BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044I03

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604733.1|  PREDICTED: acetolactate synthase small subun...    322   7e-105   Nicotiana tomentosiformis
ref|XP_006353245.1|  PREDICTED: acetolactate synthase small subun...    315   3e-101   Solanum tuberosum [potatoes]
ref|XP_004250085.1|  PREDICTED: acetolactate synthase small subun...    310   2e-99    Solanum lycopersicum
gb|EYU39756.1|  hypothetical protein MIMGU_mgv1a005187mg                308   3e-98    Erythranthe guttata [common monkey flower]
ref|XP_011084705.1|  PREDICTED: acetolactate synthase small subun...    304   5e-97    Sesamum indicum [beniseed]
ref|XP_011084704.1|  PREDICTED: acetolactate synthase small subun...    304   7e-97    Sesamum indicum [beniseed]
ref|XP_009351614.1|  PREDICTED: acetolactate synthase small subun...    302   2e-96    Pyrus x bretschneideri [bai li]
emb|CDP04139.1|  unnamed protein product                                299   1e-95    Coffea canephora [robusta coffee]
ref|XP_007212091.1|  hypothetical protein PRUPE_ppa005063mg             300   2e-95    
ref|XP_011460628.1|  PREDICTED: acetolactate synthase small subun...    300   2e-95    Fragaria vesca subsp. vesca
ref|XP_008349232.1|  PREDICTED: acetolactate synthase small subun...    296   6e-95    
ref|XP_011010159.1|  PREDICTED: acetolactate synthase small subun...    298   9e-95    Populus euphratica
ref|XP_002266924.2|  PREDICTED: acetolactate synthase small subun...    298   9e-95    Vitis vinifera
ref|XP_010558579.1|  PREDICTED: acetolactate synthase small subun...    296   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_008225227.1|  PREDICTED: acetolactate synthase small subun...    298   1e-94    Prunus mume [ume]
ref|XP_010453787.1|  PREDICTED: acetolactate synthase small subun...    297   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010492512.1|  PREDICTED: acetolactate synthase small subun...    296   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002871713.1|  hypothetical protein ARALYDRAFT_488480             296   3e-94    
ref|XP_010109954.1|  hypothetical protein L484_011796                   297   4e-94    Morus notabilis
ref|XP_002311270.2|  hypothetical protein POPTR_0008s07820g             296   5e-94    
gb|KJB78878.1|  hypothetical protein B456_013G024000                    296   6e-94    Gossypium raimondii
ref|XP_010524340.1|  PREDICTED: acetolactate synthase small subun...    296   8e-94    Tarenaya hassleriana [spider flower]
ref|XP_008371723.1|  PREDICTED: acetolactate synthase small subun...    295   1e-93    
ref|XP_010242460.1|  PREDICTED: acetolactate synthase small subun...    295   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_008443657.1|  PREDICTED: acetolactate synthase small subun...    295   2e-93    Cucumis melo [Oriental melon]
gb|KDO77106.1|  hypothetical protein CISIN_1g0114911mg                  290   3e-93    Citrus sinensis [apfelsine]
ref|NP_197133.1|  acetolactate synthase small subunit 1                 294   4e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352938.1|  PREDICTED: acetolactate synthase small subun...    293   5e-93    Pyrus x bretschneideri [bai li]
ref|XP_009126106.1|  PREDICTED: acetolactate synthase small subun...    293   5e-93    Brassica rapa
emb|CDX85509.1|  BnaA02g03040D                                          293   5e-93    
emb|CDY38123.1|  BnaC02g06500D                                          293   5e-93    Brassica napus [oilseed rape]
ref|XP_010420316.1|  PREDICTED: acetolactate synthase small subun...    293   7e-93    Camelina sativa [gold-of-pleasure]
ref|XP_002316167.1|  hypothetical protein POPTR_0010s18560g             291   1e-92    
gb|KDO77103.1|  hypothetical protein CISIN_1g0114911mg                  290   1e-92    Citrus sinensis [apfelsine]
dbj|BAH19535.1|  AT5G16290                                              293   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286862.1|  hypothetical protein CARUB_v10003921mg             292   1e-92    Capsella rubella
ref|XP_004139096.1|  PREDICTED: uncharacterized protein LOC101208212    292   2e-92    Cucumis sativus [cucumbers]
ref|XP_007028126.1|  ACT domain-containing small subunit of aceto...    292   2e-92    
ref|XP_006400166.1|  hypothetical protein EUTSA_v10016107mg             291   5e-92    Eutrema salsugineum [saltwater cress]
ref|XP_002529819.1|  acetolactate synthase, putative                    291   1e-91    Ricinus communis
gb|KHG22544.1|  Acetolactate synthase small subunit                     290   1e-91    Gossypium arboreum [tree cotton]
ref|XP_006468633.1|  PREDICTED: acetolactate synthase small subun...    290   2e-91    Citrus sinensis [apfelsine]
ref|XP_006448524.1|  hypothetical protein CICLE_v10015040mg             290   2e-91    Citrus clementina [clementine]
ref|XP_006448525.1|  hypothetical protein CICLE_v10015040mg             290   2e-91    Citrus clementina [clementine]
gb|KDP35124.1|  hypothetical protein JCGZ_10658                         290   2e-91    Jatropha curcas
gb|KJB27747.1|  hypothetical protein B456_005G007600                    289   2e-91    Gossypium raimondii
ref|XP_011085048.1|  PREDICTED: acetolactate synthase small subun...    289   4e-91    Sesamum indicum [beniseed]
ref|XP_011014725.1|  PREDICTED: acetolactate synthase small subun...    285   6e-91    Populus euphratica
emb|CDY15367.1|  BnaC04g42560D                                          288   8e-91    Brassica napus [oilseed rape]
ref|XP_011014719.1|  PREDICTED: acetolactate synthase small subun...    286   2e-90    Populus euphratica
ref|XP_002279286.1|  PREDICTED: acetolactate synthase small subun...    287   2e-90    Vitis vinifera
ref|XP_010650733.1|  PREDICTED: acetolactate synthase small subun...    286   2e-90    Vitis vinifera
ref|XP_007159564.1|  hypothetical protein PHAVU_002G248000g             286   2e-90    Phaseolus vulgaris [French bean]
emb|CAN61470.1|  hypothetical protein VITISV_043824                     285   4e-90    Vitis vinifera
ref|XP_006353111.1|  PREDICTED: acetolactate synthase small subun...    286   4e-90    Solanum tuberosum [potatoes]
ref|XP_010673855.1|  PREDICTED: acetolactate synthase small subun...    286   4e-90    Beta vulgaris subsp. vulgaris [field beet]
gb|KHG18039.1|  Acetolactate synthase small subunit                     286   5e-90    Gossypium arboreum [tree cotton]
gb|EYU36664.1|  hypothetical protein MIMGU_mgv1a005401mg                286   5e-90    Erythranthe guttata [common monkey flower]
ref|XP_009406425.1|  PREDICTED: acetolactate synthase small subun...    286   6e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002514772.1|  acetolactate synthase, putative                    287   6e-90    
ref|XP_011014695.1|  PREDICTED: acetolactate synthase small subun...    285   1e-89    Populus euphratica
ref|XP_004251994.1|  PREDICTED: acetolactate synthase small subun...    285   1e-89    Solanum lycopersicum
ref|XP_010039380.1|  PREDICTED: acetolactate synthase small subun...    283   1e-89    
ref|XP_009625351.1|  PREDICTED: acetolactate synthase small subun...    284   2e-89    Nicotiana tomentosiformis
gb|EYU17620.1|  hypothetical protein MIMGU_mgv1a005378mg                285   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_010672487.1|  PREDICTED: acetolactate synthase small subun...    285   2e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524233.1|  PREDICTED: acetolactate synthase small subun...    284   2e-89    Glycine max [soybeans]
gb|EAZ36982.1|  hypothetical protein OsJ_21322                          280   4e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010557051.1|  PREDICTED: acetolactate synthase small subun...    284   4e-89    Tarenaya hassleriana [spider flower]
ref|XP_011005277.1|  PREDICTED: acetolactate synthase small subun...    283   5e-89    Populus euphratica
gb|KHN48087.1|  Acetolactate synthase small subunit                     283   5e-89    Glycine soja [wild soybean]
ref|XP_009625350.1|  PREDICTED: acetolactate synthase small subun...    283   6e-89    Nicotiana tomentosiformis
ref|XP_003532793.1|  PREDICTED: acetolactate synthase small subun...    282   1e-88    Glycine max [soybeans]
ref|XP_011047624.1|  PREDICTED: acetolactate synthase small subun...    283   1e-88    Populus euphratica
ref|XP_003629945.1|  Acetolactate synthase small subunit                282   2e-88    Medicago truncatula
emb|CDX79442.1|  BnaC03g17780D                                          281   2e-88    
ref|XP_009782836.1|  PREDICTED: acetolactate synthase small subun...    281   2e-88    Nicotiana sylvestris
gb|KCW59207.1|  hypothetical protein EUGRSUZ_H01869                     282   2e-88    Eucalyptus grandis [rose gum]
ref|XP_010070426.1|  PREDICTED: acetolactate synthase small subun...    282   2e-88    Eucalyptus grandis [rose gum]
ref|XP_008243054.1|  PREDICTED: acetolactate synthase small subun...    282   3e-88    Prunus mume [ume]
ref|XP_007033634.1|  ACT domain-containing small subunit of aceto...    281   3e-88    
gb|EPS72034.1|  hypothetical protein M569_02723                         279   3e-88    Genlisea aurea
dbj|BAM75181.1|  B3-type transcription factor                           288   3e-88    Ricinus communis
emb|CDY19107.1|  BnaA04g18470D                                          281   3e-88    Brassica napus [oilseed rape]
emb|CDX84757.1|  BnaA03g14730D                                          281   4e-88    
ref|XP_007201965.1|  hypothetical protein PRUPE_ppa004716mg             281   5e-88    Prunus persica
ref|XP_009782832.1|  PREDICTED: acetolactate synthase small subun...    280   7e-88    Nicotiana sylvestris
ref|XP_006446200.1|  hypothetical protein CICLE_v10015044mg             280   7e-88    
ref|XP_010911692.1|  PREDICTED: acetolactate synthase small subun...    273   8e-88    Elaeis guineensis
ref|XP_010469674.1|  PREDICTED: acetolactate synthase small subun...    280   8e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009132818.1|  PREDICTED: acetolactate synthase small subun...    280   9e-88    Brassica rapa
ref|XP_006663345.1|  PREDICTED: acetolactate synthase small subun...    278   9e-88    
ref|XP_006446199.1|  hypothetical protein CICLE_v10015044mg             280   9e-88    Citrus clementina [clementine]
ref|XP_008243055.1|  PREDICTED: acetolactate synthase small subun...    280   1e-87    Prunus mume [ume]
ref|XP_006470698.1|  PREDICTED: acetolactate synthase small subun...    280   1e-87    Citrus sinensis [apfelsine]
gb|EEC67965.1|  hypothetical protein OsI_35716                          280   1e-87    Oryza sativa Indica Group [Indian rice]
gb|AAX96859.1|  acetolactate synthase, small subunit, putative          280   1e-87    Oryza sativa Japonica Group [Japonica rice]
emb|CAX48742.1|  acetohydroxyacid synthase regulatory subunit 1 p...    279   2e-87    Eupatorium cannabinum [hemp agrimony]
ref|XP_010510152.1|  PREDICTED: acetolactate synthase small subun...    280   2e-87    Camelina sativa [gold-of-pleasure]
emb|CDP08089.1|  unnamed protein product                                280   2e-87    Coffea canephora [robusta coffee]
ref|XP_010414082.1|  PREDICTED: acetolactate synthase small subun...    280   2e-87    Camelina sativa [gold-of-pleasure]
ref|NP_850174.1|  ACT domain-containing small subunit of acetolac...    278   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141188.1|  PREDICTED: acetolactate synthase small subun...    279   2e-87    Brassica rapa
ref|XP_010469676.1|  PREDICTED: acetolactate synthase small subun...    279   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009144047.1|  PREDICTED: acetolactate synthase small subun...    278   3e-87    Brassica rapa
gb|EMT17230.1|  Acetolactate synthase small subunit                     278   3e-87    
ref|XP_002310395.2|  hypothetical protein POPTR_0007s00700g             278   5e-87    
ref|NP_850172.1|  ACT domain-containing small subunit of acetolac...    278   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144045.1|  PREDICTED: acetolactate synthase small subun...    277   5e-87    Brassica rapa
ref|XP_010466593.1|  PREDICTED: acetolactate synthase small subun...    276   9e-87    Camelina sativa [gold-of-pleasure]
ref|XP_004490063.1|  PREDICTED: acetolactate synthase small subun...    277   1e-86    Cicer arietinum [garbanzo]
ref|XP_003576101.1|  PREDICTED: acetolactate synthase small subun...    277   1e-86    Brachypodium distachyon [annual false brome]
emb|CDY42070.1|  BnaA05g11160D                                          276   2e-86    Brassica napus [oilseed rape]
ref|XP_008383971.1|  PREDICTED: acetolactate synthase small subun...    277   2e-86    
ref|XP_008354318.1|  PREDICTED: acetolactate synthase small subun...    277   2e-86    
emb|CDY34514.1|  BnaC04g12850D                                          276   3e-86    Brassica napus [oilseed rape]
ref|XP_006294093.1|  hypothetical protein CARUB_v10023086mg             276   3e-86    Capsella rubella
gb|KFK31180.1|  hypothetical protein AALP_AA6G079200                    276   4e-86    Arabis alpina [alpine rockcress]
gb|AFW62902.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    268   4e-86    
ref|XP_009366239.1|  PREDICTED: acetolactate synthase small subun...    276   5e-86    Pyrus x bretschneideri [bai li]
ref|XP_002879344.1|  hypothetical protein ARALYDRAFT_482103             276   6e-86    
ref|XP_008800993.1|  PREDICTED: acetolactate synthase small subun...    275   7e-86    Phoenix dactylifera
gb|KFK31179.1|  hypothetical protein AALP_AA6G079200                    276   9e-86    Arabis alpina [alpine rockcress]
ref|XP_004490062.1|  PREDICTED: acetolactate synthase small subun...    277   1e-85    
ref|XP_006410309.1|  hypothetical protein EUTSA_v10016569mg             275   2e-85    Eutrema salsugineum [saltwater cress]
ref|XP_006664907.1|  PREDICTED: acetolactate synthase small subun...    272   2e-85    Oryza brachyantha
gb|EMS53688.1|  Acetolactate synthase small subunit                     271   3e-85    Triticum urartu
ref|XP_008367825.1|  PREDICTED: acetolactate synthase small subun...    274   3e-85    
ref|XP_008394268.1|  PREDICTED: acetolactate synthase small subun...    271   3e-85    
ref|XP_008394267.1|  PREDICTED: acetolactate synthase small subun...    271   4e-85    
gb|AAD32291.1|  putative acetolactate synthase                          273   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002452423.1|  hypothetical protein SORBIDRAFT_04g025560          273   7e-85    Sorghum bicolor [broomcorn]
ref|XP_006858758.1|  hypothetical protein AMTR_s00066p00141740          272   1e-84    Amborella trichopoda
gb|EMT12300.1|  Acetolactate synthase small subunit                     270   2e-84    
ref|XP_004288733.1|  PREDICTED: acetolactate synthase small subun...    272   3e-84    Fragaria vesca subsp. vesca
tpg|DAA41907.1|  TPA: hypothetical protein ZEAMMB73_831035              271   3e-84    
gb|KDO50434.1|  hypothetical protein CISIN_1g047033mg                   272   3e-84    Citrus sinensis [apfelsine]
ref|NP_001146158.1|  uncharacterized protein LOC100279727               271   3e-84    Zea mays [maize]
ref|XP_008677344.1|  PREDICTED: acetolactate synthase/ amino acid...    269   6e-84    Zea mays [maize]
ref|XP_008394266.1|  PREDICTED: acetolactate synthase small subun...    270   9e-84    
ref|XP_007028127.1|  Valine-tolerant 1 isoform 2                        267   1e-83    
ref|XP_009404279.1|  PREDICTED: acetolactate synthase small subun...    270   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008667813.1|  PREDICTED: uncharacterized protein LOC100279...    267   1e-83    Zea mays [maize]
ref|XP_002449227.1|  hypothetical protein SORBIDRAFT_05g006620          269   1e-83    Sorghum bicolor [broomcorn]
ref|XP_004953051.1|  PREDICTED: acetolactate synthase small subun...    269   2e-83    Setaria italica
ref|NP_001151166.1|  acetolactate synthase/ amino acid binding pr...    269   2e-83    Zea mays [maize]
ref|XP_008643958.1|  PREDICTED: uncharacterized protein LOC100381...    268   3e-83    Zea mays [maize]
dbj|BAJ92239.1|  predicted protein                                      268   3e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK41430.1|  unknown                                                 267   7e-83    Lotus japonicus
ref|XP_004504201.1|  PREDICTED: acetolactate synthase small subun...    267   1e-82    Cicer arietinum [garbanzo]
gb|KGN49589.1|  hypothetical protein Csa_5G013280                       265   1e-82    Cucumis sativus [cucumbers]
ref|XP_008800984.1|  PREDICTED: acetolactate synthase small subun...    266   5e-82    
ref|XP_008450269.1|  PREDICTED: acetolactate synthase small subun...    265   6e-82    Cucumis melo [Oriental melon]
ref|XP_003572704.1|  PREDICTED: acetolactate synthase small subun...    265   9e-82    Brachypodium distachyon [annual false brome]
ref|XP_004149627.1|  PREDICTED: uncharacterized protein LOC101212902    265   1e-81    Cucumis sativus [cucumbers]
ref|XP_008383599.1|  PREDICTED: acetolactate synthase small subun...    256   2e-78    
gb|KCW46078.1|  hypothetical protein EUGRSUZ_L00052                     252   3e-78    Eucalyptus grandis [rose gum]
gb|KCW46079.1|  hypothetical protein EUGRSUZ_L00052                     251   5e-78    Eucalyptus grandis [rose gum]
gb|KCW46077.1|  hypothetical protein EUGRSUZ_L00052                     252   6e-78    Eucalyptus grandis [rose gum]
sp|Q9SMC2.1|ILVH_NICPL  RecName: Full=Acetolactate synthase small...    253   7e-78    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KCW59209.1|  hypothetical protein EUGRSUZ_H01869                     252   8e-78    Eucalyptus grandis [rose gum]
ref|XP_009778724.1|  PREDICTED: acetolactate synthase small subun...    245   2e-77    Nicotiana sylvestris
ref|XP_009144046.1|  PREDICTED: acetolactate synthase small subun...    248   2e-76    
gb|ACN35790.1|  unknown                                                 236   6e-75    Zea mays [maize]
ref|XP_010557052.1|  PREDICTED: acetolactate synthase small subun...    241   2e-73    Tarenaya hassleriana [spider flower]
ref|XP_008450270.1|  PREDICTED: acetolactate synthase small subun...    242   2e-73    Cucumis melo [Oriental melon]
gb|EEE57346.1|  hypothetical protein OsJ_07472                          241   3e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006446198.1|  hypothetical protein CICLE_v10015044mg             242   5e-73    
ref|XP_011464846.1|  PREDICTED: LOW QUALITY PROTEIN: acetolactate...    236   3e-72    Fragaria vesca subsp. vesca
ref|XP_010414083.1|  PREDICTED: acetolactate synthase small subun...    238   5e-72    
gb|EEC73569.1|  hypothetical protein OsI_08011                          241   7e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_001773408.1|  predicted protein                                  237   8e-72    
ref|NP_850173.2|  ACT domain-containing small subunit of acetolac...    236   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002977907.1|  hypothetical protein SELMODRAFT_107328             234   6e-71    
ref|XP_002979412.1|  hypothetical protein SELMODRAFT_111081             234   7e-71    
ref|XP_011014712.1|  PREDICTED: acetolactate synthase small subun...    233   1e-69    Populus euphratica
gb|KJB27748.1|  hypothetical protein B456_005G007600                    221   3e-66    Gossypium raimondii
ref|XP_009404280.1|  PREDICTED: acetolactate synthase small subun...    217   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004504413.1|  PREDICTED: acetolactate synthase small subun...    206   1e-59    
ref|WP_015195236.1|  acetolactate synthase, small subunit               191   3e-57    Stanieria cyanosphaera
ref|WP_015227737.1|  acetolactate synthase small subunit                191   9e-57    Halothece sp. PCC 7418
ref|WP_044500522.1|  acetolactate synthase                              190   9e-57    Nostoc sp. PCC 7107
ref|WP_016870148.1|  acetolactate synthase                              190   1e-56    Fischerella muscicola
gb|KJB38012.1|  hypothetical protein B456_006G233200                    192   1e-56    Gossypium raimondii
ref|WP_015189621.1|  acetolactate synthase, small subunit               190   1e-56    Gloeocapsa sp. PCC 7428
gb|AFY41657.1|  acetolactate synthase, small subunit                    190   1e-56    Nostoc sp. PCC 7107
ref|WP_009756687.1|  MULTISPECIES: acetolactate synthase                189   2e-56    Fischerella
ref|WP_017303099.1|  acetolactate synthase                              189   2e-56    Spirulina subsalsa
ref|XP_004159602.1|  PREDICTED: uncharacterized LOC101212902            197   2e-56    
ref|WP_012598844.1|  acetolactate synthase                              189   2e-56    Cyanothece sp. PCC 7424
ref|WP_011141136.1|  acetolactate synthase                              189   3e-56    Gloeobacter violaceus
ref|WP_012626204.1|  acetolactate synthase                              189   3e-56    Cyanothece sp. PCC 7425
ref|WP_019508465.1|  acetolactate synthase                              189   3e-56    Pleurocapsa sp. PCC 7319
ref|WP_017322778.1|  acetolactate synthase                              189   4e-56    cyanobacterium PCC 7702
ref|WP_035154634.1|  acetolactate synthase                              189   4e-56    Calothrix sp. 336/3
dbj|BAB76326.1|  acetolactate synthase                                  189   5e-56    Nostoc sp. PCC 7120
ref|WP_041456726.1|  MULTISPECIES: acetolactate synthase                188   5e-56    Nostocaceae
ref|WP_036481766.1|  acetolactate synthase                              188   5e-56    Myxosarcina sp. GI1
ref|WP_015230978.1|  acetolactate synthase small subunit                188   5e-56    Dactylococcopsis salina
gb|KJB38010.1|  hypothetical protein B456_006G233200                    193   6e-56    Gossypium raimondii
ref|WP_017715305.1|  acetolactate synthase                              188   6e-56    Oscillatoria sp. PCC 10802
gb|KJB38011.1|  hypothetical protein B456_006G233200                    193   6e-56    Gossypium raimondii
ref|WP_013322899.1|  acetolactate synthase                              188   7e-56    Cyanothece sp. PCC 7822
dbj|BAH56811.1|  AT2G31810                                              191   7e-56    Arabidopsis thaliana [mouse-ear cress]
ref|WP_036020223.1|  acetolactate synthase                              188   8e-56    Leptolyngbya sp. PCC 7375
gb|EKV00810.1|  acetolactate synthase, small subunit                    189   8e-56    Leptolyngbya sp. PCC 7375
ref|WP_017313402.1|  MULTISPECIES: acetolactate synthase                188   9e-56    Hapalosiphonaceae
ref|WP_017319158.1|  acetolactate synthase                              187   1e-55    Mastigocladopsis repens
ref|WP_009767679.1|  acetolactate synthase, small subunit               187   2e-55    Oscillatoriales cyanobacterium JSC-12
ref|WP_015125829.1|  acetolactate synthase small subunit                187   2e-55    Synechococcus sp. PCC 6312
ref|WP_017286074.1|  acetolactate synthase                              187   2e-55    Leptolyngbya boryana
ref|WP_028946400.1|  acetolactate synthase                              187   2e-55    Synechocystis sp. PCC 6714
gb|KIJ82940.1|  acetolactate synthase                                   187   2e-55    Scytonema tolypothrichoides VB-61278
ref|WP_026732404.1|  acetolactate synthase                              187   2e-55    Fischerella sp. PCC 9605
ref|WP_014407139.1|  acetolactate synthase                              187   2e-55    Synechocystis
dbj|BAM54375.1|  acetolactate synthase 3 regulatory subunit             187   2e-55    Bacillus subtilis BEST7613
ref|WP_015164258.1|  acetolactate synthase small subunit                187   2e-55    Pseudanabaena sp. PCC 7367
ref|WP_015145546.1|  acetolactate synthase small subunit                187   2e-55    Pleurocapsales
ref|WP_006277889.1|  acetolactate synthase                              187   3e-55    Cylindrospermopsis
ref|WP_009342538.1|  acetolactate synthase                              187   3e-55    Aphanizomenonaceae
ref|WP_019487064.1|  MULTISPECIES: acetolactate synthase                186   3e-55    Kamptonema
ref|WP_016859689.1|  acetolactate synthase                              186   3e-55    Fischerella muscicola
ref|WP_011056724.1|  MULTISPECIES: acetolactate synthase                186   3e-55    Thermosynechococcus
ref|WP_018397129.1|  acetolactate synthase                              186   3e-55    filamentous cyanobacterium ESFC-1
ref|WP_037218077.1|  acetolactate synthase                              186   3e-55    
ref|WP_012408560.1|  acetolactate synthase                              186   4e-55    Nostoc punctiforme
ref|WP_036532119.1|  acetolactate synthase                              186   4e-55    Neosynechococcus sphagnicola
ref|WP_017740695.1|  acetolactate synthase                              186   4e-55    Scytonema hofmannii
ref|WP_010873502.1|  acetolactate synthase                              186   4e-55    
emb|CBN54307.1|  acetolactate synthase 3 regulatory subunit [ [         187   4e-55    [Oscillatoria] sp. PCC 6506
ref|WP_015139015.1|  acetolactate synthase small subunit                186   5e-55    Nostoc sp. PCC 7524
gb|ABB17340.1|  acetolactate synthase                                   186   5e-55    Coleofasciculus chthonoplastes IPPAS B-270
ref|WP_026099569.1|  acetolactate synthase                              186   5e-55    Prochlorothrix hollandica
ref|WP_012595734.1|  MULTISPECIES: acetolactate synthase                186   6e-55    Cyanothece
ref|WP_009631788.1|  acetolactate synthase, small subunit               186   6e-55    Synechocystis sp. PCC 7509
ref|WP_008314262.1|  acetolactate synthase, small subunit               186   7e-55    Leptolyngbya sp. PCC 6406
ref|WP_007304707.1|  acetolactate synthase                              186   7e-55    Crocosphaera watsonii
ref|WP_015196808.1|  acetolactate synthase small subunit                186   7e-55    Calothrix parietina
gb|KIE11579.1|  acetolactate synthase                                   186   7e-55    Tolypothrix bouteillei VB521301
ref|WP_006453777.1|  acetolactate synthase                              185   8e-55    Synechococcus sp. PCC 7335
ref|WP_041040884.1|  acetolactate synthase                              185   8e-55    Tolypothrix campylonemoides
ref|WP_010477416.1|  MULTISPECIES: acetolactate synthase                185   8e-55    Acaryochloris
ref|WP_023076484.1|  acetolactate small subunit                         186   9e-55    Leptolyngbya sp. Heron Island J
ref|WP_041622928.1|  acetolactate synthase                              185   9e-55    Oscillatoria nigro-viridis
emb|CCI14937.1|  Acetolactate synthase small subunit                    186   9e-55    Microcystis aeruginosa PCC 9806
ref|WP_039887977.1|  acetolactate synthase                              185   1e-54    Microcoleus vaginatus
ref|WP_043999720.1|  acetolactate synthase                              185   1e-54    Microcystis aeruginosa
ref|WP_017660939.1|  acetolactate synthase                              185   1e-54    Geitlerinema sp. PCC 7105
ref|WP_006527479.1|  acetolactate synthase, small subunit               185   1e-54    Gloeocapsa sp. PCC 73106
emb|CCI18700.1|  Acetolactate synthase small subunit                    185   1e-54    Microcystis aeruginosa PCC 9807
dbj|GAL94295.1|  acetolactate synthase small subunit                    185   1e-54    Microcystis aeruginosa NIES-44
ref|WP_024971071.1|  acetolactate synthase                              185   1e-54    Microcystis aeruginosa
ref|WP_044304865.1|  acetolactate synthase                              185   1e-54    Richelia intracellularis
ref|WP_006508477.1|  acetolactate synthase, small subunit               185   1e-54    Xenococcus sp. PCC 7305
ref|WP_002732118.1|  acetolactate synthase                              185   1e-54    Microcystis
ref|WP_002743360.1|  MULTISPECIES: acetolactate synthase                185   1e-54    Microcystis
ref|WP_039728011.1|  MULTISPECIES: acetolactate synthase                185   1e-54    Lyngbya confervoides
emb|CCH67841.1|  Acetolactate synthase small subunit                    185   2e-54    Richelia intracellularis HH01
gb|EGK83985.1|  acetolactate synthase, small subunit                    185   2e-54    Microcoleus vaginatus FGP-2
ref|WP_040935206.1|  acetolactate synthase                              184   2e-54    
gb|AFZ05551.1|  acetolactate synthase, small subunit                    185   2e-54    Oscillatoria nigro-viridis PCC 7112
ref|WP_019492237.1|  acetolactate synthase                              184   2e-54    Calothrix
ref|WP_015180717.1|  acetolactate synthase small subunit                184   2e-54    Microcoleus sp. PCC 7113
ref|WP_040931574.1|  acetolactate synthase                              184   2e-54    
ref|WP_026073042.1|  acetolactate synthase                              184   2e-54    Nodosilinea nodulosa
ref|WP_035996987.1|  acetolactate synthase                              184   2e-54    [Leptolyngbya] sp. JSC-1
ref|WP_006196435.1|  acetolactate synthase                              184   2e-54    Nodularia spumigena
ref|WP_023066701.1|  acetolactate synthase, small subunit               184   3e-54    Lyngbya aestuarii
ref|WP_015205120.1|  acetolactate synthase small subunit                184   3e-54    Crinalium epipsammum
ref|WP_040655402.1|  acetolactate synthase                              184   3e-54    Rubidibacter lacunae
ref|WP_016875905.1|  acetolactate synthase                              184   3e-54    Chlorogloeopsis fritschii
gb|ERN42020.1|  acetolactate synthase, small subunit                    184   3e-54    Rubidibacter lacunae KORDI 51-2
ref|WP_008188861.1|  acetolactate synthase                              184   3e-54    Moorea producens
ref|WP_015171191.1|  acetolactate synthase small subunit                183   4e-54    Geitlerinema sp. PCC 7407
ref|WP_015126609.1|  acetolactate synthase small subunit                183   5e-54    Calothrix sp. PCC 7507
ref|WP_015083282.1|  acetolactate synthase small subunit                183   5e-54    Anabaena sp. 90
ref|WP_027843130.1|  acetolactate synthase                              183   6e-54    Mastigocoleus testarum
ref|WP_009547809.1|  MULTISPECIES: acetolactate synthase                183   7e-54    Cyanothece
gb|ACB49979.1|  acetolactate synthase small subunit                     183   7e-54    Cyanothece sp. ATCC 51142
ref|WP_011611481.1|  acetolactate synthase                              183   8e-54    
ref|WP_015209539.1|  acetolactate synthase, small subunit               182   1e-53    
ref|WP_023175301.1|  acetolactate synthase 3 regulatory subunit         182   1e-53    
ref|WP_015154365.1|  acetolactate synthase small subunit                182   2e-53    
ref|WP_015146637.1|  acetolactate synthase small subunit                182   2e-53    
ref|WP_015219133.1|  acetolactate synthase small subunit                182   2e-53    
ref|WP_035993822.1|  acetolactate synthase                              182   2e-53    
ref|WP_015213275.1|  acetolactate synthase, small subunit               182   2e-53    
ref|WP_028084672.1|  acetolactate synthase                              182   2e-53    
ref|WP_017294692.1|  acetolactate synthase                              181   2e-53    
ref|WP_013190466.1|  acetolactate synthase                              181   3e-53    
ref|XP_011400735.1|  Acetolactate synthase small subunit                190   3e-53    
ref|WP_019502773.1|  acetolactate synthase                              181   3e-53    
ref|WP_015116444.1|  acetolactate synthase small subunit                181   3e-53    
gb|EAZ92294.1|  acetolactate synthase small subunit                     181   3e-53    
ref|WP_039716657.1|  acetolactate synthase                              181   3e-53    
ref|WP_035798716.1|  acetolactate synthase                              181   4e-53    
ref|WP_006103562.1|  acetolactate synthase                              181   4e-53    
ref|WP_040688882.1|  acetolactate synthase                              181   4e-53    
ref|WP_017651464.1|  acetolactate synthase                              180   7e-53    
gb|ELS31853.1|  acetolactate synthase, small subunit                    180   8e-53    
ref|WP_029632809.1|  acetolactate synthase [                            180   1e-52    
ref|WP_009787902.1|  acetolactate synthase                              180   1e-52    
ref|WP_027403392.1|  acetolactate synthase                              179   1e-52    
ref|WP_016950575.1|  acetolactate synthase                              179   2e-52    
ref|WP_044106118.1|  acetolactate synthase                              179   2e-52    
ref|WP_015167340.1|  acetolactate synthase small subunit                179   2e-52    
ref|WP_039747340.1|  acetolactate synthase                              179   2e-52    
ref|WP_015158120.1|  acetolactate synthase, small subunit               179   2e-52    
ref|WP_026786440.1|  MULTISPECIES: acetolactate synthase                178   6e-52    
ref|WP_006625441.1|  MULTISPECIES: acetolactate synthase                178   6e-52    
dbj|BAI88928.1|  acetolactate synthase III small subunit                178   7e-52    
ref|NP_045137.1|  acetohydroxyacid synthase small subunit               177   7e-52    
ref|WP_006618438.1|  acetolactate synthase                              177   8e-52    
ref|WP_012308298.1|  acetolactate synthase                              177   1e-51    
ref|YP_009051154.1|  acetohydroxyacid synthase small subunit            177   1e-51    
ref|WP_011243982.1|  MULTISPECIES: acetolactate synthase                177   2e-51    
ref|WP_015223783.1|  acetolactate synthase small subunit                176   2e-51    
ref|WP_024545091.1|  acetolactate synthase                              176   2e-51    
ref|WP_041763544.1|  acetolactate synthase                              176   2e-51    
gb|AFY38678.1|  acetolactate synthase, small subunit                    176   3e-51    
ref|WP_023846216.1|  acetolactate synthase, small subunit               176   4e-51    
ref|WP_015325139.1|  acetolactate synthase, small subunit               175   4e-51    
ref|WP_030007373.1|  acetolactate synthase                              176   5e-51    
ref|WP_028952581.1|  acetolactate synthase                              175   9e-51    
sp|Q9MS98.1|ILVH_GALSU  RecName: Full=Acetolactate synthase small...    174   2e-50    
ref|WP_038545989.1|  acetolactate synthase                              173   4e-50    
ref|WP_011032620.1|  acetolactate synthase                              172   5e-50    
ref|XP_005851575.1|  hypothetical protein CHLNCDRAFT_29593              179   5e-50    
ref|WP_011933543.1|  acetolactate synthase                              173   6e-50    
ref|WP_015051056.1|  acetolactate synthase                              172   9e-50    
ref|WP_011305258.1|  acetolactate synthase                              172   1e-49    
ref|WP_038653708.1|  acetolactate synthase                              172   1e-49    
ref|WP_006041820.1|  acetolactate synthase                              172   1e-49    
gb|KDO39820.1|  hypothetical protein CISIN_1g015044mg                   179   1e-49    
ref|YP_001293521.1|  acetohydroxyacid synthetase small subunit          172   2e-49    
ref|XP_002948458.1|  hypothetical protein VOLCADRAFT_73781              180   2e-49    
ref|WP_011294852.1|  acetolactate synthase                              171   2e-49    
ref|WP_011127547.1|  acetolactate synthase                              172   2e-49    
ref|WP_015411261.1|  Acetolactate synthase small subunit                171   2e-49    
ref|WP_011364939.1|  acetolactate synthase                              171   2e-49    
ref|WP_038553682.1|  acetolactate synthase                              171   3e-49    
ref|WP_011430944.1|  acetolactate synthase                              171   5e-49    
ref|XP_001700185.1|  acetolactate synthase, small subunit               179   6e-49    
ref|WP_012195782.1|  acetolactate synthase                              170   6e-49    
ref|WP_028309200.1|  acetolactate synthase                              170   6e-49    
ref|WP_011023691.1|  acetolactate synthase                              169   7e-49    
ref|NP_050708.1|  acetohydroxyacid synthase small subunit               170   7e-49    
ref|WP_043692189.1|  acetolactate synthase                              170   8e-49    
ref|WP_036920271.1|  acetolactate synthase                              169   1e-48    
gb|AHF64430.1|  acetolactate synthase, small subunit                    169   1e-48    
dbj|BAA22822.1|  acetolactate synthase                                  169   2e-48    
gb|KGK97747.1|  acetolactate synthase                                   169   2e-48    
ref|WP_019474688.1|  acetolactate synthase                              169   2e-48    
ref|WP_011432604.1|  acetolactate synthase                              169   2e-48    
ref|YP_008965793.1|  acetolactate synthase small subunit                169   2e-48    
gb|KCZ72887.1|  acetolactate synthase, small subunit                    168   2e-48    
ref|WP_007100311.1|  acetolactate synthase                              169   3e-48    
ref|WP_010302742.1|  acetolactate synthase                              169   3e-48    
ref|WP_011825509.1|  acetolactate synthase                              169   3e-48    
gb|AIA61091.1|  acetohydroxyacid synthase small subunit (chloropl...    168   3e-48    
ref|WP_028051312.1|  acetolactate synthase                              168   3e-48    
ref|WP_041587884.1|  acetolactate synthase                              168   3e-48    
ref|NP_848948.1|  aceohydroxyacid synthase small subunit                168   3e-48    
gb|AJO68499.1|  acetohydroxyacid synthase small subunit                 168   4e-48    
ref|WP_006171772.1|  acetolactate synthase                              168   5e-48    
gb|KDD76489.1|  hypothetical protein H632_c209p2                        176   5e-48    
ref|WP_015052687.1|  acetolactate synthase                              167   5e-48    
ref|WP_035832248.1|  acetolactate synthase                              168   5e-48    
ref|XP_005705049.1|  [pt] acetolactate synthase I/III small subunit     167   5e-48    
ref|WP_036914369.1|  MULTISPECIES: acetolactate synthase                168   6e-48    
ref|WP_009790304.1|  acetolactate synthase                              168   6e-48    
ref|WP_011498832.1|  acetolactate synthase                              167   6e-48    
ref|WP_015108799.1|  acetolactate synthase small subunit                168   6e-48    
ref|XP_005648800.1|  acetolactate synthase                              179   6e-48    
ref|WP_036896778.1|  acetolactate synthase                              167   6e-48    
gb|ADG81247.1|  acetolactate synthase, small subunit                    168   6e-48    
ref|WP_011359483.1|  acetolactate synthase                              167   7e-48    
ref|WP_011130547.1|  acetolactate synthase                              167   7e-48    
ref|WP_013037303.1|  acetolactate synthase                              167   8e-48    
ref|WP_011618839.1|  acetolactate synthase                              167   9e-48    
ref|WP_036902537.1|  acetolactate synthase                              167   9e-48    
ref|WP_013897834.1|  acetolactate synthase                              167   1e-47    
ref|WP_011343452.1|  acetolactate synthase                              167   1e-47    
ref|YP_007878297.1|  acetolactate synthase small subunit                167   1e-47    
ref|WP_015738272.1|  acetolactate synthase                              166   1e-47    
ref|WP_007098346.1|  acetolactate synthase                              167   2e-47    
ref|XP_003081855.1|  Acetolactate synthase, small subunit (ISS)         175   3e-47    
emb|CEF99544.1|  Acetolactate synthase, small subunit, C-terminal       175   3e-47    
ref|YP_009019682.1|  acetolactate synthase small subunit                166   3e-47    
ref|WP_027717595.1|  acetolactate synthase                              166   4e-47    
ref|WP_015756230.1|  acetolactate synthase                              165   4e-47    
ref|WP_006910483.1|  acetolactate synthase                              166   5e-47    
ref|WP_026100701.1|  acetolactate synthase                              165   5e-47    
ref|WP_036918354.1|  MULTISPECIES: acetolactate synthase                165   6e-47    
ref|WP_032518375.1|  acetolactate synthase                              165   6e-47    
gb|AIA21259.1|  acetolactate synthase small subunit                     165   6e-47    
ref|WP_025930661.1|  acetolactate synthase                              165   6e-47    
ref|WP_011818754.1|  MULTISPECIES: acetolactate synthase                165   6e-47    
ref|YP_003359223.1|  acetohydroxyacid synthase small subunit            165   6e-47    
ref|WP_010315670.1|  acetolactate synthase                              165   7e-47    
ref|WP_006852196.1|  acetolactate synthase                              165   7e-47    
ref|WP_029894787.1|  acetolactate synthase                              164   8e-47    
ref|YP_008144692.1|  acetolactate synthase small subunit                165   9e-47    
ref|WP_011125403.1|  MULTISPECIES: acetolactate synthase                164   1e-46    
ref|WP_012008031.1|  MULTISPECIES: acetolactate synthase                164   1e-46    
ref|WP_029966267.1|  acetolactate synthase                              164   1e-46    
ref|WP_018125420.1|  acetolactate synthase                              164   1e-46    
ref|YP_063674.1|  acetohydroxyacid synthase small subunit               164   1e-46    
dbj|BAA22831.1|  acetolactate synthase                                  164   1e-46    
ref|WP_011936109.1|  acetolactate synthase                              164   2e-46    
ref|WP_011376800.1|  acetolactate synthase                              164   2e-46    
ref|WP_028574494.1|  acetolactate synthase                              163   2e-46    
ref|WP_020879762.1|  acetolactate synthase, small subunit               163   3e-46    
ref|WP_027356889.1|  acetolactate synthase                              163   3e-46    
ref|WP_012031699.1|  acetolactate synthase                              163   3e-46    
dbj|GAK59322.1|  acetolactate synthase, small subunit                   162   3e-46    
ref|WP_025961335.1|  acetolactate synthase                              163   4e-46    
ref|YP_009027514.1|  acetolactate synthase small subunit                163   4e-46    
ref|WP_020887632.1|  acetolactate synthase, small subunit               162   4e-46    
ref|WP_025939160.1|  acetolactate synthase                              163   4e-46    
gb|ADU62786.1|  acetolactate synthase, small subunit                    162   4e-46    
ref|WP_041271396.1|  acetolactate synthase                              162   4e-46    
ref|YP_536911.1|  acetohydroxyacid synthase small subunit               162   5e-46    
ref|YP_007947759.1|  acetohydroxyacid synthase small subunit            162   6e-46    
gb|AIA21465.1|  acetolactate synthase small subunit                     162   6e-46    
ref|YP_007627456.1|  acetolactate synthase small subunit                162   7e-46    
ref|WP_044664993.1|  acetolactate synthase                              162   8e-46    
emb|CEO88936.1|  acetolactate synthase III, thiamin-dependent, sm...    162   8e-46    
ref|WP_015413662.1|  Acetolactate synthase small subunit                162   1e-45    
ref|WP_011393740.1|  acetolactate synthase                              162   1e-45    
ref|WP_011132788.1|  acetolactate synthase                              162   1e-45    
ref|WP_042685047.1|  acetolactate synthase                              161   1e-45    
ref|WP_011820626.1|  acetolactate synthase                              161   2e-45    
ref|WP_003513130.1|  acetolactate synthase                              161   2e-45    
ref|XP_001420250.1|  predicted protein                                  169   2e-45    
gb|AFC39900.1|  acetohydroxyacid synthase small subunit                 161   2e-45    
gb|AII48755.1|  acetolactate synthase                                   161   2e-45    
ref|WP_014320961.1|  acetolactate synthase                              160   2e-45    
ref|WP_012282598.1|  acetolactate synthase                              160   3e-45    
ref|WP_011368061.1|  acetolactate synthase                              160   3e-45    
ref|NP_001168069.1|  uncharacterized protein LOC100381801               166   3e-45    
ref|WP_038290690.1|  acetolactate synthase [                            160   3e-45    
ref|NP_053840.1|  acetohydroxyacid synthase small subunit               160   3e-45    
ref|WP_013194214.1|  acetolactate synthase                              160   4e-45    
ref|WP_013823910.1|  acetolactate synthase                              160   4e-45    
ref|WP_014257070.1|  acetolactate synthase [                            160   4e-45    
gb|KGN66640.1|  hypothetical protein Csa_1G652230                       159   4e-45    
gb|AIY89502.1|  Acetolactate synthase small subunit                     160   4e-45    
ref|YP_002048700.1|  acetolactate synthase III small subunit            160   4e-45    
gb|AGL00152.1|  acetolactate synthase, small subunit                    160   4e-45    
ref|WP_041285150.1|  acetolactate synthase                              160   5e-45    
ref|YP_003002120.1|  acetolactate synthase small subunit                160   5e-45    
ref|WP_028572765.1|  MULTISPECIES: acetolactate synthase                159   6e-45    
gb|KDE54705.1|  acetolactate synthase                                   160   6e-45    
ref|WP_034108190.1|  acetolactate synthase                              160   6e-45    
ref|WP_020001612.1|  MULTISPECIES: acetolactate synthase                159   6e-45    
ref|WP_034424029.1|  acetolactate synthase                              159   7e-45    
ref|WP_010681301.1|  acetolactate synthase                              159   8e-45    
ref|WP_034125045.1|  acetolactate synthase                              159   2e-44    
ref|WP_034414259.1|  acetolactate synthase                              158   2e-44    
ref|WP_035064085.1|  acetolactate synthase                              158   2e-44    
gb|AFR24747.1|  acetolactate synthase small subunit                     158   2e-44    
gb|ETX06225.1|  acetolactate synthase                                   158   3e-44    
ref|WP_027363981.1|  acetolactate synthase                              158   3e-44    
ref|WP_028587126.1|  acetolactate synthase                              157   3e-44    
ref|WP_027338794.1|  acetolactate synthase                              157   3e-44    
ref|WP_008410933.1|  putative acetolactate synthase small subunit       157   4e-44    
ref|WP_025979293.1|  acetolactate synthase                              157   4e-44    
ref|WP_015752088.1|  acetolactate synthase                              157   5e-44    
ref|YP_001936325.1|  acetohydroxyacid synthase small subunit            157   6e-44    
ref|WP_044602782.1|  acetolactate synthase                              157   6e-44    
ref|WP_008868801.1|  acetolactate synthase                              157   6e-44    
ref|WP_012301503.1|  acetolactate synthase                              157   7e-44    
ref|WP_013289783.1|  acetolactate synthase                              157   7e-44    
ref|WP_029955291.1|  acetolactate synthase                              157   9e-44    
ref|WP_015926776.1|  acetolactate synthase [                            157   9e-44    
ref|WP_013681719.1|  acetolactate synthase                              156   1e-43    
ref|WP_025209759.1|  acetolactate synthase                              156   1e-43    
ref|WP_018249315.1|  acetolactate synthase                              156   1e-43    
ref|WP_018205332.1|  MULTISPECIES: hypothetical protein                 156   1e-43    
ref|WP_007521186.1|  acetolactate synthase                              156   1e-43    
ref|WP_013413135.1|  acetolactate synthase                              156   2e-43    
ref|WP_041722489.1|  acetolactate synthase                              156   2e-43    
ref|WP_015907091.1|  acetolactate synthase                              156   2e-43    
ref|WP_022662724.1|  acetolactate synthase                              155   2e-43    
ref|WP_011843915.1|  acetolactate synthase                              155   2e-43    
ref|WP_011916693.1|  acetolactate synthase                              156   2e-43    
ref|WP_013328365.1|  acetolactate synthase                              155   2e-43    
ref|WP_017951674.1|  hypothetical protein                               155   2e-43    
ref|WP_027178078.1|  acetolactate synthase                              155   2e-43    
ref|WP_013404018.1|  MULTISPECIES: acetolactate synthase                155   3e-43    
ref|WP_013411358.1|  acetolactate synthase                              155   3e-43    
ref|WP_012611310.1|  acetolactate synthase                              155   3e-43    
ref|WP_014868187.1|  acetolactate synthase                              155   3e-43    
ref|WP_004629443.1|  MULTISPECIES: acetolactate synthase, small s...    155   4e-43    
ref|WP_022669730.1|  acetolactate synthase                              155   4e-43    
ref|WP_003544157.1|  acetolactate synthase                              155   5e-43    
ref|WP_015842926.1|  acetolactate synthase                              154   6e-43    
dbj|BAD19594.1|  putative acetolactate synthase small subunit           159   7e-43    
ref|WP_015325982.1|  acetolactate synthase, small subunit               154   7e-43    



>ref|XP_009604733.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=402

 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 178/245 (73%), Positives = 190/245 (78%), Gaps = 16/245 (7%)
 Frame = +1

Query  58   MAAAVSQCPGVRKSFLPAFSKP---GPLNRAVFRPKVTHFAPFVANA-----------AG  195
            MAAA +     +K+ LPA SKP     L R  F   +   +P +  A             
Sbjct  1    MAAAATATGLSKKNLLPALSKPTLPSKLGRRNFSFGLKKLSPVITTANAVASSSGSGSTD  60

Query  196  KGAETVAvsvsspppsvs--RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN  369
             GA +V  +    PPS S  RVK HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN
Sbjct  61   NGAVSVTRTAPPLPPSPSTSRVKCHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN  120

Query  370  KDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAE  549
            KDKALFTIVVSGT+KVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNA+ STKAE
Sbjct  121  KDKALFTIVVSGTEKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNADASTKAE  180

Query  550  IMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMG  729
            IMWL DIFR K+VDISEHF+TIEVTGDPGKMAAVLRNL KFGIKELARTGKIALRREKMG
Sbjct  181  IMWLVDIFRGKIVDISEHFLTIEVTGDPGKMAAVLRNLSKFGIKELARTGKIALRREKMG  240

Query  730  ETAPF  744
            E APF
Sbjct  241  EDAPF  245


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HTIS+ V +  G++N I GV +RRGYN++SLAVG  + + L   T VV GTD+ + +
Sbjct  314  LRSHTISMLVNNAPGVLNLITGVISRRGYNVQSLAVGPAESEGLSRITTVVPGTDETIGK  373

Query  427  VVEQLNKLVNVLKV  468
            +V+Q  KLV++ +V
Sbjct  374  LVKQFYKLVDIHEV  387



>ref|XP_006353245.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=490

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 191/240 (80%), Gaps = 15/240 (6%)
 Frame = +1

Query  70   VSQCP--GVRK-SFLPAFSKPGPLNRAV---FRPKVTHFAPF--VANAAGKGAE------  207
            VS+ P  G+RK S LPA  KP    R     F   +  F+P   +A++ G G+       
Sbjct  11   VSKIPSTGLRKKSLLPALIKPASPGRTSSRNFNFGLKKFSPVNVIASSNGSGSTDNGAVS  70

Query  208  -TVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  384
             T    ++ P PS SRVK HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL
Sbjct  71   VTRTAPLTPPKPSSSRVKSHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  130

Query  385  FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLA  564
            FTIVVSGT+KVLQQVVEQLNKLVNV KVEDLSREPQVERELMLIKLNA+ +TKAEIMWL 
Sbjct  131  FTIVVSGTEKVLQQVVEQLNKLVNVWKVEDLSREPQVERELMLIKLNADATTKAEIMWLV  190

Query  565  DIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            DIFR K+VDISEHF+TIEVTGDPGKMAAVLRNL KFGI ELARTGKIALRREKMGE APF
Sbjct  191  DIFRGKIVDISEHFLTIEVTGDPGKMAAVLRNLSKFGISELARTGKIALRREKMGEDAPF  250


 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I+GV +RRGYN++SLAVG  + + L   T VV GTD+ + +
Sbjct  318  IRSHTLSMLVNNAPGVLNLISGVISRRGYNVQSLAVGPAETEGLSRITTVVPGTDETIGK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q NKL++V +V+D++  P  ERELMLIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVKQFNKLIDVHEVQDITHLPFAERELMLIKVAANAAARRDVLDIASIFRAKPVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+E+TGD  K+ A+ R L+ +GI E+ARTG++AL RE
Sbjct  438  VTLELTGDFNKLLALQRLLEPYGICEVARTGRVALVRE  475



>ref|XP_004250085.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=490

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 187/240 (78%), Gaps = 15/240 (6%)
 Frame = +1

Query  70   VSQCP--GVRK-SFLPAFSKPGPLNRAVFRPKVTHFAPFV-------ANAAG---KGAET  210
            VSQ P  G+RK S LPA   P    R   R     F   +       +N +G    GA  
Sbjct  11   VSQIPLTGMRKNSLLPALINPASPGRTGSRNISFGFKNVLPVNVIASSNGSGSTDNGAVY  70

Query  211  VAvsv--sspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  384
            VA +   +   P+ SRVK HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL
Sbjct  71   VARTAPVTPSSPASSRVKSHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  130

Query  385  FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLA  564
            FTIVVSGT+KVLQQVVEQLNKLVNV KVEDLSREPQVERELMLIKLNA+ +TKAEIMWL 
Sbjct  131  FTIVVSGTEKVLQQVVEQLNKLVNVWKVEDLSREPQVERELMLIKLNADATTKAEIMWLV  190

Query  565  DIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            DIFR K+VDIS+HF+TIEVTGDPGKMAAVLRNL KFGI ELARTGKIALRREKMGE APF
Sbjct  191  DIFRGKIVDISDHFLTIEVTGDPGKMAAVLRNLSKFGISELARTGKIALRREKMGEDAPF  250


 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I+GV +RRGYN++SLAVG  + + L   T VV GTD+ + +
Sbjct  318  IRSHTLSMLVNNAPGVLNLISGVISRRGYNVQSLAVGPAETEGLSRITTVVPGTDETIGK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q NKL++V +V D++  P  ERELMLIK+ +  + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVKQFNKLIDVHEVRDITHLPFAERELMLIKVASNAAARRDVLDIASIFRAKPVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+E+TGD  K+ A+ R L+ +GI E+ARTG++AL RE
Sbjct  438  VTLELTGDFNKLLALQRLLEPYGICEVARTGRVALIRE  475



>gb|EYU39756.1| hypothetical protein MIMGU_mgv1a005187mg [Erythranthe guttata]
Length=494

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 175/244 (72%), Positives = 189/244 (77%), Gaps = 25/244 (10%)
 Frame = +1

Query  70   VSQCP--GVRK-------SFLPAFSKPGPLNRAVFRPKVTHFAPFVANAAGKGAET----  210
            VSQCP  GV K       S L +  + G +N   FR    H    +ANAA  G  +    
Sbjct  11   VSQCPITGVEKKKNRLHFSKLSSRVQFGGIN---FR---NHKQLLLANAAVNGGSSENGG  64

Query  211  ------VAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  372
                   +     PPP+ +R KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+
Sbjct  65   AVSVTRSSSPSPPPPPATTRAKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQ  124

Query  373  DKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEI  552
            DKALFTIVVSGT+KVLQQVVEQLNKLVNVLKVEDLS+E QVERELMLIKLNA+ +TK EI
Sbjct  125  DKALFTIVVSGTEKVLQQVVEQLNKLVNVLKVEDLSKEAQVERELMLIKLNADSNTKGEI  184

Query  553  MWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGE  732
            MWL DIFRA VVDISEH +TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGE
Sbjct  185  MWLVDIFRASVVDISEHTLTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGE  244

Query  733  TAPF  744
            TAPF
Sbjct  245  TAPF  248


 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I GV +RRGYNI+SLAVG  + + +   T VV GTD+ + +
Sbjct  322  LQSHTLSMVVNNSPGVLNLITGVISRRGYNIQSLAVGPAESEGISRITTVVPGTDESIGK  381

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q  KLV++ +V+D++  P  ERELMLIK+ A  S + +++ +A+IFRAK VD+S+H 
Sbjct  382  LVQQFYKLVDIHEVQDMTHLPFAERELMLIKIAANASARRDVLDIANIFRAKPVDVSDHT  441

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+EVTGD  KM A+   L+ +GI E+ARTG++AL RE
Sbjct  442  VTLEVTGDFNKMLALQNLLEPYGICEVARTGRVALARE  479



>ref|XP_011084705.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=493

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            R KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT+K+LQQV
Sbjct  83   RTKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKALFTIVVCGTEKILQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNVLKVEDLSREPQVERELMLIKLNA+ +TK EIMWL DIFR KVVDISE+ +
Sbjct  143  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNADSNTKGEIMWLVDIFRGKVVDISENTL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AVLRNL+KFGIKELARTGKIALRREKMGETAPF
Sbjct  203  TIEVTGDPGKMVAVLRNLRKFGIKELARTGKIALRREKMGETAPF  247


 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + +   T VV+GTD+ + +
Sbjct  321  LQSHTLSLLVNNSPGVLNLVTGVVSRRGYNIQSLAVGPAETEGISRITTVVAGTDESIGK  380

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q  KLV+V +V+D++  P  ERELMLIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  381  LVKQFYKLVDVYEVQDMTHLPFAERELMLIKIAANAAARRDVLDIASIFRAKPVDVSDHT  440

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+EVTGD  KM A+   L+ +GI E+ARTG++AL RE
Sbjct  441  VTLEVTGDFNKMLALQNLLEPYGICEVARTGRVALVRE  478



>ref|XP_011084704.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
 ref|XP_011084706.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=493

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            R KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT+K+LQQV
Sbjct  83   RTKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKALFTIVVCGTEKILQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNVLKVEDLSREPQVERELMLIKLNA+ +TK EIMWL DIFR KVVDISE+ +
Sbjct  143  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNADSNTKGEIMWLVDIFRGKVVDISENTL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AVLRNL+KFGIKELARTGKIALRREKMGETAPF
Sbjct  203  TIEVTGDPGKMVAVLRNLRKFGIKELARTGKIALRREKMGETAPF  247


 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + +   T VV+GTD+ + +
Sbjct  321  LQSHTLSLLVNNSPGVLNLVTGVVSRRGYNIQSLAVGPAETEGISRITTVVAGTDESIGK  380

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q  KLV+V +V+D++  P  ERELMLIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  381  LVKQFYKLVDVYEVQDMTHLPFAERELMLIKIAANAAARRDVLDIASIFRAKPVDVSDHT  440

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            VT+EVTGD  KM A+   L+ +GI E+ARTG++AL RE 
Sbjct  441  VTLEVTGDFNKMLALQNLLEPYGICEVARTGRVALVRES  479



>ref|XP_009351614.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=479

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 187/241 (78%), Gaps = 16/241 (7%)
 Frame = +1

Query  58   MAAAVS---------QCPGVRKSFLPAFSKPGPLNRAVFRP---KVTHFAPFVANAAGKG  201
            MAAAVS         Q P  R  F   FS    L R   RP   K       V +A+   
Sbjct  1    MAAAVSSPCSPSLAAQKPSFRVDFRHGFSTSFDLGRQ--RPLKWKSCGLKKLVVSASTGN  58

Query  202  AETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA  381
            A  V+VS S P  + S+VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA
Sbjct  59   A--VSVSDSVPSLTSSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA  116

Query  382  LFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWL  561
            LFTIVVSGT+KVL+QVVEQLNKLVNV+KVED+SREPQVERELMLIKLNA+ ST+AEIMWL
Sbjct  117  LFTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEIMWL  176

Query  562  ADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAP  741
             DIFRAK+VDISE  +T+EVTGDPGK+ AV RNL KFGIKELARTGKIALRREKMG TAP
Sbjct  177  VDIFRAKIVDISEQSLTVEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRREKMGATAP  236

Query  742  F  744
            F
Sbjct  237  F  237


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  + +
Sbjct  307  VRSHTLSMIVNDSPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTEDSISK  366

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  367  LVQQLHKLIDLHEVRDITHLPFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDHT  426

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE
Sbjct  427  VTLELTGDLNKMVALQKLLEPYGICEVARTGRVALERE  464



>emb|CDP04139.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+K LQQVV
Sbjct  47   VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKTLQQVV  106

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNVLKVEDLSREPQVERELMLIKL+A+  T AE+MWL DIFRAK+VDISEHF+T
Sbjct  107  EQLNKLVNVLKVEDLSREPQVERELMLIKLHADSETIAEVMWLKDIFRAKIVDISEHFLT  166

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            +EVTGDPGK AAVLRN  KFGIKE+ARTG+IALRREKMGETAPF
Sbjct  167  VEVTGDPGKTAAVLRNFSKFGIKEVARTGRIALRREKMGETAPF  210


 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GV +RRGYN++SLAVG  + + +   T VV GT++ + +
Sbjct  280  LRSHTLSMLVNDSPGVLNLVTGVISRRGYNVQSLAVGPAEKEGVSRITTVVPGTNETIGK  339

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q  KLV+V +V+D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  340  LVQQFYKLVDVHEVQDITPLPFAERELMLIKVAVNAAARRDVLDIASIFRAKPVDVSDHT  399

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE
Sbjct  400  ITLELTGDFNKMLALQKLLEPYGICEVARTGRVALVRE  437



>ref|XP_007212091.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
 gb|EMJ13290.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
Length=479

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/239 (70%), Positives = 186/239 (78%), Gaps = 12/239 (5%)
 Frame = +1

Query  58   MAAAVS---------QCPGVRKSFLPAFSKPGPL-NRAVFRPKVTHFAPFVANAAGKGAE  207
            MAAAVS         Q P +R  F   F K     ++   + K  H    V +A+   A 
Sbjct  1    MAAAVSSPCSTPLMTQKPSLRVDFRHGFLKSFDFGHQKPIKWKTFHLKELVVSASTDNA-  59

Query  208  TVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALF  387
             V+V+   P  + S+VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALF
Sbjct  60   -VSVTDPVPSLTRSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALF  118

Query  388  TIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLAD  567
            TIVVSGT+KVL+QVVEQLNKLVNV+KVED+S+E  VERELMLIKLNA+ ST AEIMWL D
Sbjct  119  TIVVSGTEKVLRQVVEQLNKLVNVIKVEDISKEEHVERELMLIKLNADPSTLAEIMWLVD  178

Query  568  IFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IFRAK+VDISEH +TIEVTGDPGK+ AV RNL KFGIKELARTGKIALRREKMGETAPF
Sbjct  179  IFRAKIVDISEHSLTIEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRREKMGETAPF  237


 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD  + +
Sbjct  307  VQSHTLSMIVNDCPGVLNIVTGVMSRRGYNIQSLAVGPAEKEGLSRITTVVPGTDDSITK  366

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  367  LVQQLHKLIDLHEVRDITHLPFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHT  426

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE
Sbjct  427  ITLELTGDINKMVALQKLLEPYGICEVARTGRVALERE  464



>ref|XP_011460628.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=479

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT+K+LQQV
Sbjct  74   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTEKILQQV  133

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+SREPQVERELMLIKL+A+ S +AEIMWL DIFRAK+VDISEH +
Sbjct  134  VEQLNKLVNVIKVEDISREPQVERELMLIKLHADPSNRAEIMWLVDIFRAKIVDISEHSL  193

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RN  KFGIKELARTGKIALRREKMGETAPF
Sbjct  194  TIEVTGDPGKMVAVQRNFSKFGIKELARTGKIALRREKMGETAPF  238


 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+ + V D  G++N + GV +RRGYNI+SLAVG ++ + L   T VV GTD  + +
Sbjct  307  VQSHTLCMLVSDVPGVLNIVTGVISRRGYNIQSLAVGPSEKEGLSRITTVVPGTDDTITK  366

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL+++ +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  367  LVQQLRKLIDLHEVRDITHLPFAERELMLIKIAVNANARRDVLDIAGIFRAKAVDVSDHT  426

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRR  717
            +T+E+TGD  KM A+ + L+ +G+ E+ARTG++AL R
Sbjct  427  ITLELTGDLNKMVALQKLLEPYGLCEIARTGRVALER  463



>ref|XP_008349232.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=412

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVL+QV
Sbjct  6    RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLRQV  65

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+SREPQVERELMLIKLNA+ ST+AEIMWL DIFRAK+VDISE  +
Sbjct  66   VEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDISEQSL  125

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+E+TGDPGK+ AV RNL KFGIKELARTGKIALRREKMG TAPF
Sbjct  126  TVEITGDPGKVVAVQRNLSKFGIKELARTGKIALRREKMGATAPF  170


 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD  + +
Sbjct  240  VRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVGPAEMEGLSRITTVVPGTDDSISK  299

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D+S  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  300  LVQQLHKLIDLHEVRDISHLPFAERELMLIKIXXXXTARRDVLDIASIFRAKAVDVSDHT  359

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL+RE
Sbjct  360  ITLELTGDLNKMVALQKLLEPYGICEVARTGRVALQRE  397



>ref|XP_011010159.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Populus euphratica]
Length=490

 Score =   298 bits (764),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 189/240 (79%), Gaps = 11/240 (5%)
 Frame = +1

Query  58   MAAAVSQC--------PGVRKSFLPAFSKPGPLNRAVFRPKV--THFAPFVANAAGK-GA  204
            MAA+V QC        P  +   +  FS+         RP V  ++ A  V+ +  K   
Sbjct  1    MAASVPQCSTRITTQTPCSKPDSVGGFSRKSSGFVHFLRPSVWKSNNAVKVSCSISKDNG  60

Query  205  ETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  384
              V+V+ S P  + S+++RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL
Sbjct  61   SAVSVADSVPTVTRSKLQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  120

Query  385  FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLA  564
            FTIVV GT+KVL+QVVEQLNKLVNV+KV+D+SREPQVERELMLIK NA+ ST+AE+MWL 
Sbjct  121  FTIVVCGTEKVLRQVVEQLNKLVNVIKVDDISREPQVERELMLIKFNADSSTRAEVMWLV  180

Query  565  DIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            DIFRAK+VDISE+ +TIEVTGDPGKMAA+ RNL KFGIKELARTGKIALRRE+MGETAPF
Sbjct  181  DIFRAKIVDISENSLTIEVTGDPGKMAAIQRNLSKFGIKELARTGKIALRRERMGETAPF  240


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  +++ L   T V+ GTD  + +
Sbjct  318  LRSHTLSMLVNNCPGVLNIVTGVISRRGYNIQSLAVGPAEEEGLSRITTVIPGTDDSIGK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D++  P  ERELMLIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLHKLIDLHEVRDITHSPFAERELMLIKIAANSAARRDVLDIARIFRAKAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  438  ITLELTGDFNKMVALQRILEPYGICEVARTGRVALVRES  476



>ref|XP_002266924.2| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646454.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646455.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 emb|CBI23353.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT+ VL+QV
Sbjct  70   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVSGTETVLRQV  129

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNVLKV+DLSREPQVERELMLIKLNA+ S +AEIMWL DIFRAK+VDISEH +
Sbjct  130  VEQLNKLVNVLKVKDLSREPQVERELMLIKLNADPSKRAEIMWLVDIFRAKIVDISEHSL  189

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKELARTGKIALRREKMGETAPF
Sbjct  190  TIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKMGETAPF  234


 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GV +RR YNI+SLAVG  +   ++  T VV GTD+ + +
Sbjct  304  LRSHTLSMLVNDTPGVLNIVTGVISRRSYNIQSLAVGPAEMEGRSHITTVVPGTDESISK  363

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL+++ +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  364  LVQQLQKLIDLHEVRDITHMPFAERELMLIKIAVNTAARRDVLDIASIFRAKAVDVSDHT  423

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  424  ITLELTGDLNKMVALQRLLEPYGICEVARTGRVALVRE  461



>ref|XP_010558579.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=421

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN DKALFTIVV GTD+VLQQV
Sbjct  15   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNADKALFTIVVIGTDRVLQQV  74

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S+EPQVERELMLIKLNA  ST+ EIMWL DIFRAK+VD SEH +
Sbjct  75   VEQLNKLVNVIKVEDISKEPQVERELMLIKLNAGPSTRTEIMWLVDIFRAKIVDTSEHSL  134

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKMAA+ RNL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  135  TIEVTGDPGKMAALQRNLEKFGIKEIARTGKIALRREKMGETAPF  179


 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N IAGV +RRGYNI+SLAVG  + + L   T V+  TD+   Q
Sbjct  249  MRSHTLSILVNNSPGVLNEIAGVISRRGYNIQSLAVGPAEKEGLSRITTVIPATDEKTSQ  308

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL+KLV++ +V D++  P  ERELMLIK+ A  + + +++ +A +FRAK VD+S+H 
Sbjct  309  LVGQLHKLVDIHEVRDMTHLPFAERELMLIKVAANTAARRDLLDIAQVFRAKAVDVSDHT  368

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  369  ITLEVTGDLRKMAALQNQLETYGICEVARTGRVALVRE  406



>ref|XP_008225227.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Prunus mume]
Length=479

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 186/244 (76%), Gaps = 22/244 (9%)
 Frame = +1

Query  58   MAAAVS---------QCPG----VRKSFLPAFS--KPGPLNRAVFRPKVTHFAPFVANAA  192
            MAAAVS         Q P     +R  FL +F      PL    F     H   +V +A+
Sbjct  1    MAAAVSSPCSTPLMTQKPSLRVDIRHGFLKSFDFGHQKPLKWKTF-----HLKEWVVSAS  55

Query  193  GKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  372
               A  V+V+   P    S+VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK
Sbjct  56   TDNA--VSVTDPVPSLIRSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  113

Query  373  DKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEI  552
            DKALFTIVVSGT+KVL+QVVEQLNKLVNV+KVED+S+E  VERELMLIKLNA+ ST AEI
Sbjct  114  DKALFTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISKEEHVERELMLIKLNADPSTLAEI  173

Query  553  MWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGE  732
            MWL DIFRAK+VDISEH +TIEVTGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE
Sbjct  174  MWLVDIFRAKIVDISEHSLTIEVTGDPGKVVAVQRNLSKFGIKEVARTGKIALRREKMGE  233

Query  733  TAPF  744
            TAPF
Sbjct  234  TAPF  237


 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD  + +
Sbjct  307  VQSHTLSMIVNDCPGVLNIVTGVMSRRGYNIQSLAVGPAEKEGLSRITTVVPGTDDSITK  366

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  367  LVQQLHKLIDLHEVRDITHLPFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHT  426

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE
Sbjct  427  ITLELTGDINKMVALQKLLEPYGICEVARTGRVALERE  464



>ref|XP_010453787.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Camelina sativa]
Length=479

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTDKVLQQV
Sbjct  75   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQV  134

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNK+VNV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SEH +
Sbjct  135  VEQLNKIVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHSL  194

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RNL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  195  TIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRREKMGETAPF  239


 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD  + ++
Sbjct  308  RSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKL  367

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V QL KL+++ +V++++  P  ERELMLIK+ A  ST+ +I+ +A +FRAK +D+S+H +
Sbjct  368  VRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSTRRDILDIAHVFRAKAIDVSDHTI  427

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+EV GD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  428  TLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRE  464



>ref|XP_010492512.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=479

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTDKVLQQV
Sbjct  75   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQV  134

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNK+VNV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SEH +
Sbjct  135  VEQLNKIVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLMDIFRAKIVDTSEHSL  194

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RNL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  195  TIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRREKMGETAPF  239


 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD  + ++
Sbjct  308  RSHTLSILVANSPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKL  367

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V QL KL+++ +V +++  P  ERELMLIK+ A+ ST+ +I+ +A +FRAK +D+S+H +
Sbjct  368  VRQLQKLIDLHEVHNITHMPFAERELMLIKVAAQTSTRRDILDIAQVFRAKAIDVSDHTI  427

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+EV GD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  428  TLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRE  464



>ref|XP_002871713.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47972.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTDKVLQQV
Sbjct  71   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQV  130

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SEH +
Sbjct  131  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHSL  190

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  191  TIEVTGDPGKMVALTTNLEKFGIKEIARTGKIALRREKMGETAPF  235


 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  304  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  363

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ ++++++  P  ERELMLIK+ A+ S + +++ +A +FRAK +D+S+H 
Sbjct  364  LVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHT  423

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KM+A+   L+ +G+ E+ARTG++AL RE
Sbjct  424  ITLEVTGDLRKMSALQTQLEAYGLCEVARTGRVALVRE  461



>ref|XP_010109954.1| hypothetical protein L484_011796 [Morus notabilis]
 gb|EXC24930.1| hypothetical protein L484_011796 [Morus notabilis]
Length=512

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVL+QV
Sbjct  93   KVQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLRQV  152

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+SREPQVERELMLIKLNA+ +T+AEIMWL DIFR ++VDISE  +
Sbjct  153  VEQLNKLVNVIKVEDISREPQVERELMLIKLNADPNTRAEIMWLVDIFRGRIVDISESTL  212

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AVLRNL KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  213  TIEVTGDPGKMVAVLRNLMKFGIKEIARTGKIALRREKMGETAPF  257


 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 114/171 (67%), Gaps = 14/171 (8%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTD----K  414
            ++ HT+S+ V D  G++N + GV +RRGYNI+SL VG  + + L   T V+ GTD    K
Sbjct  326  LRSHTLSMLVNDYPGVLNIVTGVISRRGYNIQSLTVGHAEVEGLSRITTVIPGTDESIGK  385

Query  415  VLQQV--------VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADI  570
            ++Q+V        V+QL  L+++ +V D++  P  ERELMLIK+    + + +++ +A I
Sbjct  386  LVQEVLNFLKAAQVQQLPGLIDLHEVRDITHLPFAERELMLIKIAVNTAARRDVLDIATI  445

Query  571  FRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            FRAK VD+S+H +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE 
Sbjct  446  FRAKAVDVSDHTITLELTGDLNKMVALQKLLEPYGICEVARTGRVALVRES  496



>ref|XP_002311270.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
 gb|EEE88637.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
Length=490

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 188/240 (78%), Gaps = 11/240 (5%)
 Frame = +1

Query  58   MAAAVSQC--------PGVRKSFLPAFSKPGPLNRAVFRPKV--THFAPFVANAAGK-GA  204
            MAA+V QC        P  +   +  FS+         RP V  ++ A  V+ +  K   
Sbjct  1    MAASVPQCSTRITTQTPCSKLDSVGGFSRKSSGFVHFLRPSVWKSNNAVKVSCSISKENG  60

Query  205  ETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  384
              V+V+ S P  + SR++RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL
Sbjct  61   SAVSVADSVPTVTRSRLQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  120

Query  385  FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLA  564
            FTIVV GT+ VL+QVVEQLNKLVNV+KV+D+SREPQVERELMLIK NA+ ST+AE+MWL 
Sbjct  121  FTIVVCGTENVLRQVVEQLNKLVNVIKVDDISREPQVERELMLIKFNADPSTRAEVMWLV  180

Query  565  DIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            DIFRAK+VDISE+ +TIEVTGDPGKMAA+ RNL KFGIKELARTGKIALRRE+MGETAPF
Sbjct  181  DIFRAKIVDISENSLTIEVTGDPGKMAAIQRNLSKFGIKELARTGKIALRRERMGETAPF  240


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  +++ L   T V+ GTD+ + +
Sbjct  318  LRSHTLSMLVNNCPGVLNIVTGVISRRGYNIQSLAVGPAEEEGLSRITTVIPGTDESIGK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D++  P  ERELMLIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLHKLIDLHEVRDITHSPFAERELMLIKIAANSAARRDVLDIARIFRAKAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  438  ITLELTGDFNKMVALQRILEPYGICEVARTGRVALVRES  476



>gb|KJB78878.1| hypothetical protein B456_013G024000 [Gossypium raimondii]
Length=483

 Score =   296 bits (758),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+++L+QV
Sbjct  77   RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERILRQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KV+D+S EP VERELMLIKLN   +T+AEIMWL DIFRA++VD SEHF+
Sbjct  137  VEQLNKLVNVIKVDDISMEPHVERELMLIKLNTNPTTRAEIMWLVDIFRARIVDTSEHFL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EVTGDPGKMAAV RNL KFGIKELARTGKIALRREKMGETAPF
Sbjct  197  TVEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRREKMGETAPF  241


 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+++ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GTD+ L +
Sbjct  311  LRSHTLAMVVNDSPGVLNVVTGVISRRGYNIQSLAVGPAEKDGLSRITTVIPGTDETLAK  370

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            + +QL KLV++ +V+D++  P  ERELMLIK+    + + +I+ +A+IFRAK VD+ +H 
Sbjct  371  LFQQLRKLVDLYEVQDMTHSPFAERELMLIKVAVSPAARRDILDIANIFRAKAVDVCDHT  430

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE
Sbjct  431  ITLELTGDLNKMVALQKLLEPYGICEVARTGRVALVRE  468



>ref|XP_010524340.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=489

 Score =   296 bits (757),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  175  FVANAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESL  354
             +A A   G    A S S  P    RV+RHTISVFVGDESGIINRIAGVFARRGYNIESL
Sbjct  58   LIAAAGSTGKAITAASESVAPAGRERVRRHTISVFVGDESGIINRIAGVFARRGYNIESL  117

Query  355  AVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAEL  534
            AVGLN+DKALFTIVV GTDKVLQQVVEQLNKLVNV+KVED+S+EPQVERELMLIKLNA+ 
Sbjct  118  AVGLNEDKALFTIVVIGTDKVLQQVVEQLNKLVNVIKVEDISKEPQVERELMLIKLNADP  177

Query  535  STKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALR  714
            +T+ EIMWL DIFRAK+VD SE  +TIEVTGDPGKM A+ RNL+KFGIKE+ARTGKIALR
Sbjct  178  TTRTEIMWLIDIFRAKIVDTSERSLTIEVTGDPGKMVALQRNLEKFGIKEIARTGKIALR  237

Query  715  REKMGETAPF  744
            REKMGETAPF
Sbjct  238  REKMGETAPF  247


 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            +  T+S+ V +  G++N I GV +RRGYNI+SLAVG  + + +   T V+  TD+++ ++
Sbjct  318  RSRTLSILVNNSPGVLNEITGVISRRGYNIQSLAVGPAEKEGISRITTVIPATDEMISKL  377

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V QL+KLV++ +V D++  P  ERELMLIK+ A  S + +++ +A +FRAK VD+S+H +
Sbjct  378  VRQLHKLVDLHEVRDMTNLPFAERELMLIKVAANTSARRDVLDIAQVFRAKAVDVSDHTI  437

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+EVTGD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  438  TLEVTGDLRKMAALQTQLEAYGICEVARTGRVALVRE  474



>ref|XP_008371723.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like, 
partial [Malus domestica]
Length=472

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT KVL+QV
Sbjct  66   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTGKVLRQV  125

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+SREPQVERELMLIKLNA+ ST+AEIMWL DIFRAK+VDISE  +
Sbjct  126  VEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDISEQSL  185

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EVTGDPGK+ AV RNL KFGIKELARTGKIALRREKMG TAPF
Sbjct  186  TVEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRREKMGATAPF  230


 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T VV GT+  + +
Sbjct  300  VQSHTLSMIVNDSPGVLNIVTGVISRRGYNIQSLAVGPAEKXGLSRITTVVPGTEDSISK  359

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  360  LVQQLHKLIDLHEVRDITHXPFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDHT  419

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE
Sbjct  420  VTLELTGDLNKMVALQKLLEPYGICEVARTGRVALERE  457



>ref|XP_010242460.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Nelumbo nucifera]
Length=482

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV
Sbjct  77   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNVLKVED+S+EPQVERELML+KLNA+ S +AEIMWL DIFRAKVVDISEH +
Sbjct  137  VEQLLKLVNVLKVEDISKEPQVERELMLVKLNADPSNRAEIMWLVDIFRAKVVDISEHSL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKELARTGKIALRRE+MGETAPF
Sbjct  197  TIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRRERMGETAPF  241


 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GTD+ + +
Sbjct  310  LRSHTLSMLVSDSPGVLNLVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTDESIGK  369

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL+N+ +V+D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  370  LVQQLYKLINIHEVQDITHLPFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHT  429

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  430  ITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  468



>ref|XP_008443657.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Cucumis melo]
Length=480

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/241 (67%), Positives = 182/241 (76%), Gaps = 14/241 (6%)
 Frame = +1

Query  58   MAAAVSQCPGVRKSFLPAFSKPGPLNRAVFRPKVT------------HFAPFVANAAGKG  201
            MAAAV+ CP   K+  P +S     +R  F   +              F     ++A   
Sbjct  1    MAAAVALCPAPVKAHKPPYSALA--SRHFFSTSLIVKYQKVQKWNRFEFQRLQVSSAAVN  58

Query  202  AETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA  381
               V V+ SS P   S V RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA
Sbjct  59   DNAVTVTDSSRPSIRSTVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA  118

Query  382  LFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWL  561
            LFTIVV+GT+ VL+QVVEQLNKLVNV+KVED+SR+PQVEREL+L+KLNA+ ST+AEIMWL
Sbjct  119  LFTIVVTGTENVLRQVVEQLNKLVNVIKVEDISRQPQVERELVLMKLNADSSTRAEIMWL  178

Query  562  ADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAP  741
             DIFR K+VDISEH VTIEVTGDPGK+ AV RN  KFGI+ELARTGKIALRREKMGETAP
Sbjct  179  VDIFRGKIVDISEHSVTIEVTGDPGKLVAVERNFSKFGIRELARTGKIALRREKMGETAP  238

Query  742  F  744
            F
Sbjct  239  F  239


 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V D  G++N + G+ +RRGYNI+SLAVG  + + L   T V+ GTD+ + ++
Sbjct  309  QSHTLSMLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAERQGLSRITTVIPGTDESIGKL  368

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+QL+KL+++ +V DL+  P  ERELMLIK+ A  + + +++ +ADIFRAK VD+S H +
Sbjct  369  VQQLHKLIDLHEVRDLTHLPFAERELMLIKIAANAAARRDVLDIADIFRAKAVDVSGHTI  428

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETA  738
            T+++TGD  KM A+ R L+ FGI E+ARTG++AL RE   ++A
Sbjct  429  TLQLTGDLNKMVALQRLLEPFGICEVARTGRVALERESGVDSA  471



>gb|KDO77106.1| hypothetical protein CISIN_1g0114911mg [Citrus sinensis]
Length=349

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN DKALFTIVVSGT++VL+QV
Sbjct  76   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S EP VERELMLIKLN + ST  EIMWL DIFRAKVVDISEH +
Sbjct  136  VEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHAL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKELARTGKIALRREK+G+TAPF
Sbjct  196  TIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPF  240



>ref|NP_197133.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 ref|NP_850829.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 sp|Q9FFF4.1|ILVH1_ARATH RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; AltName: Full=Protein valine-tolerant 
1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09596.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AAY25401.1| At5g16290 [Arabidopsis thaliana]
 dbj|BAE98982.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AED92272.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 gb|AED92273.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
Length=477

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTDKVLQQV
Sbjct  73   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQV  132

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SE  +
Sbjct  133  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQSL  192

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  193  TIEVTGDPGKMVALTTNLEKFGIKEIARTGKIALRREKMGETAPF  237


 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  305  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  364

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ ++++++  P  ERELMLIK+ A+ S + +++ +A +FRAK +D+S+H 
Sbjct  365  LVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHT  424

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KM+A+   L+ +GI E+ARTG++AL RE
Sbjct  425  ITLEVTGDLRKMSALQTQLEAYGICEVARTGRVALVRE  462



>ref|XP_009352938.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=477

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 180/228 (79%), Gaps = 8/228 (4%)
 Frame = +1

Query  70   VSQCPGVRKSFLPAFSKPGPLNRAVFRP---KVTHFAPFVANAAGKGAETVAvsvssppp  240
            V+Q P   + F   FS    L R   RP   K +     V +A+   A +V+ SV S   
Sbjct  13   VAQKPSFPEDFRHGFSTSFDLGRQ--RPLVWKSSELKKLVVSASTGNAVSVSDSVPSLTS  70

Query  241  svsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVL  420
               +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVL
Sbjct  71   ---KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVL  127

Query  421  QQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISE  600
            +QVVEQLNKLVNV+ VED+SRE QVERELMLIKL+A+ ST+AEIMWL DIFRAK+VDISE
Sbjct  128  RQVVEQLNKLVNVINVEDISREQQVERELMLIKLDADPSTRAEIMWLVDIFRAKIVDISE  187

Query  601  HFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
              +T+EVTGDPGK+ AV RNL KFGIKELARTGKIALRREKMG TAPF
Sbjct  188  QSLTVEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRREKMGATAPF  235


 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD  + +
Sbjct  305  VRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVGPAEMEGLSRITTVVPGTDDSISK  364

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D+S  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  365  LVQQLHKLIDLHEVRDISHLPFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHT  424

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL+RE
Sbjct  425  ITLELTGDLNKMVALQKLLEPYGICEVARTGRVALQRE  462



>ref|XP_009126106.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Brassica rapa]
Length=475

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKA+FTIVV GTDKVLQQV
Sbjct  70   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVLGTDKVLQQV  129

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ +T++EIMWL DIFRAKVVD S+H +
Sbjct  130  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHTL  189

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  190  TIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRREKMGETAPF  234


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  303  LRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ +V++++  P  ERELMLIK+ A  S + +++ +A +FRAK +D+S+H 
Sbjct  363  LVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  423  ITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRE  460



>emb|CDX85509.1| BnaA02g03040D [Brassica napus]
Length=475

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKA+FTIVV GTDKVLQQV
Sbjct  70   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVLGTDKVLQQV  129

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ +T++EIMWL DIFRAKVVD S+H +
Sbjct  130  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHTL  189

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  190  TIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRREKMGETAPF  234


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  303  LRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ +V++++  P  ERELMLIK+ A  S + +++ +A +FRAK +D+S+H 
Sbjct  363  LVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  423  ITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRE  460



>emb|CDY38123.1| BnaC02g06500D [Brassica napus]
Length=475

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKA+FTIVV GTDKVLQQV
Sbjct  70   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVLGTDKVLQQV  129

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ +T++EIMWL DIFRAKVVD S+H +
Sbjct  130  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHTL  189

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  190  TIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRREKMGETAPF  234


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  303  LRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ +V++++  P  ERELMLIK+ A  S + +++ +A +FRAK +D+S+H 
Sbjct  363  LVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  423  ITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRE  460



>ref|XP_010420316.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=481

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAV LN+DKALFTIVV GTDKVLQQV
Sbjct  77   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVALNEDKALFTIVVLGTDKVLQQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNK+VNV+KVED+S+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SEH +
Sbjct  137  VEQLNKIVNVIKVEDISKEPHVERELMLIKLNADPSTRSEIMWLMDIFRAKIVDTSEHSL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RNL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  197  TIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRREKMGETAPF  241


 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD  + ++
Sbjct  310  RSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKL  369

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V QL KL+++ +V++++  P  ERELMLIK+ A  ST+ +I+ +A +FRAK +D+S+H +
Sbjct  370  VRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSTRRDILDIAHVFRAKAIDVSDHTI  429

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+EV GD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  430  TLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRE  466



>ref|XP_002316167.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
 gb|EEF02338.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
Length=414

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            ++RHTISVFVGDE GIINRIAGVFARRGY+IESLAVGLNKDKALFTIVV GT+KVL+QVV
Sbjct  1    MQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFTIVVCGTEKVLRQVV  60

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV+KVED+SR+PQVERELMLIKLNA  ST+AEIMWL DIFRAK+VDISEH +T
Sbjct  61   EQLNKLVNVIKVEDISRDPQVERELMLIKLNANPSTRAEIMWLVDIFRAKIVDISEHSLT  120

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKMAAV RNL KFGIKELARTGKIAL+RE MGETAPF
Sbjct  121  IEVTGDPGKMAAVQRNLSKFGIKELARTGKIALKRETMGETAPF  164


 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  242  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  301

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+K ++  +V D++  P  EREL LIK+ A  + + +++ +A IFRAK VD S+H 
Sbjct  302  LVQQLHKSIDFHEVRDITHSPFAERELTLIKIAANSAARRDVLDIARIFRAKAVDFSDHT  361

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  362  ITLELTGDLNKMVALQRILEPYGICEVARTGRVALVRES  400



>gb|KDO77103.1| hypothetical protein CISIN_1g0114911mg, partial [Citrus sinensis]
 gb|KDO77104.1| hypothetical protein CISIN_1g0114911mg, partial [Citrus sinensis]
 gb|KDO77105.1| hypothetical protein CISIN_1g0114911mg, partial [Citrus sinensis]
Length=384

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN DKALFTIVVSGT++VL+QV
Sbjct  76   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S EP VERELMLIKLN + ST  EIMWL DIFRAKVVDISEH +
Sbjct  136  VEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHAL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKELARTGKIALRREK+G+TAPF
Sbjct  196  TIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPF  240


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSCITTVVPGTDESIGK  371

Query  427  VVEQLNKLVNV  459
            +V+ L+KL+++
Sbjct  372  LVQLLHKLIDL  382



>dbj|BAH19535.1| AT5G16290 [Arabidopsis thaliana]
Length=477

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTDKVLQQV
Sbjct  73   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQV  132

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SE  +
Sbjct  133  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQSL  192

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGI+E+ARTGKIALRREKMGETAPF
Sbjct  193  TIEVTGDPGKMVALTTNLEKFGIQEIARTGKIALRREKMGETAPF  237


 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  305  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  364

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ ++++++  P  ERELMLIK+ A+ S + +++ +A +FRAK +D+S+H 
Sbjct  365  LVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHT  424

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KM+A+   L+ +GI E+ARTG++AL RE
Sbjct  425  ITLEVTGDLRKMSALQTQLEAYGICEVARTGRVALVRE  462



>ref|XP_006286862.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
 gb|EOA19760.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
Length=476

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTDKVLQQV
Sbjct  73   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQV  132

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SEH +
Sbjct  133  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHSL  192

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGK+ A+  NL+KFGI+E+ARTGKIALRREKMG+TAPF
Sbjct  193  TIEVTGDPGKLVALETNLEKFGIREIARTGKIALRREKMGDTAPF  237


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD  + +
Sbjct  304  IRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDK  363

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ +V++++  P  ERELMLIK+ A  S + +++ +A +FRAK +D+S+H 
Sbjct  364  LVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHT  423

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KMAA+   L+ +G+ E+ARTG++AL RE
Sbjct  424  ITLEVTGDLRKMAALQTQLEVYGLCEVARTGRVALVRE  461



>ref|XP_004139096.1| PREDICTED: uncharacterized protein LOC101208212 [Cucumis sativus]
Length=480

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 181/241 (75%), Gaps = 14/241 (6%)
 Frame = +1

Query  58   MAAAVSQCPGVRKSFLPAFSKPGPLNRAVFRPKVT------------HFAPFVANAAGKG  201
            MAAAV+ CP   K+  P +S     +R  F   +              F     ++A   
Sbjct  1    MAAAVALCPAPVKAHKPPYSALA--SRHFFSTSLIVKYQEVQKWNRFEFQRLQVSSAAVN  58

Query  202  AETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA  381
               V V+ SS P   S V RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA
Sbjct  59   DNAVTVTDSSRPSIRSTVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA  118

Query  382  LFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWL  561
            LFTIVV+GT+ VL+QVVEQLNKLVNV+KVED+SR+PQVEREL+L+KLNA+ ST+AEIMWL
Sbjct  119  LFTIVVTGTENVLRQVVEQLNKLVNVIKVEDISRQPQVERELVLMKLNADSSTRAEIMWL  178

Query  562  ADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAP  741
             DIFR K+VDISEH VTIEVTGDPGK+ AV RN  KFGI+ELARTGKIALRREK GETAP
Sbjct  179  VDIFRGKIVDISEHSVTIEVTGDPGKLVAVERNFSKFGIRELARTGKIALRREKRGETAP  238

Query  742  F  744
            F
Sbjct  239  F  239


 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V D  G++N + G+ +RRGYNI+SLAVG  + + L   T V+ GTD+ + ++
Sbjct  309  QSHTLSMLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAEREGLSRITTVIPGTDESIGKL  368

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+QL+KL+++ +V DL+  P  ERELMLIK+ A  + + +++ +ADIFRAK VD+S H +
Sbjct  369  VQQLHKLIDLHEVRDLTHLPFAERELMLIKIAANATARRDVLDIADIFRAKAVDVSGHTI  428

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETA  738
            T+++TGD  KM A+ R L+ FGI E+ARTG++AL RE   ++A
Sbjct  429  TLQLTGDLNKMVALQRLLEPFGICEVARTGRVALERESGVDSA  471



>ref|XP_007028126.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
 gb|EOY08628.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
Length=482

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT+ +L+QV
Sbjct  76   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAIFTIVVSGTEMILRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S+EP VERELMLIKL+A+  T+AE+MWL DIFRAK+VD SE F+
Sbjct  136  VEQLNKLVNVIKVEDISKEPHVERELMLIKLHADADTRAEVMWLVDIFRAKIVDTSEQFL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKMAAV RNL KFGIKELARTGKIALRREK+G+TAPF
Sbjct  196  TIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRREKLGQTAPF  240


 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T VV GT++ + +
Sbjct  310  LQSHTLSMVVNDTPGVLNVVTGVISRRGYNIQSLAVGPAERDELSRITTVVPGTNETIGK  369

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+D++  P  ERELML+K+    + + +++ +A IFRAK VD+S+H 
Sbjct  370  LVQQLQKLVDLYEVQDMTHLPFAERELMLVKVAVNTAARRDVLDIASIFRAKAVDVSDHT  429

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ RTG++AL RE 
Sbjct  430  ITLELTGDLNKMVALQRLLEPYGICEVTRTGRVALVRES  468



>ref|XP_006400166.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
 gb|ESQ41619.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
Length=479

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKA+FTIVV GTDKVLQQV
Sbjct  75   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVLGTDKVLQQV  134

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ +T++EIMWL DIFRAK+VD SEH +
Sbjct  135  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKIVDTSEHTL  194

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGI E+ARTGKIALRREKMGETAPF
Sbjct  195  TIEVTGDPGKMVALKTNLEKFGILEIARTGKIALRREKMGETAPF  239


 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  307  LRSHTLSILVTNVPGVLNLITGAISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDENIDK  366

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ +V++++  P  ERELMLIK+ A  + + +++ +A +FRAK +D+S+H 
Sbjct  367  LVRQLQKLIDLHEVKNITHMPFAERELMLIKVAAHTTARRDVLDIAQVFRAKAIDVSDHT  426

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KMAA+   L+ +GI E+ARTG++AL RE
Sbjct  427  ITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRE  464



>ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis]
Length=493

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  87   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQV  146

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNV+KVEDLS EPQVERELMLIK+NA+ S +AEIMWL  IFRAK+VDISEH +
Sbjct  147  VEQLQKLVNVMKVEDLSSEPQVERELMLIKVNADPSYRAEIMWLVGIFRAKIVDISEHSL  206

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE APF
Sbjct  207  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGECAPF  251


 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + G+FARRGYN++SLAVG ++ + L   T VV GTD+ + +
Sbjct  321  LRSHTLSMLVNDSPGVLNIVTGIFARRGYNVQSLAVGHSETEGLSRITTVVPGTDESISK  380

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL+++ +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  381  LVQQLYKLIDLHEVRDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  440

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  441  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  479



>gb|KHG22544.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=469

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +1

Query  151  PKVTHFAPFVANAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFAR  330
            PK   F+P   +     +  +A       P+ S+V+RHTISVFVGDESG+INRIAGVFAR
Sbjct  40   PKKLVFSPKSVDDKISNSNFLANGPVPSTPTRSKVRRHTISVFVGDESGMINRIAGVFAR  99

Query  331  RGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELM  510
            RGYNIESLAVGLNKDKALFTIVVSGTD+VLQQVVEQL KLVNV KVEDLS EPQVERELM
Sbjct  100  RGYNIESLAVGLNKDKALFTIVVSGTDRVLQQVVEQLQKLVNVWKVEDLSNEPQVERELM  159

Query  511  LIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELA  690
            LIK+NA+   +AEIMWL DIFRAK+VDISEH +TIEVTGDPGKM AV RNL KFGIKE+A
Sbjct  160  LIKVNADPKFRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNLSKFGIKEIA  219

Query  691  RTGKIALRREKMGETAPF  744
            RTGKIALRREKMG +APF
Sbjct  220  RTGKIALRREKMGASAPF  237


 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 106/157 (68%), Gaps = 12/157 (8%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V D  G++N + G          SLAVG  + + L   T VV GTD+ + ++
Sbjct  308  QSHTLSMLVNDSPGVLNLVTG----------SLAVGHAEVEGLSRITTVVPGTDESISKL  357

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+QL KLV++ +V DL++ P  ERELMLIK+    + + +++ +A+IFRAK VD+S+H V
Sbjct  358  VQQLYKLVDMHEVRDLTQLPFAERELMLIKIAVNATARRDVLDIANIFRAKAVDVSDHTV  417

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  418  TLELTGDLDKMVALQRLLEPYGICEVARTGRLALVRE  454



>ref|XP_006468633.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Citrus sinensis]
Length=484

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN DKALFTIVVSGT++VL+QV
Sbjct  76   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S EP VERELMLIKLN + ST  EIMWL DIFRAKVVDISEH +
Sbjct  136  VEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHAL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKELARTGKIALRREK+G+TAPF
Sbjct  196  TIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPF  240


 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGK  371

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+ L+KL+++ +V+D++  P  EREL+LIK+    + + +++ +A IFRA+ VD+S+H 
Sbjct  372  LVQLLHKLIDLHEVQDITHLPFAERELILIKIAVNTAARRDVLDIAKIFRARAVDVSDHT  431

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  K+ A+ R L+ +GI E+ARTG++AL RE 
Sbjct  432  ITLELTGDLNKIIALQRLLEPYGICEVARTGRVALVRES  470



>ref|XP_006448524.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61764.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=489

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN DKALFTIVVSGT++VL+QV
Sbjct  76   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S EP VERELMLIKLN + ST  EIMWL DIFRAKVVDISEH +
Sbjct  136  VEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHAL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKELARTGKIALRREK+G+TAPF
Sbjct  196  TIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPF  240


 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGK  371

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+ L+KL+++ +V+D++  P  EREL+LIK+    + + +++  A IFRA+ VD+S+H 
Sbjct  372  LVQLLHKLIDLHEVQDITHLPFAERELILIKIAVNTAARRDVLDTAKIFRARAVDVSDHT  431

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKEL  687
            +T+E+TGD  K+ A+ R L+ +GI EL
Sbjct  432  ITLELTGDLNKIIALQRLLEPYGICEL  458



>ref|XP_006448525.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61765.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=484

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN DKALFTIVVSGT++VL+QV
Sbjct  76   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S EP VERELMLIKLN + ST  EIMWL DIFRAKVVDISEH +
Sbjct  136  VEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHAL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKELARTGKIALRREK+G+TAPF
Sbjct  196  TIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPF  240


 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGK  371

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+ L+KL+++ +V+D++  P  EREL+LIK+    + + +++  A IFRA+ VD+S+H 
Sbjct  372  LVQLLHKLIDLHEVQDITHLPFAERELILIKIAVNTAARRDVLDTAKIFRARAVDVSDHT  431

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  K+ A+ R L+ +GI E+ARTG++AL RE 
Sbjct  432  ITLELTGDLNKIIALQRLLEPYGICEVARTGRVALVRES  470



>gb|KDP35124.1| hypothetical protein JCGZ_10658 [Jatropha curcas]
Length=483

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVLQQV
Sbjct  77   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLQQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNVLKVEDLS EPQVERELMLIK+NA+ + +AEI WL +IFRAK+VDISEH V
Sbjct  137  VEQLQKLVNVLKVEDLSSEPQVERELMLIKVNADPNYRAEIKWLVEIFRAKIVDISEHSV  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKFGI+E+ARTGKIALRREKMGE APF
Sbjct  197  TIEVTGDPGKMVAVQRNLKKFGIREIARTGKIALRREKMGEFAPF  241


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GTD+ + +
Sbjct  311  LRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHSETEGISRITTVVPGTDESISK  370

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V+DL+  P  ERELMLIK+    + + +++ +A IFRA+ VD+S+H 
Sbjct  371  LVQQLYKLVELHEVQDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHT  430

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  431  VTLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  468



>gb|KJB27747.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=479

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VLQQV
Sbjct  73   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLQQV  132

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNV KVEDLS EPQVERELMLIK+NA+   +AEIMWL DIFRAK+VDISEH +
Sbjct  133  VEQLQKLVNVWKVEDLSNEPQVERELMLIKVNADPKFRAEIMWLVDIFRAKIVDISEHSL  192

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKE+ARTGKIALRREKMG +APF
Sbjct  193  TIEVTGDPGKMVAVQRNLSKFGIKEIARTGKIALRREKMGASAPF  237


 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V D  G++N + GVFARRGYN++SLAVG  + + L   T VV GTD+ + ++
Sbjct  308  QSHTLSMLVNDSPGVLNLVTGVFARRGYNLQSLAVGHAEVEGLSRITTVVPGTDESISKL  367

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+QL KLV++ +V DL++ P  ERELMLIK+    + + +++ +A+IFRAK VD+S+H V
Sbjct  368  VQQLYKLVDMHEVRDLTQLPFAERELMLIKIAVNAAARRDVLDIANIFRAKAVDVSDHTV  427

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  428  TLELTGDLDKMVALQRLLEPYGICEVARTGRLALVRE  464



>ref|XP_011085048.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Sesamum indicum]
Length=476

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VLQQV
Sbjct  71   KVKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLQQV  130

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S+EPQVERELMLIK+NA+   +AE+MWL DIFRAK+VDIS+H +
Sbjct  131  MEQLQKLVNVLKVEDISKEPQVERELMLIKINADPKYRAEVMWLVDIFRAKIVDISDHSL  190

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  191  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  235


 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQ  426
            ++ HT+ + V D  G++N + GVFARRGYNI+SLAVG  +    +  T VV GTD+ +++
Sbjct  304  LRSHTLFLVVNDAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGHSRITTVVPGTDESIRK  363

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + +  ++ +A IFRAK VD+S H 
Sbjct  364  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSGHT  423

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  424  ITLELTGDLDKMVALQRLLEPYGICEVARTGRLALIRES  462



>ref|XP_011014725.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X4 [Populus euphratica]
Length=392

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +++RHTISVFVGDE GIINRIAGVFARRGY+IESLAVGLNKDKALFTIVV GT++VL+QV
Sbjct  76   KMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFTIVVCGTEEVLRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLV V+KVED+SR+PQVERELMLIKLNA  ST+AEIMWL DIFRA +VDISEH +
Sbjct  136  VEQLNKLVTVIKVEDISRDPQVERELMLIKLNANPSTRAEIMWLVDIFRATIVDISEHSL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKMAAV RNL KFGIKELARTGKIALRRE MGE APF
Sbjct  196  TIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRRETMGEKAPF  240



>emb|CDY15367.1| BnaC04g42560D [Brassica napus]
Length=487

 Score =   288 bits (737),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 181/243 (74%), Gaps = 14/243 (6%)
 Frame = +1

Query  58   MAAAVSQCPGVRKSFLPAFSKPGP----LNRAVFRPKVTHFA----PFVANAAGKGAETV  213
            MAA  +  P   ++   A S   P    L R  F  K++H +    P   N  GKG E +
Sbjct  1    MAAISTSTPPSLRNLRSACSNSSPALIPLTRVSFPAKISHLSGDKSPNRDNETGKGTERI  60

Query  214  A------vsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKD  375
                   VS +      S+V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+D
Sbjct  61   VRRVDKRVSDAPLTTPESKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRD  120

Query  376  KALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIM  555
            KALFTIVVSGT++VLQQV+EQL KLVNVLKVED+S EPQVERELML+K+NA   ++A+IM
Sbjct  121  KALFTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAQIM  180

Query  556  WLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGET  735
            WL D FRA++VDI+EH +TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG T
Sbjct  181  WLVDTFRARIVDIAEHALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGAT  240

Query  736  APF  744
            APF
Sbjct  241  APF  243


 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV  TD+ + +
Sbjct  313  LRSHTLSLLVNDVPGVLNLVTGVFSRRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  372

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  373  LVQQLYKLVDVHEVHDLTHMPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  432

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  433  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  470



>ref|XP_011014719.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=446

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 183/240 (76%), Gaps = 11/240 (5%)
 Frame = +1

Query  58   MAAAV--------SQCPGVRKSFLPAFSKPGPLNRAVFRPKV--THFAPFVANAAGK-GA  204
            MAA+V        +Q P  +      FS+    +    RP +   + A  V+ A  K   
Sbjct  1    MAASVLLLSSRITAQNPSSKLDLDGGFSRKSSGSVHFLRPSIWENNNAVKVSCAISKDNG  60

Query  205  ETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  384
              V+V+ S P  + S+++RHTISVFVGDE GIINRIAGVFARRGY+IESLAVGLNKDKAL
Sbjct  61   NAVSVADSVPTVTRSKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKAL  120

Query  385  FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLA  564
            FTIVV GT++VL+QVVEQLNKLV V+KVED+SR+PQVERELMLIKLNA  ST+AEIMWL 
Sbjct  121  FTIVVCGTEEVLRQVVEQLNKLVTVIKVEDISRDPQVERELMLIKLNANPSTRAEIMWLV  180

Query  565  DIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            DIFRA +VDISEH +TIEVTGDPGKMAAV RNL KFGIKELARTGKIALRRE MGE APF
Sbjct  181  DIFRATIVDISEHSLTIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRRETMGEKAPF  240


 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  318  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL++  +V D++  P  EREL LIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLHKLIDFHEVRDITHSPFAERELTLIKIAANSAARRDVLDIARIFRAKAVDVSDHT  437

Query  607  VTIE  618
            +T+E
Sbjct  438  ITLE  441



>ref|XP_002279286.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI24729.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +1

Query  184  NAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  363
            N  G   +T AV+  +P  + S+V+RHTISVFVGDESG+INRIAGVFARRGYNI+SLAVG
Sbjct  52   NGVGFNDKTAAVANPAPSAARSKVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVG  111

Query  364  LNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTK  543
            LNKDKALFTIVVSGT++VLQQVVEQL+KLVNVLKVED+S EP VERELMLIK+NA    +
Sbjct  112  LNKDKALFTIVVSGTERVLQQVVEQLHKLVNVLKVEDISTEPHVERELMLIKVNANPQYR  171

Query  544  AEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            AEIMWL +IFRAK+VDISEH VTIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREK
Sbjct  172  AEIMWLVNIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREK  231

Query  724  MGETAPF  744
            MGE+APF
Sbjct  232  MGESAPF  238


 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  308  LRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINK  367

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL+++  V D++  P  ERELMLIK+    + + +++ +A IFRAK +D+S+H 
Sbjct  368  LVQQLKKLIDLHDVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAIDVSDHT  427

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TG   KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  428  ITLELTGALDKMVALQRLLEPYGICEVARTGRVALVRES  466



>ref|XP_010650733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Vitis vinifera]
Length=480

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESG+INRIAGVFARRGYNI+SLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  72   RVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKALFTIVVSGTERVLQQV  131

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL+KLVNVLKVED+S EP VERELMLIK+NA    +AEIMWL +IFRAK+VDISEH V
Sbjct  132  VEQLHKLVNVLKVEDISTEPHVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISEHSV  191

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  192  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  236


 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  306  LRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINK  365

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL+++  V D++  P  ERELMLIK+    + + +++ +A IFRAK +D+S+H 
Sbjct  366  LVQQLKKLIDLHDVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAIDVSDHT  425

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TG   KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  426  ITLELTGALDKMVALQRLLEPYGICEVARTGRVALVRES  464



>ref|XP_007159564.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
 gb|ESW31558.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
Length=473

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = +1

Query  106  PAFSKPGPLNRAVFRPKVTHFAPFVANAAGKGAETVAvsvsspppsvsR--VKRHTISVF  279
            P+FS   P   + F P          +AA   A TV+ S     PS +R  V+RHTISVF
Sbjct  20   PSFSPKLP---SFFTPHTFRANKLTVSAANTSATTVSASSPPSVPSPARSKVRRHTISVF  76

Query  280  VGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNV  459
            VGDESG+INRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGTDKVL QV+EQL KLVNV
Sbjct  77   VGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLLQVMEQLQKLVNV  136

Query  460  LKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGK  639
            LKVEDLSREPQVERELMLIK++A+    AE+ WL DIFRAK+VDISEH VTIEVTGDPGK
Sbjct  137  LKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISEHSVTIEVTGDPGK  196

Query  640  MAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            MAAV RNL KFGIKE+ARTGKIALRREKMG +APF
Sbjct  197  MAAVQRNLSKFGIKEIARTGKIALRREKMGASAPF  231


 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  301  IRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDETISK  360

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRA+ VD+S+H 
Sbjct  361  LVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHT  420

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  421  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALIRE  458



>emb|CAN61470.1| hypothetical protein VITISV_043824 [Vitis vinifera]
Length=451

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNI+SLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  43   QVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKALFTIVVSGTERVLQQV  102

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL+KLVNVLKVED+S EP VERELMLIK+NA    +AEIMWL +IFRAK+VDISEH V
Sbjct  103  VEQLHKLVNVLKVEDISTEPHVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISEHSV  162

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  163  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  207


 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  277  LRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINK  336

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL+++  V D++  P  ERELMLIK+    + + +++ +A IFRAK +D+S+H 
Sbjct  337  LVQQLKKLIDLHDVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAIDVSDHT  396

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TG   KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  397  ITLELTGALDKMVALQRLLEPYGICEVARTGRVALVRES  435



>ref|XP_006353111.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=481

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTI VFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFT+VVSGT++VLQQV+
Sbjct  76   VRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTVVVSGTERVLQQVM  135

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNV+KVEDLS+EPQVERELMLIK+NA+   +AE+MWL D+FRAK+VDIS+H +T
Sbjct  136  EQLQKLVNVIKVEDLSKEPQVERELMLIKINADPKYRAEVMWLVDVFRAKIVDISDHSLT  195

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  196  IEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  239


 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  309  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  368

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V D +  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H 
Sbjct  369  LVQQLYKLVDIHEVRDFTHHPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHT  428

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  429  ITLELTGDLHKMVALQRLLEPYGICEVARTGRLALVRES  467



>ref|XP_010673855.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=477

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V RHTISVFVGDESGIINRIAGV +RRGYNIESLAVGLNKDKALFTIVV GTDKVL+QV
Sbjct  70   KVMRHTISVFVGDESGIINRIAGVISRRGYNIESLAVGLNKDKALFTIVVCGTDKVLRQV  129

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLV+VLKVEDLSREPQVERELML+KLNA+ +T  EI WL +IFRAK+VD+S+  V
Sbjct  130  MEQLNKLVSVLKVEDLSREPQVERELMLVKLNADANTHTEIKWLVEIFRAKIVDVSDSLV  189

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EVTGDPGKMAAVLRN  KFGIKE+ARTGKIALRRE+MGETAPF
Sbjct  190  TVEVTGDPGKMAAVLRNFSKFGIKEVARTGKIALRRERMGETAPF  234


 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V + SG++N + GV +RRGYNI+SLAVG  + + L   T VV G D+ + +
Sbjct  303  LRSHTLSMLVNNVSGVLNTVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGNDESIGK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KLV++ +++DL+  P  ERELMLIK+ A  S + +++ +A+IFRAK VD+S+H 
Sbjct  363  LVQQLSKLVDLHEIQDLTHLPFAERELMLIKVAANTSARRDVLDIANIFRAKAVDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETA  738
            +T++++GD  KM A+ R L+ +GI E+ARTG++AL RE   ++A
Sbjct  423  ITLQLSGDLDKMVALQRLLEPYGICEVARTGRVALTRESRVDSA  466



>gb|KHG18039.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=499

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 156/181 (86%), Gaps = 16/181 (9%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+++L+QV
Sbjct  77   RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERILRQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KV+D+S EP VERELMLIKLN   +T+AEIMWL DIFRA++VD SEHF+
Sbjct  137  VEQLNKLVNVIKVDDISMEPHVERELMLIKLNTNPTTRAEIMWLVDIFRARIVDTSEHFL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGK----------------IALRREKMGETAP  741
            TIEVTGDPGKMAAV RNL KFGIKELARTGK                IALRREKMGETAP
Sbjct  197  TIEVTGDPGKMAAVQRNLSKFGIKELARTGKVALSILPLVLDWMLNMIALRREKMGETAP  256

Query  742  F  744
            F
Sbjct  257  F  257


 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GTD+ L +
Sbjct  327  LRSHTLSMIVNDSPGVLNVVTGVISRRGYNIQSLAVGPAEKDGLSRITTVIPGTDETLAK  386

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            + +QL KLV++ +V+D++  P  ERELMLIK+      + +I+ +A+IFRAK VD+S+H 
Sbjct  387  LFQQLRKLVDLYEVQDMTHSPFAERELMLIKVAVSPPARRDILDIANIFRAKAVDVSDHT  446

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL RE
Sbjct  447  ITLELTGDLNKMVALQKLLEPYGICEVARTGRVALVRE  484



>gb|EYU36664.1| hypothetical protein MIMGU_mgv1a005401mg [Erythranthe guttata]
Length=485

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KV+QQV
Sbjct  80   KVKRHTVSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVIQQV  139

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S+EPQVERELMLIK+NA+   +AE+MWL DIFRA++VD S+H +
Sbjct  140  MEQLKKLVNVLKVEDISKEPQVERELMLIKINADPQHRAEVMWLMDIFRAQIVDTSDHSL  199

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  200  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  244


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  313  LRSHTLSMLVNDAPGVLNLVTGVFARRGYNIQSLAVGHAEIEGLSRITTVVPGTDESISK  372

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QL KL ++ +V D +  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H 
Sbjct  373  LLQQLRKLNDLHEVRDFTHLPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHT  432

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  433  ITLELTGDLDKMIALQRLLEPYGICEVARTGRVALVRE  470



>ref|XP_009406425.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=487

 Score =   286 bits (732),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVLQQV
Sbjct  80   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTNKVLQQV  139

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVLKVEDLSREPQVERELMLIKLN +   + E+M L D+FRAKVVDISEH +
Sbjct  140  MEQLNKLVNVLKVEDLSREPQVERELMLIKLNVDPDKRPEVMGLVDVFRAKVVDISEHSL  199

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI E+ARTGKIALRREKMG+TAPF
Sbjct  200  TIEVTGDPGKMVAVQRNLSKFGINEIARTGKIALRREKMGQTAPF  244


 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GTD  + ++V+
Sbjct  318  HTLSILVNDFPGVLNLVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTDGSIGKLVQ  377

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+D++  P  ERELMLIK+    + + +I+ +ADIFRAK VD+S+H VT+
Sbjct  378  QLYKLIDVHEVQDITHLPFAERELMLIKVAVNTTARRDILDIADIFRAKAVDVSDHTVTL  437

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            ++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  438  QLTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  472



>ref|XP_002514772.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF47326.1| acetolactate synthase, putative [Ricinus communis]
Length=531

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+ HTISVFVGDESGIINRIAGVFARRG+NIESLAV LN+DKALFTIVV GTD VL+QV
Sbjct  122  RVQTHTISVFVGDESGIINRIAGVFARRGFNIESLAVCLNEDKALFTIVVRGTDNVLRQV  181

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLV+V+KVED+SREPQVERELMLIKLNA+  T+ EIMWL DIFRAKVVDISEH +
Sbjct  182  VEQLNKLVSVIKVEDISREPQVERELMLIKLNADPMTRHEIMWLVDIFRAKVVDISEHTL  241

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKMAAVLRNL KF IKEL+RTGKIALRRE+MGETAPF
Sbjct  242  TIEVTGDPGKMAAVLRNLSKFRIKELSRTGKIALRRERMGETAPF  286


 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N I GV +RRGYNI+SLAVG  + + L   T V+ GT++ + ++V 
Sbjct  362  HTLSMLVNDSPGVLNMITGVISRRGYNIQSLAVGSAEREGLSRITTVIPGTNESIGKLVL  421

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL+KL+++ +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H +T+
Sbjct  422  QLHKLIDMHEVRDITHVPFAERELMLIKIAVNTAARRDVLDIASIFRAKAVDVSDHTITL  481

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            E+TGD  KMAA+   L+ +GI E+ARTG++AL RE 
Sbjct  482  ELTGDLNKMAALQTVLEPYGICEVARTGRVALVRES  517



>ref|XP_011014695.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011014703.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=490

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 183/240 (76%), Gaps = 11/240 (5%)
 Frame = +1

Query  58   MAAAV--------SQCPGVRKSFLPAFSKPGPLNRAVFRPKV--THFAPFVANAAGK-GA  204
            MAA+V        +Q P  +      FS+    +    RP +   + A  V+ A  K   
Sbjct  1    MAASVLLLSSRITAQNPSSKLDLDGGFSRKSSGSVHFLRPSIWENNNAVKVSCAISKDNG  60

Query  205  ETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL  384
              V+V+ S P  + S+++RHTISVFVGDE GIINRIAGVFARRGY+IESLAVGLNKDKAL
Sbjct  61   NAVSVADSVPTVTRSKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKAL  120

Query  385  FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLA  564
            FTIVV GT++VL+QVVEQLNKLV V+KVED+SR+PQVERELMLIKLNA  ST+AEIMWL 
Sbjct  121  FTIVVCGTEEVLRQVVEQLNKLVTVIKVEDISRDPQVERELMLIKLNANPSTRAEIMWLV  180

Query  565  DIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            DIFRA +VDISEH +TIEVTGDPGKMAAV RNL KFGIKELARTGKIALRRE MGE APF
Sbjct  181  DIFRATIVDISEHSLTIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRRETMGEKAPF  240


 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  318  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL++  +V D++  P  EREL LIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLHKLIDFHEVRDITHSPFAERELTLIKIAANSAARRDVLDIARIFRAKAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  438  ITLELTGDFNKMVALQRILEPYGICEVARTGRVALERES  476



>ref|XP_004251994.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=481

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTI VFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV+
Sbjct  76   VRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQVM  135

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNV+KVEDLS+EPQVERELMLIK++A+   +AE+MWL DIFRAK+VDIS+H +T
Sbjct  136  EQLQKLVNVIKVEDLSKEPQVERELMLIKISADPKFRAEVMWLVDIFRAKIVDISDHSLT  195

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  196  IEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  239


 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  309  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  368

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V D +  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H 
Sbjct  369  LVQQLYKLVDIHEVRDFTHLPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHT  428

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  429  ITLELTGDLHKMVALQRLLEPYGICEVARTGRLALVRES  467



>ref|XP_010039380.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Eucalyptus grandis]
Length=423

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV
Sbjct  17   RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQV  76

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVEDLS+EPQVERELMLIK+ A+   +AEIM+L DIFRAK+VDISEH V
Sbjct  77   MEQLQKLVNVLKVEDLSKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSV  136

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  137  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGASAPF  181


 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GTD+ + +
Sbjct  251  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  310

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  311  LVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  370

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  371  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  409



>ref|XP_009625351.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=454

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            + +RHTI VFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  77   KTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNV+KVEDLS+EPQVERELMLIK++A+   +AE+MWL D+FRAK+VDIS+H +
Sbjct  137  MEQLQKLVNVIKVEDLSKEPQVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDHSL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  197  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  241


 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + ++V+
Sbjct  285  HTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQ  344

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KLV++ +V D++  P  ERELMLIK+ A  + +  ++ +A IFRAK VD+S+H +T+
Sbjct  345  QLYKLVDIHEVRDITHHPFAERELMLIKIAANAAARRNVLDIASIFRAKAVDVSDHTITL  404

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            E+TGD  KM A+ R L+  GI E+ARTG++AL RE
Sbjct  405  ELTGDLHKMVALQRLLEPCGICEVARTGRLALVRE  439



>gb|EYU17620.1| hypothetical protein MIMGU_mgv1a005378mg [Erythranthe guttata]
Length=486

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRH ISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VL  V
Sbjct  80   KVKRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLHHV  139

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S++PQVERELMLIK+NA+ + +AE+MWL DIFRAK+VDIS+H +
Sbjct  140  MEQLQKLVNVLKVEDISQDPQVERELMLIKINADPNHRAEVMWLVDIFRAKIVDISDHSL  199

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  200  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  244


 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + L   T VV GTD+ + ++V+
Sbjct  317  HTLSMVVNDVPGVLNLVTGVFARRGYNIQSLAVGHSEVEGLSRITTVVPGTDESIGKLVQ  376

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KLV++ +V DL+  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H +T+
Sbjct  377  QLYKLVDLHEVRDLTHLPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITL  436

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  437  ELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  471



>ref|XP_010672487.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=486

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +1

Query  181  ANAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAV  360
            +N   +G E+          + S+  RHTISVFVGDESG+INRIAGVFARRGYNIESLAV
Sbjct  57   SNVDQQGNESNLPFNGVSSSTRSKAMRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  116

Query  361  GLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELST  540
            GLN+DKALFTIVVSGTDKVL QV+EQL KL+NVLKVED+SREPQVERELML+K+ A+ S+
Sbjct  117  GLNEDKALFTIVVSGTDKVLHQVMEQLQKLLNVLKVEDISREPQVERELMLVKVGADQSS  176

Query  541  KAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            + E+MWL DIFRAK+VDISE ++T+EVTGDPGKM AVLRNL KFGI+E+ARTGKIALRRE
Sbjct  177  RGELMWLVDIFRAKIVDISEEYLTVEVTGDPGKMVAVLRNLSKFGIREIARTGKIALRRE  236

Query  721  KMGETAPF  744
            K+GE+APF
Sbjct  237  KLGESAPF  244


 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V D  G++N + G FARRGYNI+SLAVG  + K L   T VV+GTD+ + ++
Sbjct  315  QSHTLSMLVNDRPGVLNFVTGAFARRGYNIQSLAVGHAETKGLSRITTVVTGTDESISKL  374

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+Q+ KLV++ +V+DL+  P  ERELML+K+    + + E++ +A IFRAK VD+S+H +
Sbjct  375  VQQIYKLVDIHEVKDLTHLPFAERELMLVKVAVNTAARREVLDIASIFRAKAVDVSDHTI  434

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  435  TLELTGDVNKMVALQRLLEPYGICEVARTGRVALARE  471



>ref|XP_003524233.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=476

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGTDKVL+QV
Sbjct  70   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLRQV  129

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVEDLSREPQVERELMLIK++A+    AE+ WL DIFRAK+VDISEH V
Sbjct  130  MEQLQKLVNVLKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISEHSV  189

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKMAAV RN  KFGIKE+ARTGKIALRREKMG +APF
Sbjct  190  TIEVTGDPGKMAAVQRNFSKFGIKEIARTGKIALRREKMGASAPF  234


 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  304  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISK  363

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  364  LVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  423

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  424  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  461



>gb|EAZ36982.1| hypothetical protein OsJ_21322 [Oryza sativa Japonica Group]
Length=358

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            +KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+K+L+QVV
Sbjct  17   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILKQVV  76

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV++V+DLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVD+S+H +T
Sbjct  77   EQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLT  136

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE+APF
Sbjct  137  IEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRREKMGESAPF  180


 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 90/127 (71%), Gaps = 2/127 (2%)
 Frame = +1

Query  346  ESLAVGLNKDKAL--FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIK  519
            +SLAVG  + +     T VV GTD+ + ++V QL KL++V +V+DL+  P   RELM+IK
Sbjct  217  QSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHLPFAARELMIIK  276

Query  520  LNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTG  699
            +    + +  I+ +ADIFRAK VD+S+H VT+++TGD  KM A+ R L+ +GI E+ARTG
Sbjct  277  IAVNTTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLEPYGICEVARTG  336

Query  700  KIALRRE  720
            ++ALRRE
Sbjct  337  RVALRRE  343



>ref|XP_010557051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=489

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VK+H ISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVKKHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FR+K+VDISEH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRSKIVDISEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  203  TIEVTGDPGKMNAVERNLRKFGIREIARTGKIALRREKMGESAPF  247


 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGL--NKDKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG    + ++  T V+  TD+ + +
Sbjct  317  LRSHTLSLLVNDAPGVLNLVTGVFARRGYNIQSLAVGHAETEGRSRITTVIPATDESISK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+      + +++ +A IFRAK VD+S+H 
Sbjct  377  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNTVARRDVLDIASIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  ITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  474



>ref|XP_011005277.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Populus euphratica]
Length=475

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            + +RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT++VLQQV
Sbjct  69   KARRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAIFTIVVSGTERVLQQV  128

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNVLKVEDLS EPQVERELML+K+N +   +AEIMWL  IFRAK+VDISEH V
Sbjct  129  VEQLQKLVNVLKVEDLSNEPQVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISEHTV  188

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGK+AAV RNL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  189  TIEVTGDPGKIAAVQRNLSKFGIREIARTGKIALRREKMGASAPF  233


 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  303  LQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V DL+  P  ERELMLIK+    + + +++ +A IFRA  VD+S+H 
Sbjct  363  LVQQLYKLVEIHEVRDLTHVPFAERELMLIKIAVNAAARRDVLDIASIFRANAVDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  423  VTLELTGDLDKMVALQRLLEPYGICEVARTGRIALTRE  460



>gb|KHN48087.1| Acetolactate synthase small subunit [Glycine soja]
Length=471

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGTDKVL+QV
Sbjct  65   QVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLRQV  124

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVEDLSREPQVERELMLIK++A+    AE+ WL DIFRAK+VDIS+H V
Sbjct  125  MEQLQKLVNVLKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISQHSV  184

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKMAAV RN  KFGIKE+ARTGKIALRREKMG +APF
Sbjct  185  TIEVTGDPGKMAAVQRNFSKFGIKEIARTGKIALRREKMGASAPF  229


 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  299  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISK  358

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S H 
Sbjct  359  LVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSGHT  418

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  419  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  456



>ref|XP_009625350.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=483

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            + +RHTI VFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  77   KTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNV+KVEDLS+EPQVERELMLIK++A+   +AE+MWL D+FRAK+VDIS+H +
Sbjct  137  MEQLQKLVNVIKVEDLSKEPQVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDHSL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  197  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  241


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + ++V+
Sbjct  314  HTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQ  373

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KLV++ +V D++  P  ERELMLIK+ A  + +  ++ +A IFRAK VD+S+H +T+
Sbjct  374  QLYKLVDIHEVRDITHHPFAERELMLIKIAANAAARRNVLDIASIFRAKAVDVSDHTITL  433

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            E+TGD  KM A+ R L+  GI E+ARTG++AL RE
Sbjct  434  ELTGDLHKMVALQRLLEPCGICEVARTGRLALVRE  468



>ref|XP_003532793.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=474

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGTDKVL+QV
Sbjct  68   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLRQV  127

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVEDLSREPQVERELMLIK++A+    AE+ WL DIFRAK+VDIS+H V
Sbjct  128  MEQLQKLVNVLKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISQHSV  187

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKMAAV RN  KFGIKE+ARTGKIALRREKMG +APF
Sbjct  188  TIEVTGDPGKMAAVQRNFSKFGIKEIARTGKIALRREKMGASAPF  232


 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  302  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISK  361

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S H 
Sbjct  362  LVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSGHT  421

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  422  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  459



>ref|XP_011047624.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Populus euphratica]
Length=521

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            + +RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT++VLQQV
Sbjct  115  KARRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAIFTIVVSGTERVLQQV  174

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNVLKVEDLS EPQVERELML+K+N +   +AEIMWL  IFRAK+VDISEH V
Sbjct  175  VEQLQKLVNVLKVEDLSNEPQVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISEHTV  234

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGK+AAV RNL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  235  TIEVTGDPGKIAAVQRNLSKFGIREIARTGKIALRREKMGASAPF  279


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  349  LQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITK  408

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V DL+  P  ERELMLIK+    + + +++ +A IFRA  VD+S+H 
Sbjct  409  LVQQLYKLVEIHEVRDLTHVPFAERELMLIKIAVNAAARRDVLDIASIFRANAVDVSDHT  468

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            VT+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  469  VTLELTGDLDKMVALQRLLEPYGICEVARTGRIALTRES  507



>ref|XP_003629945.1| Acetolactate synthase small subunit [Medicago truncatula]
 gb|AET04421.1| acetolactate synthase, small subunit [Medicago truncatula]
Length=478

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGTD+VL+QV
Sbjct  72   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNQDRALFTIVVSGTDRVLRQV  131

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNVLKVEDLSREPQVERELML+K++A+   +AEI WL D FRAK+VDISEH V
Sbjct  132  VEQLQKLVNVLKVEDLSREPQVERELMLVKVHADPQNRAEIKWLVDTFRAKIVDISEHSV  191

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RN  KFGIKE+ARTGKIALRREKMG +APF
Sbjct  192  TIEVTGDPGKMVAVQRNFGKFGIKEIARTGKIALRREKMGASAPF  236


 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GTD+ + +
Sbjct  306  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHSEVEGISRLTTVVPGTDESISK  365

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  366  LVQQLYKLVELREVRDITHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  425

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+I L RE 
Sbjct  426  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIGLVRES  464



>emb|CDX79442.1| BnaC03g17780D [Brassica napus]
Length=471

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 169/209 (81%), Gaps = 6/209 (3%)
 Frame = +1

Query  136  RAVFRPKVTHFAPFVAN---AAGKGAETVAvsvssppps---vsRVKRHTISVFVGDESG  297
            R  F  K++HF+   +N     GK  E +  SV          S+V++HTISVFVGDESG
Sbjct  32   RVSFPSKISHFSRKSSNRDNETGKRTEQIVRSVDERVSDAPPTSKVRKHTISVFVGDESG  91

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VLQQV+EQL KLVNVLKVED+
Sbjct  92   MINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVNVLKVEDI  151

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S EPQVERELML+K+NA+  ++AEIMWL D FRAKVVDI+EH +TIEVTGDPGKM AV R
Sbjct  152  SSEPQVERELMLVKVNADPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVER  211

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NLK F I+E+ RTGKIALRREKMG TAPF
Sbjct  212  NLKNFEIREIVRTGKIALRREKMGATAPF  240


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N              SLAVG  + + +   T VV  TD+ + +
Sbjct  310  LRSHTLSLLVNDVPGVLNL-------------SLAVGHAEAQGISRITTVVPATDESVSK  356

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  357  LVQQLYKLVDVHEVHDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  416

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  417  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  454



>ref|XP_009782836.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=454

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            + +RHTI VFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  77   KTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNV+KVEDLS++PQVERELMLIK++A+   + E+MWL D+FRAK+VDIS+H +
Sbjct  137  MEQLQKLVNVIKVEDLSKDPQVERELMLIKISADPKYRTEVMWLVDVFRAKIVDISDHSL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  197  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  241


 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  282  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  341

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V D++  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H 
Sbjct  342  LVQQLYKLVDIHEVRDITHHPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHT  401

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  402  ITLELTGDLHKMVALQRLLEPYGICEVARTGRLALVRE  439



>gb|KCW59207.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV
Sbjct  81   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQV  140

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVEDLS+EPQVERELMLIK+ A    +AEIM+L DIFRAK+VDISEH V
Sbjct  141  MEQLQKLVNVLKVEDLSKEPQVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHSV  200

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  201  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGASAPF  245


 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GTD+ + +
Sbjct  315  LRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  374

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  375  LVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  434

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  435  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  473



>ref|XP_010070426.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW59208.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV
Sbjct  81   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQV  140

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVEDLS+EPQVERELMLIK+ A    +AEIM+L DIFRAK+VDISEH V
Sbjct  141  MEQLQKLVNVLKVEDLSKEPQVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHSV  200

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  201  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGASAPF  245


 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GTD+ + +
Sbjct  315  LRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  374

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  375  LVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  434

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  435  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  473



>ref|XP_008243054.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Prunus mume]
Length=495

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RH ISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+QV
Sbjct  89   RVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRQV  148

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVLKVEDLS EPQVERELMLIK+NA+ S +AEI WL +IFRAK+VDISEH V
Sbjct  149  IEQLNKLVNVLKVEDLSNEPQVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISEHSV  208

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RN  KFGIKE+ARTGKIALRREK+G +APF
Sbjct  209  TIEVTGDPGKMVALQRNFSKFGIKEVARTGKIALRREKLGASAPF  253


 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  323  LRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISK  382

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL ++  V+DL+  P  ERELMLIK+ A    + +++ + +IFRAK VD+S+H 
Sbjct  383  LVQQLYKLADIHDVQDLTNLPFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHT  442

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  443  ITLELTGDLNKMVALQRLLEPYGICEVARTGRIALVRES  481



>ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
 gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
Length=478

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  72   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQV  131

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNV KVEDLS EPQVERELMLIK+NA+    AEI WL DIFRA++VDISEH +
Sbjct  132  VEQLQKLVNVWKVEDLSNEPQVERELMLIKVNADPKFGAEIKWLVDIFRAQIVDISEHSL  191

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGIKE+ARTGKIALRREKMG +APF
Sbjct  192  TIEVTGDPGKMVAVQRNLSKFGIKEIARTGKIALRREKMGASAPF  236


 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + ++
Sbjct  307  QSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESISKL  366

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+QL KLV++ +V DL+  P  ERELMLIK+    + + +++ +A+IFRAK VD+S H +
Sbjct  367  VQQLYKLVDLHEVRDLTYLPFAERELMLIKIAVNAAARRDVLDIANIFRAKAVDVSGHTI  426

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  427  TLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  463



>gb|EPS72034.1| hypothetical protein M569_02723, partial [Genlisea aurea]
Length=408

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            VKRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VL  V+
Sbjct  1    VKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLHHVM  60

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNVLKVED+SREPQVERELMLIK+NA+ + +AE+MWL DIFRAK+VDI++  +T
Sbjct  61   EQLKKLVNVLKVEDISREPQVERELMLIKINADPAYRAEVMWLVDIFRAKIVDIADMSLT  120

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFG++E+ARTGKIALRREK+GE+APF
Sbjct  121  IEVTGDPGKMVAVQRNLSKFGVREIARTGKIALRREKLGESAPF  164


 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVFARRGYNI+SLAVG  +   L   T VV GTD+ + +
Sbjct  233  LRSHTLSMLVNDAPGVLNLITGVFARRGYNIQSLAVGHAETDGLSRITTVVPGTDESIAK  292

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QLNKL+++  VEDL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  293  LLKQLNKLIDLHAVEDLTHLPFAERELMLIKVAVNAAARRDVLDIASIFRAKAVDVSDHT  352

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  353  ITLELTGDFDKMVALQRLLEPYGICEVARTGRVALLRES  391



>dbj|BAM75181.1| B3-type transcription factor [Ricinus communis]
Length=767

 Score =   288 bits (738),  Expect = 3e-88, Method: Composition-based stats.
 Identities = 143/165 (87%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTDKVLQQV
Sbjct  73   RVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQV  132

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SE  +
Sbjct  133  VEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQSL  192

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  193  TIEVTGDPGKMVALTTNLEKFGIKEIARTGKIALRREKMGETAPF  237


 Score =   146 bits (368),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 70/158 (44%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  305  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  364

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL+++ ++++++  P  ERELMLIK+ A+ S + +++ +A +FRAK +D+S+H 
Sbjct  365  LVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHT  424

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KM+A+   L+ +GI E+ARTG++AL RE
Sbjct  425  ITLEVTGDLRKMSALQTQLEAYGICEVARTGRVALVRE  462



>emb|CDY19107.1| BnaA04g18470D [Brassica napus]
Length=488

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 170/216 (79%), Gaps = 10/216 (5%)
 Frame = +1

Query  127  PLNRAVFRPKVTHFA----PFVANAAGKGAETVAvsvsspppsv------sRVKRHTISV  276
            PL R  F  K++H +    P   N  G+  E +  SV             S+V++HTISV
Sbjct  28   PLTRVSFPAKISHLSGNKSPNRDNETGQRTERIIRSVDKMVSDAPLTTPESKVRKHTISV  87

Query  277  FVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVN  456
            FVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VLQQV+EQL KLVN
Sbjct  88   FVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVN  147

Query  457  VLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPG  636
            VLKVED+S EPQVERELML+K+NA   ++A+IMWL D FRA++VDI+EH +TIEVTGDPG
Sbjct  148  VLKVEDISSEPQVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAEHALTIEVTGDPG  207

Query  637  KMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            KM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  208  KMIAVERNLRKFQIREIVRTGKIALRREKMGATAPF  243


 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 114/159 (72%), Gaps = 3/159 (2%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTDKVLQ  423
            ++ HT+S+ V D  G++N + GVF+RRGYNI++ LAVG  + + +   T VV  TD+ + 
Sbjct  313  LRSHTLSLLVNDVPGVLNLVTGVFSRRGYNIQAFLAVGHAETEGISRITTVVPATDESVS  372

Query  424  QVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEH  603
            ++V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H
Sbjct  373  KLVQQLYKLVDVHEVHDLTHMPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDH  432

Query  604  FVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  433  TITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  471



>emb|CDX84757.1| BnaA03g14730D [Brassica napus]
Length=467

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 168/208 (81%), Gaps = 5/208 (2%)
 Frame = +1

Query  136  RAVFRPKVTHFA--PFVANAAGKGAETVAvsvssppps---vsRVKRHTISVFVGDESGI  300
            R  F  K++HF+      N  GK  E +  SV+         S+V++HTISVFVGDESG+
Sbjct  29   RVSFPSKISHFSGNSNRDNETGKRVERIVRSVNERVSDAPPTSKVRKHTISVFVGDESGM  88

Query  301  INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLS  480
            INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VLQQV+EQL KLVNVLKVED+S
Sbjct  89   INRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVNVLKVEDIS  148

Query  481  REPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRN  660
             EPQVERELML+K+NA    +AEIMWL D FRAKVVDI+EH +TIEVTGDPGKM AV RN
Sbjct  149  SEPQVERELMLVKVNAHPEYRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERN  208

Query  661  LKKFGIKELARTGKIALRREKMGETAPF  744
            LKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  209  LKKFEIREIVRTGKIALRREKMGATAPF  236


 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N              SLAVG  + + +   T VV  TD+ + +
Sbjct  306  LRSHTLSLLVNDVPGVLNL-------------SLAVGHAEAQGISRITTVVPATDESVSK  352

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  353  LVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  412

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  413  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  450



>ref|XP_007201965.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
 gb|EMJ03164.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
Length=494

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RH ISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+QV
Sbjct  88   KVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRQV  147

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVLKVEDLS EPQVERELMLIK+NA+ S +AEI WL +IFRAK+VDISEH V
Sbjct  148  IEQLNKLVNVLKVEDLSNEPQVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISEHSV  207

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RN  KFGIKE+ARTGKIALRREK+G +APF
Sbjct  208  TIEVTGDPGKMVALQRNFSKFGIKEVARTGKIALRREKLGASAPF  252


 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  322  LRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISK  381

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL ++  V+DL+  P  ERELMLIK+ A    + +++ + +IFRAK VD+S+H 
Sbjct  382  LVQQLYKLADIHDVQDLTNLPFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHT  441

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  442  ITLELTGDLNKMVALQRLLEPYGICEVARTGRIALVRES  480



>ref|XP_009782832.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=483

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            + +RHTI VFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV
Sbjct  77   KTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQV  136

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNV+KVEDLS++PQVERELMLIK++A+   + E+MWL D+FRAK+VDIS+H +
Sbjct  137  MEQLQKLVNVIKVEDLSKDPQVERELMLIKISADPKYRTEVMWLVDVFRAKIVDISDHSL  196

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  197  TIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  241


 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  311  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  370

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V D++  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H 
Sbjct  371  LVQQLYKLVDIHEVRDITHHPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHT  430

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  431  ITLELTGDLHKMVALQRLLEPYGICEVARTGRLALVRE  468



>ref|XP_006446200.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59440.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=469

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVV GTDKVLQQV+
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVM  143

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNVLKVEDLS EPQVERELMLIK+NA+   +AEI WL DIFRAK+VDISE+ +T
Sbjct  144  EQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLT  203

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  204  IEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPF  247


 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  TD+ + +
Sbjct  316  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  375

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QL KL+++ +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  376  LMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHT  435

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELA  690
            +T+E+TGD  KM A+ R L+ +GI E+ 
Sbjct  436  ITLELTGDLDKMVALQRLLEPYGICEVC  463



>ref|XP_010911692.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like, 
partial [Elaeis guineensis]
Length=256

 Score =   273 bits (697),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQL  441
            HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGTD+VL+QVVEQL
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDRALFTIVVSGTDRVLRQVVEQL  147

Query  442  NKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEV  621
            +KLVNVLKV+DLS+EPQVERELMLIKLN     + E+M L DIFRAKVVDISEH +TIEV
Sbjct  148  HKLVNVLKVDDLSKEPQVERELMLIKLNVGPERRQEVMGLVDIFRAKVVDISEHSLTIEV  207

Query  622  TGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE APF
Sbjct  208  TGDPGKIVAVQRNLHKFGIKEIARTGKIALRREKMGENAPF  248



>ref|XP_010469674.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010469675.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  84   RVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  143

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRAKVVDI+EH +
Sbjct  144  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHAL  203

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  204  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  248


 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  TD+ + +
Sbjct  318  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QLNKLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  438  ITLQLTGDLDKMVALQRFLEPYGICEVARTGRVALARE  475



>ref|XP_009132818.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=480

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 168/208 (81%), Gaps = 5/208 (2%)
 Frame = +1

Query  136  RAVFRPKVTHFA--PFVANAAGKGAETVAvsvssppps---vsRVKRHTISVFVGDESGI  300
            R  F  K++HF+      N  GK  E +  SV+         S+V++HTISVFVGDESG+
Sbjct  29   RVSFPSKISHFSGNSNRDNETGKRVERIVRSVNERVSDAPPTSKVRKHTISVFVGDESGM  88

Query  301  INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLS  480
            INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VLQQV+EQL KLVNVLKVED+S
Sbjct  89   INRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVNVLKVEDIS  148

Query  481  REPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRN  660
             EPQVERELML+K+NA    +AEIMWL D FRAKVVDI+EH +TIEVTGDPGKM AV RN
Sbjct  149  SEPQVERELMLVKVNAHPEYRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERN  208

Query  661  LKKFGIKELARTGKIALRREKMGETAPF  744
            LKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  209  LKKFEIREIVRTGKIALRREKMGATAPF  236


 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  TD+ + +
Sbjct  306  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAEAQGISRITTVVPATDESVSK  365

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  366  LVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  425

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  426  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  463



>ref|XP_006663345.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=425

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            +KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+K+L+QVV
Sbjct  20   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILKQVV  79

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV++V+DLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVD+S+H +T
Sbjct  80   EQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLT  139

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE APF
Sbjct  140  IEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRREKMGENAPF  183


 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GTD+ + ++V 
Sbjct  256  HTLSILVNDFPGVLNVVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  315

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+DL+  P   RELM+IK+    + +  I+ +ADIFRAK VD+S+H VT+
Sbjct  316  QLYKLIDVYEVQDLTHLPFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVSDHTVTL  375

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            ++TGD  KM A+ R L+ +GI E+ARTG++ALRRE
Sbjct  376  QLTGDLDKMVALQRMLEPYGICEVARTGRVALRRE  410



>ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=488

 Score =   280 bits (717),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVV GTDKVLQQV+
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVM  143

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNVLKVEDLS EPQVERELMLIK+NA+   +AEI WL DIFRAK+VDISE+ +T
Sbjct  144  EQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLT  203

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  204  IEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPF  247


 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  TD+ + +
Sbjct  316  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  375

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QL KL+++ +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  376  LMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHT  435

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  436  ITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  474



>ref|XP_008243055.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Prunus mume]
Length=494

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RH ISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+QV
Sbjct  88   KVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRQV  147

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVLKVEDLS EPQVERELMLIK+NA+ S +AEI WL +IFRAK+VDISEH V
Sbjct  148  IEQLNKLVNVLKVEDLSNEPQVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISEHSV  207

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RN  KFGIKE+ARTGKIALRREK+G +APF
Sbjct  208  TIEVTGDPGKMVALQRNFSKFGIKEVARTGKIALRREKLGASAPF  252


 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  322  LRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISK  381

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL ++  V+DL+  P  ERELMLIK+ A    + +++ + +IFRAK VD+S+H 
Sbjct  382  LVQQLYKLADIHDVQDLTNLPFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHT  441

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  442  ITLELTGDLNKMVALQRLLEPYGICEVARTGRIALVRES  480



>ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Citrus sinensis]
Length=488

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVV GTDKVLQQV+
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVM  143

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNVLKVEDLS EPQVERELMLIK+NA+   +AEI WL DIFRAK+VDISE+ +T
Sbjct  144  EQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLT  203

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  204  IEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPF  247


 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  TD+ + +
Sbjct  316  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  375

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QL KL+++ +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  376  LMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHT  435

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  436  ITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  474



>gb|EEC67965.1| hypothetical protein OsI_35716 [Oryza sativa Indica Group]
Length=476

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            +KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+K+L+QVV
Sbjct  71   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILKQVV  130

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV++V+DLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVD+S+H +T
Sbjct  131  EQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLT  190

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE+APF
Sbjct  191  IEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRREKMGESAPF  234


 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            H++S+ V D +G++N + GVF+RRGYNI+SLAVG  + +     T VV GTD+ + ++V 
Sbjct  307  HSLSILVNDFTGVLNVVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+DL+  P   RELM+IK+    + +  I+ +ADIFRAK VD+S+H VT+
Sbjct  367  QLYKLIDVYEVQDLTHLPFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVSDHTVTL  426

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            ++TGD  KM A+ R L+ +GI E+ARTG++ALRRE
Sbjct  427  QLTGDLDKMVALQRMLEPYGICEVARTGRVALRRE  461



>gb|AAX96859.1| acetolactate synthase, small subunit, putative [Oryza sativa 
Japonica Group]
 gb|ABA92419.1| acetolactate synthase small subunit, putative, expressed [Oryza 
sativa Japonica Group]
Length=476

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            +KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+K+L+QVV
Sbjct  71   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILKQVV  130

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV++V+DLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVD+S+H +T
Sbjct  131  EQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLT  190

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE+APF
Sbjct  191  IEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRREKMGESAPF  234


 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            H++S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GTD+ + ++V 
Sbjct  307  HSLSILVNDFPGVLNVVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+DL+  P   RELM+IK+    + +  I+ +ADIFRAK VD+S+H VT+
Sbjct  367  QLYKLIDVYEVQDLTHLPFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVSDHTVTL  426

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            ++TGD  KM A+ R L+ +GI E+ARTG++ALRRE
Sbjct  427  QLTGDLDKMVALQRMLEPYGICEVARTGRVALRRE  461



>emb|CAX48742.1| acetohydroxyacid synthase regulatory subunit 1 precursor [Eupatorium 
cannabinum]
Length=475

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 163/198 (82%), Gaps = 2/198 (1%)
 Frame = +1

Query  151  PKVTHFAPFVANAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFAR  330
            PK  HF      A+     T   S SS      +V+RHTISVFVGDESG+INRIAGVFAR
Sbjct  39   PKTFHFKRLFVQASNGTVSTAVDSTSSMARP--KVRRHTISVFVGDESGMINRIAGVFAR  96

Query  331  RGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELM  510
            RGYNIESLAVGLNKDKALFTIVVSGT++VL+QV++QL KLVNVLKVED+S+EPQVERELM
Sbjct  97   RGYNIESLAVGLNKDKALFTIVVSGTERVLEQVMKQLLKLVNVLKVEDISKEPQVERELM  156

Query  511  LIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELA  690
            LIK+NA+   + E+ WL DIFRAK+VDIS+H +TIEVTGDPGKM AV RNL KFGI+E+A
Sbjct  157  LIKINADPRYRLEVKWLVDIFRAKIVDISDHSITIEVTGDPGKMVAVQRNLSKFGIQEVA  216

Query  691  RTGKIALRREKMGETAPF  744
            RTGKIALRRE+MGE APF
Sbjct  217  RTGKIALRRERMGEDAPF  234


 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVF RRGYNI+SLAVG  +   ++  T VV GTD+ +++
Sbjct  303  LRSHTLSIVVNDSPGVLNIVTGVFTRRGYNIQSLAVGHAEVEGRSRITTVVPGTDESIRK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V +V DL+  P  ERELMLIK+      +  ++ +A IFRAK VD+S+H 
Sbjct  363  LVQQLYKLIDVHEVIDLTLMPFAERELMLIKVAVNSMARRNVLDIASIFRAKAVDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+EVTGD  KM A+ R L+  GI E+ARTG++AL RE
Sbjct  423  ITLEVTGDVNKMVALQRLLEPCGICEVARTGRVALTRE  460



>ref|XP_010510152.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
 ref|XP_010510153.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
Length=492

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  84   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  143

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRAKVVDI+EH +
Sbjct  144  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHAL  203

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  204  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  248


 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  TD+ + +
Sbjct  318  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QLNKLV+V  V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLNKLVDVHAVHDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  438  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  475



>emb|CDP08089.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVV GTD VLQQV
Sbjct  100  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVCGTDTVLQQV  159

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNV+KVED+S+EPQVERELML+K+N++   +AE+MWL D FRAK+VD+S++ +
Sbjct  160  MEQLQKLVNVIKVEDISKEPQVERELMLVKINSDPDYRAEVMWLVDTFRAKIVDLSDYSL  219

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGK+ AV RNL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  220  TIEVTGDPGKLVAVQRNLSKFGIREIARTGKIALRREKMGESAPF  264


 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD  + +
Sbjct  334  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDASISK  393

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KLV + +V DL+  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H 
Sbjct  394  LVQQLSKLVELHEVRDLTHMPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHT  453

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  454  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  491



>ref|XP_010414082.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  84   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  143

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRAKVVDI+EH +
Sbjct  144  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHAL  203

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  204  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  248


 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  TD+ + +
Sbjct  318  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QLNKLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  438  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  475



>ref|NP_850174.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08588.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=469

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRA+VVDI+EH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  203  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  247


 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 99/158 (63%), Gaps = 24/158 (15%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  TD+ + +
Sbjct  317  LRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  377  LVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T++V                      ARTG++AL RE
Sbjct  437  ITLQV----------------------ARTGRVALARE  452



>ref|XP_009141188.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=487

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 168/216 (78%), Gaps = 10/216 (5%)
 Frame = +1

Query  127  PLNRAVFRPKVTHFA----PFVANAAGKGAETVAvsvsspppsv------sRVKRHTISV  276
            PL R  F  K +H +    P   N  GK  E +  SV             S+V++HTISV
Sbjct  28   PLTRVSFPAKTSHLSGNKSPNRDNETGKRTERIIRSVDKMVSDAPLTTPESKVRKHTISV  87

Query  277  FVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVN  456
            FVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VLQQV+EQL KLVN
Sbjct  88   FVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVN  147

Query  457  VLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPG  636
            VLKVED+S EPQVERELML+K+NA   ++A+IMWL D FRA++VDI+EH +TIEVTGDPG
Sbjct  148  VLKVEDISSEPQVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAEHALTIEVTGDPG  207

Query  637  KMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            KM AV RNL+KF I+E+ RTGKIALRREKMG  APF
Sbjct  208  KMIAVERNLRKFQIREIVRTGKIALRREKMGAPAPF  243


 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVFARRGYNI+SLAVG  + + +   T VV  TD+ + +
Sbjct  313  LRSHTLSLLVNDVPGVLNLITGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  372

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  373  LVQQLYKLIDVHEVHDLTHMPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  432

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  433  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  470



>ref|XP_010469676.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=491

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRAKVVDI+EH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  203  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  247


 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  TD+ + +
Sbjct  317  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QLNKLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  377  LVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  ITLQLTGDLDKMVALQRFLEPYGICEVARTGRVALARE  474



>ref|XP_009144047.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X3 [Brassica rapa]
Length=446

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGT++VLQQV
Sbjct  63   KVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERVLQQV  122

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL + FRA+VVDISEH +
Sbjct  123  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHAL  182

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  183  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  227


 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  TD+ + +
Sbjct  297  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  356

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A +FRAK VD+S+H 
Sbjct  357  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHT  416

Query  607  VTIEV  621
            +T++V
Sbjct  417  ITLQV  421



>gb|EMT17230.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=472

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            VKRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+K+L QVV
Sbjct  67   VKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILTQVV  126

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNV++V+DLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVD+S+H +T
Sbjct  127  EQLYKLVNVIQVDDLSKEPQVERELMLIKLNVEPEQRLEVMGLVDIFRAKVVDLSDHTLT  186

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            +EVTGDPGK+AAV RNL KFGIKE+ARTGKIALRREKMG+TAPF
Sbjct  187  VEVTGDPGKIAAVQRNLNKFGIKEVARTGKIALRREKMGQTAPF  230


 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  +       T VV G D+ + ++V+
Sbjct  302  HTLSILVNDSPGVLNVVTGVFARRGYNIQSLAVGPAEKTGTSRITTVVPGNDESIAKLVQ  361

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLA-DIFRAKVVDISEHFVT  612
            QL KL++V +V+DL+  P   RELM+IK+    S + EI+ +A D+FRAK VD+S H +T
Sbjct  362  QLYKLIDVYEVQDLTHLPFAARELMIIKVAGNTSARREILDIAEDVFRAKTVDVSGHTIT  421

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  422  LQLTGDLDKMVALQRLLEPYGICEIARTGRVALCRE  457



>ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
 gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
Length=490

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 152/168 (90%), Gaps = 3/168 (2%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            + +RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT++VLQQV
Sbjct  81   KARRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTERVLQQV  140

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNVLKVEDLS EPQVERELML+K+N +   +AEIMWL  IFRAK+VDISEH V
Sbjct  141  VEQLQKLVNVLKVEDLSNEPQVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISEHTV  200

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGK---IALRREKMGETAPF  744
            TIEVTGDPGK+AAV RNL KFGI+E+ARTGK   IALRREKMG +APF
Sbjct  201  TIEVTGDPGKIAAVQRNLSKFGIREIARTGKVVLIALRREKMGASAPF  248


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  318  LQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V DL+  P  ERELMLIK+    + + +++ +A IFRA  VD+S+H 
Sbjct  378  LVQQLYKLVEIHEVRDLTHVPFAERELMLIKIAVNAAARRDVLDIASIFRANAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            VT+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  438  VTLELTGDLDKMVALQRLLEPYGICEVARTGRIALTRES  476



>ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=491

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRA+VVDI+EH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  203  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  247


 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  TD+ + +
Sbjct  317  LRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  377  LVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  474



>ref|XP_009144045.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Brassica rapa]
Length=457

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGT++VLQQV
Sbjct  63   KVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERVLQQV  122

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL + FRA+VVDISEH +
Sbjct  123  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHAL  182

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  183  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREKMGATAPF  227


 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  TD+ + +
Sbjct  297  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  356

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A +FRAK VD+S+H 
Sbjct  357  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHT  416

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELA  690
            +T+++TGD  KM A+ R L+ +GI E++
Sbjct  417  ITLQLTGDLDKMVALQRLLEPYGICEVS  444



>ref|XP_010466593.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=421

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDE G+INRIAGVFA RGYN ESLA+GLN+DKALFTIVV GTDKVLQQV
Sbjct  78   RVRRHTISVFVGDERGMINRIAGVFASRGYNTESLAMGLNEDKALFTIVVLGTDKVLQQV  137

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKL NV+KVEDLS+EP VERELMLIKLNA+ ST++EIMWL DIFRAK+VD SEH +
Sbjct  138  VEQLNKLDNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHSL  197

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
             IE TGD GK+ A+ RNL+KFGIKE+ARTGKIALRREKMGETAPF
Sbjct  198  MIEGTGDSGKLVALERNLEKFGIKEIARTGKIALRREKMGETAPF  242


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V +   ++N I G  +RRGYNI+SLAVG  + + L   T V+ GTD  + ++
Sbjct  312  RSHTLSILVTNVPRVLNLITGAISRRGYNIQSLAVGPAEKEGLCRITTVIPGTDDHIDKL  371

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTK  543
            V QL  L+++ +V +++  P  ERELMLIK+ A    +
Sbjct  372  VRQLQMLIDLHEVLNITNMPFAERELMLIKVAAHTCAR  409



>ref|XP_004490063.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=475

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +1

Query  184  NAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  363
            +AA     TV+ +     PS S+V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVG
Sbjct  47   SAATSADTTVSSNGPVTSPSRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG  106

Query  364  LNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTK  543
            LN+D+ALF+IVVSGT++VLQQVVEQL KLVNVLKVEDLS EPQVERELML+K+NA+   +
Sbjct  107  LNQDRALFSIVVSGTNRVLQQVVEQLQKLVNVLKVEDLSNEPQVERELMLLKVNADPQNR  166

Query  544  AEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            AEI WL D FR K+VDISE+ VTIEVTGDPGKM AV R+L KFGIKE++RTGKIALRREK
Sbjct  167  AEIKWLVDTFRGKIVDISENSVTIEVTGDPGKMVAVQRSLSKFGIKEISRTGKIALRREK  226

Query  724  MGETAPF  744
            MG +APF
Sbjct  227  MGASAPF  233


 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GTD+ + +
Sbjct  303  IRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRA+ VD+S+H 
Sbjct  363  LVQQLYKLVELHEVRDITHVPFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL R+ 
Sbjct  423  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRDS  461



>ref|XP_003576101.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=474

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            VKRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+K+L+QVV
Sbjct  70   VKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILKQVV  129

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV++V+DLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVD+SE  +T
Sbjct  130  EQLNKLVNVIQVDDLSKEPQVERELMLIKLNVESDRRLEVMGLVDIFRAKVVDLSERTLT  189

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFGIKE+ARTGKIALRREK+G+TAPF
Sbjct  190  IEVTGDPGKMVAVQRNLSKFGIKEIARTGKIALRREKIGQTAPF  233


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 110/156 (71%), Gaps = 2/156 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  +   +   T VV G D+ + ++V 
Sbjct  305  HTLSILVNDVPGVLNVVTGVFSRRGYNIQSLAVGPAEKLGISRITTVVPGNDESIAKLVH  364

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+DL+  P   RELM+IK+    + +  I+ +ADIFRAK VD+S+H VT+
Sbjct  365  QLYKLIDVHEVQDLTHLPFAARELMIIKVAVNTTARRAILDIADIFRAKTVDVSDHTVTL  424

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            ++TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  425  QLTGDLDKMVALQRMLEPYGICEIARTGRVALSRES  460



>emb|CDY42070.1| BnaA05g11160D [Brassica napus]
Length=469

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGT++VLQQV
Sbjct  74   KVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERVLQQV  133

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL + FRA+VVDISEH +
Sbjct  134  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHAL  193

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  194  TIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGATAPF  238


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N              SLAVG  + + +   T VV  TD+ + +
Sbjct  308  LRSHTLSLLVNDVPGVLNL-------------SLAVGHAETEGISRITTVVPATDESVSK  354

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A +FRAK VD+S+H 
Sbjct  355  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHT  414

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  415  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  452



>ref|XP_008383971.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+ V
Sbjct  83   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRLV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV+KVEDLS EPQVERELMLIK+NA+ S  AEI WL  IFRAK+VDISEH V
Sbjct  143  IEQLNKLVNVMKVEDLSIEPQVERELMLIKVNADPSYHAEIKWLVXIFRAKIVDISEHSV  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  203  TIEVTGDPGKMVALQRNLSKFGIREIARTGKIALRREKLGASAPF  247


 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  317  LRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAVGXAEAEGLSRITTVVPGTDESISK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V  V+DL+  P  ERELMLIK+ A    + +++ + +IFRAK VD+S+H 
Sbjct  377  LVQQLYKLVDVHDVQDLTNLPFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  437  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  475



>ref|XP_008354318.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+ V
Sbjct  83   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRLV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV+KVEDLS EPQVERELMLIK+NA+ S  AEI WL  IFRAK+VDISEH V
Sbjct  143  IEQLNKLVNVMKVEDLSIEPQVERELMLIKVNADPSYHAEIKWLVXIFRAKIVDISEHSV  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  203  TIEVTGDPGKMVALQRNLSKFGIREIARTGKIALRREKLGASAPF  247


 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  317  LRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAVGHAEAEGLSRITTVVPGTDESISK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V  V+DL+  P  ERELMLIK+ A    + +++ + +IFRAK VD+S+H 
Sbjct  377  LVQQLYKLVDVHDVQDLTNLPFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  437  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  475



>emb|CDY34514.1| BnaC04g12850D [Brassica napus]
Length=468

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGT++VLQQV
Sbjct  73   KVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERVLQQV  132

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL + FRA+VVDISEH +
Sbjct  133  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHAL  192

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  193  TIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGATAPF  237


 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N              SLAVG  + + +   T VV  TD+ + +
Sbjct  307  LRSHTLSLLVNDVPGVLNL-------------SLAVGHAETEGISRITTVVPATDESVSK  353

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A +FRAK VD+S+H 
Sbjct  354  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHT  413

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  414  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  451



>ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
 gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
Length=492

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  84   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  143

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRAKVVDI+EH +
Sbjct  144  IEQLLKLVNVLKVEDISSEPQVERELMLVKVNANPESRAEIMWLVDTFRAKVVDIAEHAL  203

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  204  TIEVTGDPGKMIAVERNLEKFQIREIVRTGKIALRREKMGATAPF  248


 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T+VV  TD+ + +
Sbjct  318  LRSHTLSLLVSDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITLVVPATDESVSK  377

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QLNKLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  378  LVQQLNKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  437

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  438  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  475



>gb|KFK31180.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=491

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRAK+VDI+EH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLLDTFRAKIVDIAEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  203  TIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGATAPF  247


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  TD+ + +
Sbjct  317  LRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRA  VD+S+H 
Sbjct  377  LVQQLYKLVDVHEVHDLTHFPFAERELMLIKIAVNAAARRDVLDIASIFRAIAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  474



>gb|AFW62902.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_432211 [Zea 
mays]
Length=250

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL QV
Sbjct  76   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLNQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVDISE  +
Sbjct  136  IEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETA  738
            T+EV GDPGK+AAV RNL KFGIKE+ RTGKIALRRE++G TA
Sbjct  196  TMEVAGDPGKIAAVQRNLWKFGIKEICRTGKIALRRERIGATA  238



>ref|XP_009366239.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Pyrus x bretschneideri]
Length=489

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+ V
Sbjct  83   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRLV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV+KVEDLS EPQVERELMLIK+NA+ S  AEI WL  IFRAK+VDISEH V
Sbjct  143  IEQLNKLVNVMKVEDLSIEPQVERELMLIKVNADPSYHAEIKWLVSIFRAKIVDISEHSV  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RN  KFGI+E+ARTGKIALRREK+G +APF
Sbjct  203  TIEVTGDPGKMVALQRNFSKFGIREVARTGKIALRREKLGASAPF  247


 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  317  LRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAVGHAEAEGLSRITTVVPGTDESISK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++  V+DL+  P  ERELMLIK+ A  + + +++ + +IFRAK VD+S+H 
Sbjct  377  LVQQLYKLVDIHDVQDLTNLPFAERELMLIKIAANAAARRDVLDIGNIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  437  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  475



>ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA    +AEIMWL D FRA+VVDI+EH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPEFRAEIMWLVDTFRARVVDIAEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  203  TIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGATAPF  247


 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 114/159 (72%), Gaps = 3/159 (2%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTDKVLQ  423
            ++ HT+S+ V D  G++N + GVFARRGYNI++ LAVG  + K +   T VV  TD+ + 
Sbjct  317  LRSHTLSLLVNDTPGVLNIVTGVFARRGYNIQAYLAVGHAETKGISRITTVVPATDESIS  376

Query  424  QVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEH  603
            ++V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H
Sbjct  377  KLVQQLYKLVDVHEVHDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDH  436

Query  604  FVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  TITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  475



>ref|XP_008800993.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=488

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQL  441
            HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL+QVVEQL
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLRQVVEQL  147

Query  442  NKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEV  621
            +KLVNVLKVEDLS+EPQVERELMLIKLN     + E+M L DIFRAK+VDISEH +TIEV
Sbjct  148  HKLVNVLKVEDLSKEPQVERELMLIKLNVGPERRQEVMGLVDIFRAKIVDISEHSLTIEV  207

Query  622  TGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE APF
Sbjct  208  TGDPGKVVAVRRNLNKFGIKEIARTGKIALRREKMGENAPF  248


 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GTD+ + ++V+
Sbjct  319  HTLSILVNDSPGVLNIVTGVFSRRGYNIQSLAVGPEEKEGISRITTVVPGTDESIGKLVQ  378

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KLV+V +V+D++  P  ERELMLIK+    + + +I+ +ADIFRAK VD+S+H +T+
Sbjct  379  QLYKLVDVHEVQDITHLPFAERELMLIKVAVNTAARRDILDIADIFRAKAVDVSDHTITL  438

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            ++TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  439  QLTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  474



>gb|KFK31179.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=521

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  113  KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  172

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRAK+VDI+EH +
Sbjct  173  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLLDTFRAKIVDIAEHAL  232

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  233  TIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGATAPF  277


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  TD+ + +
Sbjct  347  LRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  406

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRA  VD+S+H 
Sbjct  407  LVQQLYKLVDVHEVHDLTHFPFAERELMLIKIAVNAAARRDVLDIASIFRAIAVDVSDHT  466

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  467  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  504



>ref|XP_004490062.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=564

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +1

Query  184  NAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  363
            +AA     TV+ +     PS S+V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVG
Sbjct  47   SAATSADTTVSSNGPVTSPSRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG  106

Query  364  LNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTK  543
            LN+D+ALF+IVVSGT++VLQQVVEQL KLVNVLKVEDLS EPQVERELML+K+NA+   +
Sbjct  107  LNQDRALFSIVVSGTNRVLQQVVEQLQKLVNVLKVEDLSNEPQVERELMLLKVNADPQNR  166

Query  544  AEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            AEI WL D FR K+VDISE+ VTIEVTGDPGKM AV R+L KFGIKE++RTGKIALRREK
Sbjct  167  AEIKWLVDTFRGKIVDISENSVTIEVTGDPGKMVAVQRSLSKFGIKEISRTGKIALRREK  226

Query  724  MGETAPF  744
            MG +APF
Sbjct  227  MGASAPF  233


 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GTD+ + +
Sbjct  303  IRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISK  362

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRA+ VD+S+H 
Sbjct  363  LVQQLYKLVELHEVRDITHVPFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHT  422

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELA  690
            +T+E+TGD  KM A+ R L+ +GI E+ 
Sbjct  423  ITLELTGDLDKMVALQRLLEPYGICEVC  450



>ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
 gb|ESQ51762.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
Length=491

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++ EIMWL D FRA++VDI+EH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRPEIMWLVDTFRARIVDIAEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM AV RNL+KF I+E+ RTGKIALRREKMG TAPF
Sbjct  203  TIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGATAPF  247


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  TD+ + +
Sbjct  317  LRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRA  VD+S+H 
Sbjct  377  LVQQLYKLVDVHEVHDLTHLPFAERELMLIKIAVNAAARRDVLDIASIFRAIAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  474



>ref|XP_006664907.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Oryza brachyantha]
Length=412

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGTD+VL QV
Sbjct  4    RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTDRVLNQV  63

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVDISE+ +
Sbjct  64   IEQLNKLVNVLNVEDLSKEPQVERELMLIKLNVEPYQRPEVMVLVDIFRAKVVDISENTL  123

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EVTGDPGK+ AV RNL KFGIKE+ RTGKIALRREK+G TA F
Sbjct  124  TVEVTGDPGKIVAVQRNLSKFGIKEICRTGKIALRREKIGATARF  168


 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  +   L   T V+ GTD+ +++
Sbjct  240  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKAGLSRITTVIPGTDESIEK  299

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V+D++  P  ERELMLIK++   + + +I+ +A+IFRAK VD+S+H 
Sbjct  300  LVQQLYKLVDVHEVQDITHWPFAERELMLIKVSVNTAARRDILDIAEIFRAKPVDVSDHT  359

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  360  VTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  397



>gb|EMS53688.1| Acetolactate synthase small subunit [Triticum urartu]
Length=384

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL+QV
Sbjct  2    RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLKQV  61

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN E   +A++M++A++FRAKVVDISE+ +
Sbjct  62   IEQLNKLVNVLNVEDLSKEPQVERELMLIKLNVEPDQRADVMFVANVFRAKVVDISENSL  121

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EVTGDPGK+ A  RNL+KFGI+E+ RTGKIALRREK+G TA F
Sbjct  122  TLEVTGDPGKIVAAQRNLRKFGIEEICRTGKIALRREKIGATARF  166


 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 107/146 (73%), Gaps = 2/146 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GTD+ +++
Sbjct  237  LRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIEK  296

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V KV+DL+  P  ERELM+IK++   + + EI+ + +IFRA+ VD+S+H 
Sbjct  297  LVQQLYKLIDVHKVDDLTDLPFAERELMVIKVSGNTAARREILDIGNIFRAECVDLSDHT  356

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKE  684
            VT+++TGD  KM A+ R L+ +GI E
Sbjct  357  VTLQLTGDLDKMVALQRLLEPYGICE  382



>ref|XP_008367825.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=492

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VL+QV
Sbjct  86   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQV  145

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV+KVED+S EPQVEREL+LIK+N++    AEI WL  IFRAK+VDISEH V
Sbjct  146  IEQLNKLVNVIKVEDISNEPQVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISEHSV  205

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+ RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  206  TIEVTGDPGKMVALQRNLSKFGIREVARTGKIALRREKLGASAPF  250


 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  + GVFARRGYNI+SLAVG  +   ++  T VV GTD+ + +
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++  V+DL+  P  ERELMLIK+  +   + +++ +  IFRAK VD+S+H 
Sbjct  380  LVQQLYKLVDIHNVQDLTNLPFAERELMLIKIAXDAVARRDVLDIGKIFRAKAVDVSDHT  439

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  440  ITLELTGDLNKMVALQRLLEPYGICEVARTGRIALVRES  478



>ref|XP_008394268.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X3 [Malus domestica]
Length=402

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VL+QV
Sbjct  86   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQV  145

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV KVED+S EPQVEREL+LIK+N++    AEI WL  IFRAK+VDISEH V
Sbjct  146  IEQLNKLVNVXKVEDISNEPQVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISEHSV  205

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  206  TIEVTGDPGKMVALQXNLSKFGIREVARTGKIALRREKLGASAPF  250


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  + GVFARRGYNI+SLAVG    + ++  T VV GTD+ + +
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  427  VVEQLNKLVNV  459
            +V+QL KLV++
Sbjct  380  LVQQLYKLVDI  390



>ref|XP_008394267.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Malus domestica]
Length=408

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VL+QV
Sbjct  86   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQV  145

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV KVED+S EPQVEREL+LIK+N++    AEI WL  IFRAK+VDISEH V
Sbjct  146  IEQLNKLVNVXKVEDISNEPQVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISEHSV  205

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  206  TIEVTGDPGKMVALQXNLSKFGIREVARTGKIALRREKLGASAPF  250


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  + GVFARRGYNI+SLAVG    + ++  T VV GTD+ + +
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  427  VVEQLNKLVNV  459
            +V+QL KLV++
Sbjct  380  LVQQLYKLVDI  390



>gb|AAD32291.1| putative acetolactate synthase [Arabidopsis thaliana]
Length=484

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D FRA+VVDI+EH +
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHAL  202

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGK---IALRREKMGETAPF  744
            TIEVTGDPGKM AV RNLKKF I+E+ RTGK   IALRREKMG TAPF
Sbjct  203  TIEVTGDPGKMIAVERNLKKFQIREIVRTGKVVYIALRREKMGATAPF  250


 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 104/158 (66%), Gaps = 12/158 (8%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + G          SLAVG  + K +   T V+  TD+ + +
Sbjct  320  LRSHTLSLLVNDIPGVLNIVTG----------SLAVGHAETKGISRITTVIPATDESVSK  369

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  370  LVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  429

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  430  ITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  467



>ref|XP_002452423.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
 gb|EES05399.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
Length=492

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL QV
Sbjct  84   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLNQV  143

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVDISE  +
Sbjct  144  IEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTL  203

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEV GDPGK+AAV RNL+KFGIKE+ RTGKIALRREK+G TA F
Sbjct  204  TIEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREKIGATARF  248


 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT + +++
Sbjct  320  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEK  379

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V D++  P  ERELMLIK++   + + EI+ +A+IFRAK VD+S+H 
Sbjct  380  LVQQLYKLVDVHEVHDITPSPFAERELMLIKVSVNTAARREILDIAEIFRAKPVDVSDHT  439

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  440  VTLQLTGDFDKMVALQRLLEPYGICEVARTGRVALVRE  477



>ref|XP_006858758.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
 gb|ERN20225.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
Length=496

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 5/225 (2%)
 Frame = +1

Query  85   GVRKSFLPAFSKPG--PLNRAVFRPK---VTHFAPFVANAAGKGAETVAvsvsspppsvs  249
             V +S++P+F+  G  P   ++FR     +   +   A+A G  +  VA+  ++P  +++
Sbjct  27   AVNRSYIPSFTSIGFSPHKLSIFRKDGLVLRSNSRVSASADGASSNGVAIPDAAPSRALN  86

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNI+SLAVGLN DKALFTIVVSGT++VL+QV
Sbjct  87   KVQRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNSDKALFTIVVSGTERVLRQV  146

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
              QL KLVNVLKVEDLS+EPQVERELMLIK+N + + +AE++ L DIFRA+VVD+S+  +
Sbjct  147  TNQLYKLVNVLKVEDLSKEPQVERELMLIKVNVDHNKRAEVLGLVDIFRARVVDVSDDLL  206

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGK+ AV R L+KFGI+E+ARTGKIALRREKMG TAPF
Sbjct  207  TIEVTGDPGKIVAVERILRKFGIREIARTGKIALRREKMGATAPF  251


 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTI--VVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + G F+RRGYNI+SLAVG ++ + +  I  VV  TD+ + +
Sbjct  324  LRSHTLSLLVNDCPGVLNIVTGCFSRRGYNIQSLAVGPSEREGISRIMTVVPATDESISK  383

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V QL KL++V +V D++  P  +RELMLIK+    + + E++ +A IFRAK VD+S+H 
Sbjct  384  LVRQLYKLIDVHEVRDITHLPFAQRELMLIKIAVNTAARREVLEIASIFRAKAVDVSDHT  443

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD GK+ A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  444  ITLELTGDLGKLVAIQRLLEPYGICEVARTGRIALARES  482



>gb|EMT12300.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=432

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL+QV
Sbjct  9    RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLKQV  68

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN E   +A++M++A++FRAKVVDISE+ +
Sbjct  69   IEQLNKLVNVLNVEDLSKEPQVERELMLIKLNVEPDQRADVMFVANVFRAKVVDISENSL  128

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EVTGDPGK+ A  RNL+KFGI+E+ RTGKIALRREK+G  A F
Sbjct  129  TLEVTGDPGKIVAAQRNLRKFGIEEICRTGKIALRREKIGAAARF  173


 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 107/146 (73%), Gaps = 2/146 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GTD+ +++
Sbjct  244  LRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIEK  303

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V KV+DL+  P  ERELM+IK++   + + EI+ + +IFRA+ VD+S+H 
Sbjct  304  LVQQLYKLIDVHKVDDLTDLPFAERELMVIKVSGNTAARREILDIGNIFRAECVDLSDHT  363

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKE  684
            VT+++TGD  KM A+ R L+ +GI E
Sbjct  364  VTLQLTGDLDKMVALQRLLEPYGICE  389



>ref|XP_004288733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=510

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RH ISVFVGDESG+INRI+GVFARRGYNIESLAVGLNKDKALFTIVVSGTD VL+QV+
Sbjct  105  VRRHAISVFVGDESGMINRISGVFARRGYNIESLAVGLNKDKALFTIVVSGTDTVLRQVI  164

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL+KLVNVLKVEDLS EPQVERELMLIK+ A     AEI W+ +IFRAK+VDIS+H VT
Sbjct  165  EQLHKLVNVLKVEDLSSEPQVERELMLIKVTAHPDYLAEIRWIVNIFRAKIVDISDHSVT  224

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM A+ RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  225  IEVTGDPGKMVALQRNLSKFGIREIARTGKIALRREKLGASAPF  268


 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I GVFARRGYNI+SLAVG  +   ++  T VV  TD+ + +
Sbjct  338  LRSHTLSMLVNDVPGVLYIITGVFARRGYNIQSLAVGRAEVEGQSRITTVVPATDESISK  397

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V  V DL+  P  ERELMLIK+ A    + +++ + +IFRAK VD+S+H 
Sbjct  398  LVQQLYKLVDVHDVRDLTNLPFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHT  457

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  458  ITLELTGDLNKMVALQRLLEPYGICEVARTGRIALVRES  496



>tpg|DAA41907.1| TPA: hypothetical protein ZEAMMB73_831035 [Zea mays]
Length=476

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 179/242 (74%), Gaps = 22/242 (9%)
 Frame = +1

Query  55   TMAAAVSQCPGVRKSFLPAFSKPGPLNRAVFRPKVTHFAPFVANAAGKGAETVAvsvssp  234
            TM AA++   G+      A S+ G  +R   RP      P V   AG  A +VAV+ +S 
Sbjct  2    TMNAAIASRLGL------AVSRCGAGSRVDSRP----LTPAVGFTAGPRARSVAVTAASS  51

Query  235  ppsvsRV------------KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDK  378
             P+   V            KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDK
Sbjct  52   SPATGGVTPVPPRSNRSVMKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDK  111

Query  379  ALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMW  558
            ALFTIVVSGTDK+L QVVEQLNKLVNV+KV+DLS EPQVERELMLIK+NAE     EIM 
Sbjct  112  ALFTIVVSGTDKILNQVVEQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMG  171

Query  559  LADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETA  738
            L  IF+A+VVD+S++ +TIEVTGDPGKM A+ + L K+GI+E+ARTGKIALRREKMGETA
Sbjct  172  LVRIFKAEVVDLSDYTLTIEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRREKMGETA  231

Query  739  PF  744
            PF
Sbjct  232  PF  233


 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GTD+ + ++V 
Sbjct  307  HTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+D +  P   RELM+IK+ A  + + +++ +A IF A+ VDIS+H +T+
Sbjct  367  QLYKLIDVYEVQDFTHLPFAARELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITL  426

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +TGD  +M  + + L+++GI E+ARTG+IAL RE
Sbjct  427  LLTGDIDRMVRLQKMLEQYGICEVARTGRIALLRE  461



>gb|KDO50434.1| hypothetical protein CISIN_1g047033mg, partial [Citrus sinensis]
Length=514

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 151/176 (86%), Gaps = 12/176 (7%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVV GTDKVLQQV+
Sbjct  98   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVM  157

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIM------------WLADIFR  576
            EQL KLVNVLKVEDLS EPQVERELMLIK+NA+   +AEI             WL DIFR
Sbjct  158  EQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIFLFPCLGVHLQIRWLVDIFR  217

Query  577  AKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            AK+VDISE+ +TIEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  218  AKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPF  273


 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  TD+ + +
Sbjct  342  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  401

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QL KL+++ +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  402  LMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHT  461

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  462  ITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  500



>ref|NP_001146158.1| uncharacterized protein LOC100279727 [Zea mays]
 gb|ACL53373.1| unknown [Zea mays]
Length=476

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 179/242 (74%), Gaps = 22/242 (9%)
 Frame = +1

Query  55   TMAAAVSQCPGVRKSFLPAFSKPGPLNRAVFRPKVTHFAPFVANAAGKGAETVAvsvssp  234
            TM AA++   G+      A S+ G  +R   RP      P V   AG  A +VAV+ +S 
Sbjct  2    TMNAAIASRLGL------AVSRCGAGSRVDSRP----LTPAVGFTAGPRARSVAVTAASS  51

Query  235  ppsvsRV------------KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDK  378
             P+   V            KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDK
Sbjct  52   SPATGGVTPVPPRSNRSVMKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDK  111

Query  379  ALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMW  558
            ALFTIVVSGTDK+L QVVEQLNKLVNV+KV+DLS EPQVERELMLIK+NAE     EIM 
Sbjct  112  ALFTIVVSGTDKILNQVVEQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMG  171

Query  559  LADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETA  738
            L  IF+A+VVD+S++ +TIEVTGDPGKM A+ + L K+GI+E+ARTGKIALRREKMGETA
Sbjct  172  LVRIFKAEVVDLSDYTLTIEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRREKMGETA  231

Query  739  PF  744
            PF
Sbjct  232  PF  233


 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GTD+ + ++V 
Sbjct  307  HTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+D +  P   RELM+IK+ A  + + +++ +A IF A+ VDIS+H +T+
Sbjct  367  QLYKLIDVYEVQDFTHLPFAARELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITL  426

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +TGD  +M  + + L+++GI E+ARTG+IAL RE
Sbjct  427  LLTGDIDRMVRLQKMLEQYGICEVARTGRIALLRE  461



>ref|XP_008677344.1| PREDICTED: acetolactate synthase/ amino acid binding protein 
isoform X1 [Zea mays]
Length=446

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL QV
Sbjct  76   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLNQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVDISE  +
Sbjct  136  IEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EV GDPGK+AAV RNL KFGIKE+ RTGKIALRRE++G TA F
Sbjct  196  TMEVAGDPGKIAAVQRNLWKFGIKEICRTGKIALRRERIGATARF  240


 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT + +++
Sbjct  311  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEK  370

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V +V D++  P  ERELMLIK++   + + EI+ +A+IFRAK VD+S+H 
Sbjct  371  LVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVNTAARKEILDIAEIFRAKPVDVSDHT  430

Query  607  VTIE  618
            VT++
Sbjct  431  VTLQ  434



>ref|XP_008394266.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=492

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT++VL+QV
Sbjct  86   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQV  145

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV KVED+S EPQVEREL+LIK+N++    AEI WL  IFRAK+VDISEH V
Sbjct  146  IEQLNKLVNVXKVEDISNEPQVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISEHSV  205

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A+  NL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  206  TIEVTGDPGKMVALQXNLSKFGIREVARTGKIALRREKLGASAPF  250


 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  + GVFARRGYNI+SLAVG  +   ++  T VV GTD+ + +
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++  V+DL+  P  ERELMLIK+  +   + +++ +  IFRAK VD+S+H 
Sbjct  380  LVQQLYKLVDIHNVQDLTNLPFAERELMLIKIAXDAVARRDVLDIGKIFRAKAVDVSDHT  439

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  440  ITLELTGDLNKMVALQRLLEPYGICEVARTGRIALVRES  478



>ref|XP_007028127.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
 gb|EOY08629.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
Length=402

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT+ +L+QV
Sbjct  76   KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAIFTIVVSGTEMILRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLVNV+KVED+S+EP VERELMLIKL+A+  T+AE+MWL DIFRAK+VD SE F+
Sbjct  136  VEQLNKLVNVIKVEDISKEPHVERELMLIKLHADADTRAEVMWLVDIFRAKIVDTSEQFL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGK  702
            TIEVTGDPGKMAAV RNL KFGIKELARTGK
Sbjct  196  TIEVTGDPGKMAAVQRNLSKFGIKELARTGK  226


 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T VV GT++ + +
Sbjct  230  LQSHTLSMVVNDTPGVLNVVTGVISRRGYNIQSLAVGPAERDELSRITTVVPGTNETIGK  289

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+D++  P  ERELML+K+    + + +++ +A IFRAK VD+S+H 
Sbjct  290  LVQQLQKLVDLYEVQDMTHLPFAERELMLVKVAVNTAARRDVLDIASIFRAKAVDVSDHT  349

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ RTG++AL RE
Sbjct  350  ITLELTGDLNKMVALQRLLEPYGICEVTRTGRVALVRE  387



>ref|XP_009404279.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN DKALFTI VSGT+KVLQQVV
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNTDKALFTISVSGTEKVLQQVV  143

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNVLKVEDLSREPQVERELMLIKL+ +   + E++ L DIFRAKVVDISE+ +T
Sbjct  144  EQLYKLVNVLKVEDLSREPQVERELMLIKLSVDHHRRPEVLGLVDIFRAKVVDISENSIT  203

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGK+ AV R+L KFGIKE+ARTGKIALRREK+G+TAPF
Sbjct  204  IEVTGDPGKIVAVQRSLSKFGIKEIARTGKIALRREKIGDTAPF  247


 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GTD+ +++
Sbjct  316  LRSHTLSILVNDIPGVLNIVTGVFSRRGYNIQSLAVGPAEKEGISRITTVVPGTDETIEK  375

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q+ KL++V +V D++  P  ERELMLIK+    + + +I+ +A+IFRAK VD+S H 
Sbjct  376  LVQQIYKLIDVHEVHDITHLPFAERELMLIKVAVNTAARRDILDIAEIFRAKAVDVSGHT  435

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            + +E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  436  IALELTGDLNKMVALQRLLEPYGICEVARTGRIALIRES  474



>ref|XP_008667813.1| PREDICTED: uncharacterized protein LOC100279727 isoform X1 [Zea 
mays]
Length=407

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            +KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDK+L QVV
Sbjct  1    MKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKILNQVV  60

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV+KV+DLS EPQVERELMLIK+NAE     EIM L  IF+A+VVD+S++ +T
Sbjct  61   EQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDLSDYTLT  120

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM A+ + L K+GI+E+ARTGKIALRREKMGETAPF
Sbjct  121  IEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRREKMGETAPF  164


 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GTD+ + ++V 
Sbjct  238  HTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  297

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+D +  P   RELM+IK+ A  + + +++ +A IF A+ VDIS+H +T+
Sbjct  298  QLYKLIDVYEVQDFTHLPFAARELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITL  357

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +TGD  +M  + + L+++GI E+ARTG+IAL RE
Sbjct  358  LLTGDIDRMVRLQKMLEQYGICEVARTGRIALLRE  392



>ref|XP_002449227.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
 gb|EES08215.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
Length=476

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            +KRHT+SVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDK+L QVV
Sbjct  71   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKILNQVV  130

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNV+KV+DLS EPQVERELMLIK+NAE     EIM L  IF+A+VVD+S+H +T
Sbjct  131  EQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDLSDHTLT  190

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM A+ + L K+GI+E+ARTGKIALRRE+MGETAPF
Sbjct  191  IEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRRERMGETAPF  234


 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 109/156 (70%), Gaps = 2/156 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG    +  +  T VV G D+ + ++V 
Sbjct  307  HTLSILVNDVPGVLNVVTGVFSRRGYNIQSLAVGPAAKEGTSRITTVVPGNDESIAKLVH  366

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V+D +  P V RELM+IK+ A  + + +++ +A IF A+ VDIS+H +T+
Sbjct  367  QLYKLIDVHEVQDFTHLPFVGRELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITL  426

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
             +TGD  +M  + + L+++GI E+ARTG++AL RE 
Sbjct  427  LLTGDIDRMVRLQKMLEQYGICEVARTGRVALLRES  462



>ref|XP_004953051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Setaria italica]
Length=488

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVL QV
Sbjct  80   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLNQV  139

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN +   + E+M L DIFRAKVVDIS+  +
Sbjct  140  IEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVKPDQRPEVMVLVDIFRAKVVDISDTTL  199

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EV GDPGK+AAV RNL+KFGIKE+ RTGKIALRREK+G TA F
Sbjct  200  TLEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREKIGATARF  244


 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT++ +++
Sbjct  316  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTNESIEK  375

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V +V D++  P  ERELMLIK++   + + EI+ +A+IFRAK VD+S+H 
Sbjct  376  LVQQLYKLIDVHEVHDITHLPFSERELMLIKVSVNTAARREILDIAEIFRAKPVDVSDHT  435

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT++++GD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  436  VTLQLSGDLNKMVALQRLLEHYGICEVARTGRVALVRE  473



>ref|NP_001151166.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|ACG41837.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|AFW62901.1| acetolactate synthase/ amino acid binding protein [Zea mays]
Length=483

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL QV
Sbjct  76   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLNQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVDISE  +
Sbjct  136  IEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTL  195

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EV GDPGK+AAV RNL KFGIKE+ RTGKIALRRE++G TA F
Sbjct  196  TMEVAGDPGKIAAVQRNLWKFGIKEICRTGKIALRRERIGATARF  240


 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT + +++
Sbjct  311  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEK  370

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V +V D++  P  ERELMLIK++   + + EI+ +A+IFRAK VD+S+H 
Sbjct  371  LVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVNTAARKEILDIAEIFRAKPVDVSDHT  430

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            VT+++TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  431  VTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  469



>ref|XP_008643958.1| PREDICTED: uncharacterized protein LOC100381801 isoform X1 [Zea 
mays]
 gb|AFW72257.1| hypothetical protein ZEAMMB73_990877 [Zea mays]
Length=486

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD VL QV
Sbjct  80   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDMVLNQV  139

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNV  VEDLS+EPQVERELMLIKLN E   + E+M L DIFRAKVVDISE  +
Sbjct  140  IEQLNKLVNVHSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTL  199

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEV GDPGK+AAV RNL+KFGIKE+ RTGKIALRREK+G TA F
Sbjct  200  TIEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREKIGATARF  244


 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT + + ++V+
Sbjct  317  HTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGSAEKEGISRITTVVPGTVESIGKLVQ  376

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V +V D++  P  ERELMLIK++   + + EI+ +A+IFRAK +D+S+H VT+
Sbjct  377  QLYKLIDVHEVHDITHSPFAERELMLIKVSVNTAARREILDIAEIFRAKPIDVSDHTVTL  436

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            ++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  QLTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  471



>dbj|BAJ92239.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL+QV
Sbjct  66   RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLKQV  125

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQLNKLVNVL VEDLS+E QVERELMLIKLN E   +A++M++A +FRAKVVDISE+ +
Sbjct  126  IEQLNKLVNVLNVEDLSKEAQVERELMLIKLNVEPDQRADVMFVATVFRAKVVDISENSL  185

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            T+EVTGDPGK+ A  RNL KFGIKE+ RTGKIALRREK+G TA F
Sbjct  186  TLEVTGDPGKIVAAQRNLSKFGIKEICRTGKIALRREKIGATARF  230


 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GTD+ + +
Sbjct  301  LRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIGK  360

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KL++V KV+DL+  P  ERELM+IK++   + + EI+ + +IFRA+ VD+S+H 
Sbjct  361  LVQQLYKLIDVHKVDDLTDLPFAERELMVIKVSGNTAARREILDIGNIFRAECVDLSDHT  420

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+++TGD  KM A+ R L+ +GI E+ARTG+ AL RE
Sbjct  421  VTLQLTGDLDKMVALQRLLEPYGICEVARTGRAALLRE  458



>gb|AFK41430.1| unknown [Lotus japonicus]
Length=478

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  265  TISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLN  444
            TISVFVGDESG+INRIAGVFARRG+NIESLAVGLN+DKALFTIVVSGT  VL+QVVEQL 
Sbjct  77   TISVFVGDESGMINRIAGVFARRGFNIESLAVGLNEDKALFTIVVSGTGTVLRQVVEQLQ  136

Query  445  KLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVT  624
            KL NVLKVEDLS EPQVERELMLIK++AE   +AE+ WL DIFRAK+VDISEH VTIEVT
Sbjct  137  KLANVLKVEDLSNEPQVERELMLIKVHAEPQNRAELKWLVDIFRAKIVDISEHSVTIEVT  196

Query  625  GDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            GDPGK+ AV RNL KFGIKE+ARTGKIALRREKMG +APF
Sbjct  197  GDPGKLVAVQRNLSKFGIKEIARTGKIALRREKMGASAPF  236


 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVF+RRGYNI+SLAVG ++ + +   T VV GTD+ + +
Sbjct  306  IRSHTLSMLVNDVPGVLNVVTGVFSRRGYNIQSLAVGHSEVEGISRLTTVVPGTDESIGK  365

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QL KL++  +V DL+  P  ERELMLIK+    + + +++ +  IFRAK VD+S+H 
Sbjct  366  LLQQLYKLIDQHEVRDLTHMPFAERELMLIKIAVNAAARRDVLDIGSIFRAKAVDVSDHT  425

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  426  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  463



>ref|XP_004504201.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=475

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +1

Query  184  NAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  363
            +AA     TV+   S   PS S+V+RHTISVFVGDESG+INRIAGV A+RGYNIESLAVG
Sbjct  47   SAATSADTTVSSHGSVTSPSRSKVRRHTISVFVGDESGMINRIAGVLAKRGYNIESLAVG  106

Query  364  LNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTK  543
            LN+DKAL +IVVSGTD+ LQQVVEQL KLVNVLKVEDLS EPQVERELML+K++A+   +
Sbjct  107  LNQDKALLSIVVSGTDRGLQQVVEQLQKLVNVLKVEDLSYEPQVERELMLLKVHADPQNR  166

Query  544  AEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            AEI WL D FR  +VD+SE+ VTIEVTGDPGKM AV R+L++FGIKE++RTGKIALRREK
Sbjct  167  AEIKWLVDTFRGNIVDVSENSVTIEVTGDPGKMVAVQRSLRRFGIKEVSRTGKIALRREK  226

Query  724  MGETAPF  744
            MG +APF
Sbjct  227  MGASAPF  233


 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALF--TIVVSGTDKVLQQV  429
            + HT+S+ V D  G+++ + GVFARRGYNI+SL VG ++ + ++  T VV GTD+ + ++
Sbjct  304  RSHTLSILVNDVPGVLSCVTGVFARRGYNIQSLVVGHSEVEGIYRLTTVVPGTDESISKL  363

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRA+ VD+S+H +
Sbjct  364  VQQLYKLVELHEVRDITHVPFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHTI  423

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL R+ 
Sbjct  424  TLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRDS  461



>gb|KGN49589.1| hypothetical protein Csa_5G013280 [Cucumis sativus]
Length=436

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKAL TIVVSGT+KVL+QV
Sbjct  29   RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALLTIVVSGTEKVLEQV  88

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            +EQL+KLVNVLKVEDLS   QVERELMLIK+NAE + +AEI  L D+FRAK+VDIS+  V
Sbjct  89   IEQLHKLVNVLKVEDLSSVQQVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDDSV  148

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            TIEVTGDPGKM A  RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  149  TIEVTGDPGKMVAFQRNLSKFGIREIARTGKIALRREKLGASAPF  193


 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GTD+ + +
Sbjct  264  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  323

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+ L +L +V +V DL+  P  ERELMLIK+ A  S + +++ +A IFRAK VD+S+H 
Sbjct  324  LVQHLYRLADVHEVRDLTHIPFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHT  383

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  384  ITLELTGDLHKMVALQRLLEPYGICEVARTGRVALVRE  421



>ref|XP_008800984.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=502

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 148/175 (85%), Gaps = 14/175 (8%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQL  441
            HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL+QVVEQL
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLRQVVEQL  147

Query  442  NKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIE-  618
            +KLVNVLKVEDLS+EPQVERELMLIKLN     + E+M L DIFRAK+VDISEH +TIE 
Sbjct  148  HKLVNVLKVEDLSKEPQVERELMLIKLNVGPERRQEVMGLVDIFRAKIVDISEHSLTIEV  207

Query  619  -------------VTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
                         VTGDPGK+ AV RNL KFGIKE+ARTGKIALRREKMGE APF
Sbjct  208  TPVEPSLIDNRMQVTGDPGKVVAVRRNLNKFGIKEIARTGKIALRREKMGENAPF  262


 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GTD+ + ++V+
Sbjct  333  HTLSILVNDSPGVLNIVTGVFSRRGYNIQSLAVGPEEKEGISRITTVVPGTDESIGKLVQ  392

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KLV+V +V+D++  P  ERELMLIK+    + + +I+ +ADIFRAK VD+S+H +T+
Sbjct  393  QLYKLVDVHEVQDITHLPFAERELMLIKVAVNTAARRDILDIADIFRAKAVDVSDHTITL  452

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            ++TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  453  QLTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  488



>ref|XP_008450269.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cucumis melo]
Length=495

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVL+QV+
Sbjct  89   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLEQVI  148

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL+KLVNVLKVEDLS   QVERELMLIK+NA+ + +AEI  L D+FRAK+VDIS+  VT
Sbjct  149  EQLHKLVNVLKVEDLSSVQQVERELMLIKINADPTYRAEIKRLVDVFRAKIVDISDDSVT  208

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM A  RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  209  IEVTGDPGKMVAFQRNLSKFGIREIARTGKIALRREKLGASAPF  252


 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GTD+ + +
Sbjct  323  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  382

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL +L +V +V DL+  P  ERELMLIK+ A  S + +++ +A IFRAK VD+S+H 
Sbjct  383  LVQQLYRLADVHEVRDLTHLPFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHT  442

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  443  ITLELTGDLHKMVALQRLLEPYGICEVARTGRVALVRE  480



>ref|XP_003572704.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=481

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL+QV+
Sbjct  74   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLKQVI  133

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQLNKLVNVL VEDLS+EPQVERELMLIKLN     +A++M++AD+FRA+VVDISE+ +T
Sbjct  134  EQLNKLVNVLNVEDLSKEPQVERELMLIKLNVGPDQRADVMFVADVFRARVVDISENSLT  193

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            +EVTGDPGK+ A  RNL KFGI+E+ RTGKIAL REK+G TA F
Sbjct  194  LEVTGDPGKIVAAQRNLSKFGIEEICRTGKIALTREKLGATARF  237


 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GTD+ ++++V+
Sbjct  312  HTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGRAEKEGISRITTVVPGTDESIEKLVQ  371

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL KL++V KV DL+  P  ERELMLIK++   + + EI+ + +IFRAK VD+S+H VT+
Sbjct  372  QLYKLIDVHKVHDLTHLPFAERELMLIKVSGNTAARREILDIGEIFRAKCVDLSDHTVTL  431

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            ++TGD  KM A+   L+ +GI E+ARTG++AL RE
Sbjct  432  QLTGDFAKMVALQGLLEPYGICEVARTGRVALVRE  466



>ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212902 [Cucumis sativus]
Length=489

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKAL TIVVSGT+KVL+QV+
Sbjct  83   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALLTIVVSGTEKVLEQVI  142

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL+KLVNVLKVEDLS   QVERELMLIK+NAE + +AEI  L D+FRAK+VDIS+  VT
Sbjct  143  EQLHKLVNVLKVEDLSSVQQVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDDSVT  202

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM A  RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  203  IEVTGDPGKMVAFQRNLSKFGIREIARTGKIALRREKLGASAPF  246


 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GTD+ + +
Sbjct  317  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  376

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+ L +L +V +V DL+  P  ERELMLIK+ A  S + +++ +A IFRAK VD+S+H 
Sbjct  377  LVQHLYRLADVHEVRDLTHIPFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHT  436

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  437  ITLELTGDLHKMVALQRLLEPYGICEVARTGRVALVRE  474



>ref|XP_008383599.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=478

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 171/230 (74%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   VSQCPGVRKSFLPAFSKPGPLNRAVFRP---KVTHFAPFVANAAGKGAETVAvsvssppp  240
            V+Q P     F   FS    L R   RP   K +     V +A+   A +V+ SV S   
Sbjct  13   VAQKPSFPVDFRHGFSTSFDLGRQ--RPLKGKSSELKKLVISASTGNAVSVSDSVPSLTS  70

Query  241  svsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVL  420
               +VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVL
Sbjct  71   ---KVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVL  127

Query  421  QQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEI-MWLAD-IFRAKVVDI  594
            +QVVEQLNKLVNV+KVED+SREPQVERELMLIKLNA+ ST+AE+  W+   IF  K +  
Sbjct  128  RQVVEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEVNFWIIQPIFGYKSIH-  186

Query  595  SEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            +    + ++TGDPGK+ AV RNL KFGIKELARTGKIALRREKMG TAPF
Sbjct  187  TYKISSSQITGDPGKVVAVQRNLSKFGIKELARTGKIALRREKMGATAPF  236


 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTD  + +
Sbjct  306  VRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVGPAEVEGLSRITTVVPGTDDSISK  365

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL+++ +V D+S  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  366  LVQQLHKLIDLHEVRDISHLPFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHT  425

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ + L+ +GI E+ARTG++AL+RE
Sbjct  426  ITLELTGDLNKMVALQKLLEPYGICEVARTGRVALQRE  463



>gb|KCW46078.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV+EQL KLVNVLKVEDL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLKVEDL  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIK+ A+   +AEIM+L DIFRAK+VDISEH VTIEVTGDPGKM AV R
Sbjct  61   SKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQR  120

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  121  NLSKFGIREIARTGKIALRREKMGASAPF  149


 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 105/159 (66%), Gaps = 20/159 (13%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GTD+ + +
Sbjct  219  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+                L  I +NA  + + +++ +A IFRAK VD+S+H 
Sbjct  279  LVQQLYKLVD----------------LHEIAVNA--AARRDVLDIASIFRAKAVDVSDHT  320

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  321  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  359



>gb|KCW46079.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV+EQL KLVNVLKVEDL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLKVEDL  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIK+ A+   +AEIM+L DIFRAK+VDISEH VTIEVTGDPGKM AV R
Sbjct  61   SKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQR  120

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  121  NLSKFGIREIARTGKIALRREKMGASAPF  149


 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GTD+ + +
Sbjct  219  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  279  LVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  338

Query  607  VTIEVTGDPGKMAAVLRNLKKFGI  678
            +T+E+TGD  KM A+ R L+ +GI
Sbjct  339  ITLELTGDLDKMVALQRLLEPYGI  362



>gb|KCW46077.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=391

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV+EQL KLVNVLKVEDL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLKVEDL  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIK+ A+   +AEIM+L DIFRAK+VDISEH VTIEVTGDPGKM AV R
Sbjct  61   SKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQR  120

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  121  NLSKFGIREIARTGKIALRREKMGASAPF  149


 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GTD+ + +
Sbjct  219  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  279  LVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  338

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE
Sbjct  339  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRE  376



>sp|Q9SMC2.1|ILVH_NICPL RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Nicotiana plumbaginifolia]
 emb|CAB56614.1| acetolactate synthase small subunit [Nicotiana plumbaginifolia]
Length=449

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT++VLQQV+EQL KLVNV+KVEDL
Sbjct  37   MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQVMEQLQKLVNVIKVEDL  96

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIK++A+   +AE+MWL D+FRAK+VDIS+  +TIEVTGDPGKM AV R
Sbjct  97   SKEPQVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDQSLTIEVTGDPGKMVAVQR  156

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NL KFGI+E+ARTGKIALRREKMGE+APF
Sbjct  157  NLSKFGIREIARTGKIALRREKMGESAPF  185


 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GTD+ + +
Sbjct  255  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  314

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V D++  P  ERELMLIK+    + +  ++ +A IFRAK VD+S+H 
Sbjct  315  LVQQLYKLVDIHEVRDITHLPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHT  374

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELART  696
            +T+E+TGD  KM  + R L+ +GI E+ART
Sbjct  375  ITLELTGDLHKMVRLQRLLEPYGICEVART  404



>gb|KCW59209.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=391

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGT++VLQQV+EQL KLVNVLKVEDL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLKVEDL  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIK+ A    +AEIM+L DIFRAK+VDISEH VTIEVTGDPGKM AV R
Sbjct  61   SKEPQVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQR  120

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NL KFGI+E+ARTGKIALRREKMG +APF
Sbjct  121  NLSKFGIREIARTGKIALRREKMGASAPF  149


 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GTD+ + +
Sbjct  219  LRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV++ +V+DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  279  LVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHT  338

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  339  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRES  377



>ref|XP_009778724.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=221

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 152/205 (74%), Gaps = 16/205 (8%)
 Frame = +1

Query  58   MAAAVSQCPGVRKSFLPAFSKP---GPLNRAVFRPKVTHFAPFVANA-----------AG  195
            MAAA +     +KSFLPA SKP     L R  F   +   +P +  A             
Sbjct  1    MAAAATATGLSKKSFLPALSKPTLPSKLGRRNFSFGLKKHSPVITTANTAASSSGSGSTD  60

Query  196  KGAETVAvsvsspppsvs--RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN  369
             GA +V       PPS S  RVK HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN
Sbjct  61   NGAVSVTRMAPPLPPSPSTSRVKCHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLN  120

Query  370  KDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAE  549
            KDKALFTIVVSGT+KVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNA+ STKAE
Sbjct  121  KDKALFTIVVSGTEKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNADASTKAE  180

Query  550  IMWLADIFRAKVVDISEHFVTIEVT  624
            IMWL DIFR K+VDISEHF+TIEV+
Sbjct  181  IMWLVDIFRGKIVDISEHFLTIEVS  205



>ref|XP_009144046.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Brassica rapa]
Length=379

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGT++VLQQV+EQL KLVNVLKVED+
Sbjct  1    MINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVNVLKVEDI  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S EPQVERELML+K+NA   ++AEIMWL + FRA+VVDISEH +TIEVTGDPGKM AV R
Sbjct  61   SSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHALTIEVTGDPGKMIAVER  120

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NLKKF I+E+ RTGKIALRREKMG TAPF
Sbjct  121  NLKKFQIREIVRTGKIALRREKMGATAPF  149


 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  TD+ + +
Sbjct  219  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  278

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A +FRAK VD+S+H 
Sbjct  279  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHT  338

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELA  690
            +T+++TGD  KM A+ R L+ +GI E++
Sbjct  339  ITLQLTGDLDKMVALQRLLEPYGICEVS  366



>gb|ACN35790.1| unknown [Zea mays]
Length=159

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VL QV+EQLNKLVNVL VEDL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLNQVIEQLNKLVNVLSVEDL  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIKLN E   + E+M L DIFRAKVVDISE  +T+EV GDPGK+AAV R
Sbjct  61   SKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTLTMEVAGDPGKIAAVQR  120

Query  658  NLKKFGIKELARTGKIALRREKMGETA  738
            NL KFGIKE+ RTGKIALRRE++G TA
Sbjct  121  NLWKFGIKEICRTGKIALRRERIGATA  147



>ref|XP_010557052.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=417

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  319  VFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVE  498
            +FARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV+EQL KLVNVLKVED+S EPQVE
Sbjct  34   IFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVE  93

Query  499  RELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGI  678
            RELML+K+NA   ++AEIMWL D FR+K+VDISEH +TIEVTGDPGKM AV RNL+KFGI
Sbjct  94   RELMLVKVNAHPESRAEIMWLVDTFRSKIVDISEHALTIEVTGDPGKMNAVERNLRKFGI  153

Query  679  KELARTGKIALRREKMGETAPF  744
            +E+ARTGKIALRREKMGE+APF
Sbjct  154  REIARTGKIALRREKMGESAPF  175


 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGL--NKDKALFTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG    + ++  T V+  TD+ + +
Sbjct  245  LRSHTLSLLVNDAPGVLNLVTGVFARRGYNIQSLAVGHAETEGRSRITTVIPATDESISK  304

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V DL+  P  ERELMLIK+      + +++ +A IFRAK VD+S+H 
Sbjct  305  LVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNTVARRDVLDIASIFRAKAVDVSDHT  364

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  365  ITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  402



>ref|XP_008450270.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cucumis melo]
Length=443

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+KVL+QV+
Sbjct  89   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLEQVI  148

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL+KLVNVLKVEDLS   QVERELMLIK+NA+ + +AEI  L D+FRAK+VDIS+  VT
Sbjct  149  EQLHKLVNVLKVEDLSSVQQVERELMLIKINADPTYRAEIKRLVDVFRAKIVDISDDSVT  208

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGK  702
            IEVTGDPGKM A  RNL KFGI+E+ARTGK
Sbjct  209  IEVTGDPGKMVAFQRNLSKFGIREIARTGK  238


 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GTD+ + +
Sbjct  271  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  330

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL +L +V +V DL+  P  ERELMLIK+ A  S + +++ +A IFRAK VD+S+H 
Sbjct  331  LVQQLYRLADVHEVRDLTHLPFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHT  390

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  391  ITLELTGDLHKMVALQRLLEPYGICEVARTGRVALVRE  428



>gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group]
Length=422

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGTD+VL QV+EQLNKLVNVL VEDL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTDRVLNQVIEQLNKLVNVLNVEDL  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIK+N E   + E+M L DIFRAKVVDISE+ +TIEVTGDPGK+ AV R
Sbjct  61   SKEPQVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAVQR  120

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NL KFGIKE+ RTGKIALRREK+G TA F
Sbjct  121  NLSKFGIKEICRTGKIALRREKIGATARF  149


 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 118/188 (63%), Gaps = 31/188 (16%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNI-----------------------------  345
            ++ HT+S+ V D  G++N + GVFARRGYNI                             
Sbjct  221  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQGDVYPVEPYEGSSMNQVLDAHWGVLDDE  280

Query  346  ESLAVGLNKDKAL--FTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIK  519
            +SLAVG  +   L   T V  GTD+ ++++V+QLNKLV+V +V+D++  P  ERELMLIK
Sbjct  281  DSLAVGPAEKSGLSRITTVAPGTDESIEKLVQQLNKLVDVHEVQDITHLPFAERELMLIK  340

Query  520  LNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTG  699
            ++   + + +I+ +A+IFRAK VD+S+H VT+++TGD  KM A+ R L+ +GI E+ARTG
Sbjct  341  VSVNTAARRDILDIAEIFRAKSVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTG  400

Query  700  KIALRREK  723
            ++AL RE 
Sbjct  401  RVALVRES  408



>ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=471

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 135/164 (82%), Gaps = 17/164 (10%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVV GTDKV     
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKV-----  138

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
                        EDLS EPQVERELMLIK+NA+   +AEI WL DIFRAK+VDISE+ +T
Sbjct  139  ------------EDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLT  186

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGKM AV RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  187  IEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPF  230


 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  TD+ + +
Sbjct  299  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  358

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +++QL KL+++ +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H 
Sbjct  359  LMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHT  418

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  419  ITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRES  457



>ref|XP_011464846.1| PREDICTED: LOW QUALITY PROTEIN: acetolactate synthase small subunit 
2, chloroplastic-like [Fragaria vesca subsp. vesca]
Length=357

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRI+GVFARRGYNIESLAVGLNKDKALFTIVVSGTD VL+Q +EQL+KLVNVLKVEDL
Sbjct  1    MINRISGVFARRGYNIESLAVGLNKDKALFTIVVSGTDTVLRQAIEQLHKLVNVLKVEDL  60

Query  478  SREPQVERELMLIKL-NAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVL  654
            S EPQVERELML+K+  A     AEI W+ +IFRAK+VDIS+H VTIEVTGDPGKM A+ 
Sbjct  61   SSEPQVERELMLLKVTTAHPDYVAEIKWIVNIFRAKIVDISDHSVTIEVTGDPGKMVALQ  120

Query  655  RNLKKFGIKELARTGKIALRREKMGETAPF  744
            RNL KFGI+E+ARTGKIALRREK+G +APF
Sbjct  121  RNLSKFGIREIARTGKIALRREKLGASAPF  150


 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 88/128 (69%), Gaps = 2/128 (2%)
 Frame = +1

Query  346  ESLAVGLNK--DKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIK  519
            +SLAVG  +   ++  T VV  TD+ + ++V+QL KLV+V  V DL+  P  ERELMLIK
Sbjct  216  DSLAVGHAEVEGQSRITAVVPATDESISKLVQQLYKLVDVHDVRDLTNFPFAERELMLIK  275

Query  520  LNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTG  699
            + A    + +++ + +IFRAK VD+S+H +T+E+TGD  KM A+ R L+  GI E+ARTG
Sbjct  276  IAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPCGICEVARTG  335

Query  700  KIALRREK  723
            +IAL RE 
Sbjct  336  RIALVRES  343



>ref|XP_010414083.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=415

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  307  RIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSRE  486
            +I  VFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV+EQL KLVNVLKVED+S E
Sbjct  25   QIRRVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSE  84

Query  487  PQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLK  666
            PQVERELML+K+NA   ++AEIMWL D FRAKVVDI+EH +TIEVTGDPGKM AV RNLK
Sbjct  85   PQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLK  144

Query  667  KFGIKELARTGKIALRREKMGETAPF  744
            KF I+E+ RTGKIALRREKMG TAPF
Sbjct  145  KFQIREIVRTGKIALRREKMGATAPF  170


 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 115/159 (72%), Gaps = 3/159 (2%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTDKVLQ  423
            ++ HT+S+ V D  G++N + GVFARRGYNI++ LAVG  + K +   T VV  TD+ + 
Sbjct  240  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQAYLAVGHAETKGISRITTVVPATDESVS  299

Query  424  QVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEH  603
            ++V+QLNKLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H
Sbjct  300  KLVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDH  359

Query  604  FVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  360  TITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  398



>gb|EEC73569.1| hypothetical protein OsI_08011 [Oryza sativa Indica Group]
Length=554

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  298  IINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDL  477
            +INRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGTD+VL QV+EQLNKLVNVL VEDL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTDRVLNQVIEQLNKLVNVLNVEDL  60

Query  478  SREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLR  657
            S+EPQVERELMLIK+N E   + E+M L DIFRAKVVDISE+ +TIEVTGDPGK+ AV R
Sbjct  61   SKEPQVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAVQR  120

Query  658  NLKKFGIKELARTGKIALRREKMGETAPF  744
            NL KFGIKE+ RTGKIALRREK+G TA F
Sbjct  121  NLSKFGIKEICRTGKIALRREKIGATARF  149


 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  +   L   T V  GTD+ +++
Sbjct  382  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKSGLSRITTVAPGTDESIEK  441

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV+V +V+D++  P  ERELMLIK++   + + +I+ +A+IFRAK VD+S+H 
Sbjct  442  LVQQLYKLVDVHEVQDITHLPFAERELMLIKVSVNTAARRDILDIAEIFRAKSVDVSDHT  501

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            VT+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  502  VTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  539


 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  418  LQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDIS  597
            + QV++    +++   VEDLS+EPQVERELMLIK+N E   + E+M L DIFRAKVVDIS
Sbjct  202  MNQVLDAHWGVLDDEDVEDLSKEPQVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDIS  261

Query  598  EHFVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            E+ +TIEVTGDPGK+ AV RNL KFGIKE+ RTGKIALRREK+G TA F
Sbjct  262  ENTLTIEVTGDPGKIVAVQRNLSKFGIKEICRTGKIALRREKIGATARF  310



>ref|XP_001773408.1| predicted protein [Physcomitrella patens]
 gb|EDQ61781.1| predicted protein, partial [Physcomitrella patens]
Length=417

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            RV+R+TISVFVGDESG+INRIAGV ARRGYNIESLAVGLNKDKALFTIVVSGTD+VLQQV
Sbjct  2    RVRRYTISVFVGDESGMINRIAGVIARRGYNIESLAVGLNKDKALFTIVVSGTDRVLQQV  61

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            ++QL+KLV+V +V DLS+EP+VERELML+K+N   + +AE++ L +IFRA++VD++E  +
Sbjct  62   MKQLSKLVSVKQVADLSKEPRVERELMLLKVNVGPTQRAEVLGLVEIFRARIVDVAEESL  121

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            TIEVTGDPGK+AA+   + KFGIKELARTGKIALRREK
Sbjct  122  TIEVTGDPGKIAAMQATMGKFGIKELARTGKIALRREK  159


 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTI--VVSGTDKVLQQVVE  435
            HT+ + V D  G++NR+ GVFARRGYNI+SLAVG  +      I  VV GTD+ +++++ 
Sbjct  244  HTLGILVNDAPGVLNRVTGVFARRGYNIQSLAVGPAETPGTSRILTVVPGTDESIKKLLS  303

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL+KL++VL V+D++ +P  ERELMLIK+ A    + E++ +A IFRAK VD+S   +T+
Sbjct  304  QLSKLIDVLAVQDITHQPFSERELMLIKVAATSDVRREVLDVAAIFRAKPVDLSNRTITL  363

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRR  717
            E+TGD  KMAA+ R L+ FGI E+ARTG++AL R
Sbjct  364  ELTGDLEKMAALQRLLEPFGILEVARTGRVALVR  397



>ref|NP_850173.2| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08587.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=421

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +1

Query  319  VFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVE  498
            VFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV+EQL KLVNVLKVED+S EPQVE
Sbjct  35   VFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVE  94

Query  499  RELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTIEVTGDPGKMAAVLRNLKKFGI  678
            RELML+K+NA   ++AEIMWL D FRA+VVDI+EH +TIEVTGDPGKM AV RNLKKF I
Sbjct  95   RELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKKFQI  154

Query  679  KELARTGKIALRREKMGETAPF  744
            +E+ RTGKIALRREKMG TAPF
Sbjct  155  REIVRTGKIALRREKMGATAPF  176


 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 114/159 (72%), Gaps = 3/159 (2%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTDKVLQ  423
            ++ HT+S+ V D  G++N + GVFARRGYNI++ LAVG  + K +   T V+  TD+ + 
Sbjct  246  LRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQAYLAVGHAETKGISRITTVIPATDESVS  305

Query  424  QVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEH  603
            ++V+QL KLV+V +V DL+  P  ERELMLIK+    + + +++ +A IFRAK VD+S+H
Sbjct  306  KLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDH  365

Query  604  FVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +T+++TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  366  TITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  404



>ref|XP_002977907.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
 gb|EFJ21245.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
Length=412

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            R++R+TISVFVGDESG+INRIAGVF+RRGYNIESLAVGLN+DKALFTIVVSGTD+VLQQV
Sbjct  3    RIQRYTISVFVGDESGMINRIAGVFSRRGYNIESLAVGLNRDKALFTIVVSGTDRVLQQV  62

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            ++QL KLVNV KVEDLS++P+VERELML+K+N   + + E++ L DIFRA+VVD++E  +
Sbjct  63   MKQLYKLVNVRKVEDLSKKPRVERELMLLKVNVPAAQRTEVLGLVDIFRARVVDVAEDSL  122

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGE  732
            T+EVTGD GK+A++ R + KFGIKELARTGKI+L R+K  E
Sbjct  123  TLEVTGDAGKLASLERRMTKFGIKELARTGKISLLRDKSEE  163


 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 123/169 (73%), Gaps = 10/169 (6%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++NR+ GVFARRGYNI+SLAVGL++ + +   T VV GTD+ +++++ 
Sbjct  242  HTLSMVVNDAPGVLNRVTGVFARRGYNIQSLAVGLSERQGISRITTVVPGTDESIRKLLH  301

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL+KL++V  V+D++  P  +RELMLIK++A  S + +I+ +A++FRAK+VD+S   +T+
Sbjct  302  QLSKLIDV--VQDITHLPFAQRELMLIKISALPSARRDILDIANVFRAKIVDLSNRSITL  359

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK------MGETAPF  744
            E+TGD  KMAA+   L+ +GI E+ARTG++AL R+       +G+  P 
Sbjct  360  ELTGDLEKMAALQHLLEPYGILEVARTGRLALVRDSGVDTKLLGQLQPL  408



>ref|XP_002979412.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
 gb|EFJ19301.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
Length=414

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            R++R+TISVFVGDESG+INRIAGVF+RRGYNIESLAVGLN+DKALFTIVVSGTD+VLQQV
Sbjct  3    RIQRYTISVFVGDESGMINRIAGVFSRRGYNIESLAVGLNRDKALFTIVVSGTDRVLQQV  62

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            ++QL KLVNV KVEDLS++P+VERELML+K+N   + + E++ L DIFRA+VVD++E  +
Sbjct  63   MKQLYKLVNVRKVEDLSKKPRVERELMLLKVNVPAAQRTEVLGLVDIFRARVVDVAEDSL  122

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGE  732
            T+EVTGD GK+A++ R + KFGIKELARTGKI+L R+K  E
Sbjct  123  TLEVTGDAGKLASLERRMTKFGIKELARTGKISLLRDKSEE  163


 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 124/169 (73%), Gaps = 8/169 (5%)
 Frame = +1

Query  262  HTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVVE  435
            HT+S+ V D  G++NR+ GVFARRGYNI+SLAVGL++ + +   T VV GTD+ +++++ 
Sbjct  242  HTLSMVVNDAPGVLNRVTGVFARRGYNIQSLAVGLSERQGISRITTVVPGTDESIRKLLH  301

Query  436  QLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVTI  615
            QL+KL++V++V+D++  P  +RELMLIK++A  S + +I+ +A++FRAK VD+S   +T+
Sbjct  302  QLSKLIDVVQVQDITHLPFAQRELMLIKISALPSARRDILDIANVFRAKTVDLSNRSITL  361

Query  616  EVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK------MGETAPF  744
            E+TGD  KMAA+   L+ +GI E+ARTG++AL R+       +G+  P 
Sbjct  362  ELTGDLEKMAALQHLLEPYGILEVARTGRLALVRDSGVDSKLLGQLQPL  410



>ref|XP_011014712.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=467

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 133/165 (81%), Gaps = 23/165 (14%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +++RHTISVFVGDE GIINRIAGVFARRGY+IESLAVGLNKDKALFTIVV GT++VL+QV
Sbjct  76   KMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFTIVVCGTEEVLRQV  135

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQLNKLV V+KVED+SR+PQVERELMLIKLNA  ST+A                     
Sbjct  136  VEQLNKLVTVIKVEDISRDPQVERELMLIKLNANPSTRA---------------------  174

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
              EVTGDPGKMAAV RNL KFGIKELARTGKIALRRE MGE APF
Sbjct  175  --EVTGDPGKMAAVQRNLSKFGIKELARTGKIALRRETMGEKAPF  217


 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  295  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  354

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL+KL++  +V D++  P  EREL LIK+ A  + + +++ +A IFRAK VD+S+H 
Sbjct  355  LVQQLHKLIDFHEVRDITHSPFAERELTLIKIAANSAARRDVLDIARIFRAKAVDVSDHT  414

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE 
Sbjct  415  ITLELTGDFNKMVALQRILEPYGICEVARTGRVALERES  453



>gb|KJB27748.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=371

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTD+VLQQV
Sbjct  73   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLQQV  132

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            VEQL KLVNV KVEDLS EPQVERELMLIK+NA+   +AEIMWL DIFRAK+VDISEH +
Sbjct  133  VEQLQKLVNVWKVEDLSNEPQVERELMLIKVNADPKFRAEIMWLVDIFRAKIVDISEHSL  192

Query  610  TIEVTGDPGKMAAVLRN  660
            TIE +G      ++L N
Sbjct  193  TIETSGHQSHTLSMLVN  209


 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = +1

Query  256  KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQV  429
            + HT+S+ V D  G++N + GVFARRGYN++SLAVG  + + L   T VV GTD+ + ++
Sbjct  200  QSHTLSMLVNDSPGVLNLVTGVFARRGYNLQSLAVGHAEVEGLSRITTVVPGTDESISKL  259

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
            V+QL KLV++ +V DL++ P  ERELMLIK+    + + +++ +A+IFRAK VD+S+H V
Sbjct  260  VQQLYKLVDMHEVRDLTQLPFAERELMLIKIAVNAAARRDVLDIANIFRAKAVDVSDHTV  319

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  320  TLELTGDLDKMVALQRLLEPYGICEVARTGRLALVRE  356



>ref|XP_009404280.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 127/164 (77%), Gaps = 28/164 (17%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN DKALFTI VSGT+KVLQQVV
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNTDKALFTISVSGTEKVLQQVV  143

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL KLVNVLKV                            + L DIFRAKVVDISE+ +T
Sbjct  144  EQLYKLVNVLKV----------------------------LGLVDIFRAKVVDISENSIT  175

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
            IEVTGDPGK+ AV R+L KFGIKE+ARTGKIALRREK+G+TAPF
Sbjct  176  IEVTGDPGKIVAVQRSLSKFGIKEIARTGKIALRREKIGDTAPF  219


 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GTD+ +++
Sbjct  288  LRSHTLSILVNDIPGVLNIVTGVFSRRGYNIQSLAVGPAEKEGISRITTVVPGTDETIEK  347

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+Q+ KL++V +V D++  P  ERELMLIK+    + + +I+ +A+IFRAK VD+S H 
Sbjct  348  LVQQIYKLIDVHEVHDITHLPFAERELMLIKVAVNTAARRDILDIAEIFRAKAVDVSGHT  407

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            + +E+TGD  KM A+ R L+ +GI E+ARTG+IAL RE 
Sbjct  408  IALELTGDLNKMVALQRLLEPYGICEVARTGRIALIRES  446



>ref|XP_004504413.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=424

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +1

Query  184  NAAGKGAETVAvsvsspppsvsRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  363
            +AA     TV+ +     PS S+V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVG
Sbjct  47   SAATSADTTVSSNGPVTSPSRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG  106

Query  364  LNKDKALFTIVVSGTDKVLQQVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTK  543
            LN+D+ALF+IVVSGT++VLQQVVEQL KLVNVLKVEDLS EPQVERELML+K++A+   +
Sbjct  107  LNQDRALFSIVVSGTNRVLQQVVEQLQKLVNVLKVEDLSNEPQVERELMLLKVHADPQNR  166

Query  544  AEIMWLADIFRAKVVDISEHFVTIEV  621
            AEI WL D FR K+VDISE+ VTIEV
Sbjct  167  AEIKWLVDTFRGKIVDISENSVTIEV  192


 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GTD+ + +
Sbjct  252  IRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISK  311

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+QL KLV + +V D++  P  ERELMLIK+    + + +++ +A IFRA+ VD+S+H 
Sbjct  312  LVQQLYKLVELHEVRDITHVPFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHT  371

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            +T+E+TGD  KM A+ R L+ +GI E+ARTG+IAL R+ 
Sbjct  372  ITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRDS  410



>ref|WP_015195236.1| acetolactate synthase, small subunit [Stanieria cyanosphaera]
 gb|AFZ37582.1| acetolactate synthase, small subunit [Stanieria cyanosphaera 
PCC 7437]
Length=173

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q++
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRIIEQLI  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELML+K+NA  S +AE++ +A IFRA++VD+SE  VT
Sbjct  62   KQLYKLINVLKVQDITQVPSVERELMLVKVNAPASGRAEVIQIAHIFRARIVDMSEDTVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  VEVVGDPGKMVAIIQMLNKFGIREVARTGKIALVRE  157



>ref|WP_015227737.1| acetolactate synthase small subunit [Halothece sp. PCC 7418]
 gb|AFZ45866.1| acetolactate synthase, small subunit [Halothece sp. PCC 7418]
Length=176

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 132/171 (77%), Gaps = 10/171 (6%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRGYNIESLAVG  + + +   T+VV G D+ ++Q+ 
Sbjct  3    KHTLSVLVQDEAGVLTRIAGLFARRGYNIESLAVGPAEKEGISRITMVVPGDDRTIEQLT  62

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELMLIK++A  S++AE++ LA +FRA+VVDI+E  +T
Sbjct  63   KQLYKLINVLKVQDVTQVPSVERELMLIKVSATASSRAEVIELAQVFRARVVDIAEDSLT  122

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE--------KMGETAP  741
            +EV GDPGKM A+++ L KFGI+E+ARTGKI L RE        K+ ET P
Sbjct  123  LEVVGDPGKMVAIIQLLSKFGIREIARTGKITLMRESGVNTEYLKLVETVP  173



>ref|WP_044500522.1| acetolactate synthase [Nostoc sp. PCC 7107]
Length=172

 Score =   190 bits (483),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+ +FARRGYNIESLAVG  +   +   T+VV+G D++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISSLFARRGYNIESLAVGQAEQGGVSRITMVVAGDDRIIEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D++  P VERELML+K+NA  + ++E++ LA IFRA+VVD++E F+T
Sbjct  62   KQLYKLVNVLKVQDITETPCVERELMLLKVNANSTHRSEVIELAQIFRARVVDVAEDFLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_016870148.1| acetolactate synthase [Fischerella muscicola]
Length=173

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDHVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITETPCVERELMLLKVNATSSTRSEIVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG+KE+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLKEIARTGKIALTRE  157



>gb|KJB38012.1| hypothetical protein B456_006G233200 [Gossypium raimondii]
Length=250

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 116/165 (70%), Gaps = 36/165 (22%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESG+INRIAG FARRGYNIE LAVGLNKDKALFTIVVSGT+ VLQQ 
Sbjct  72   KVKRHTISVFVGDESGMINRIAGDFARRGYNIEFLAVGLNKDKALFTIVVSGTETVLQQ-  130

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
                        VED+S EPQVERELML+K+  +             FRA          
Sbjct  131  ------------VEDISNEPQVERELMLVKVTMDPK-----------FRA----------  157

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
              EVTGDPGKM AV RNL KFGIKE+ART KIALRREKMG +APF
Sbjct  158  --EVTGDPGKMLAVQRNLSKFGIKEIARTAKIALRREKMGASAPF  200



>ref|WP_015189621.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 7428]
 gb|AFZ31752.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 7428]
Length=173

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQNGISRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D++  P VERELML+K+NA  ST++EI+ L+ IFRA+VVD++E  +T
Sbjct  62   KQLYKLVNVLKVQDITETPCVERELMLLKVNATSSTRSEIVELSQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREVARTGKIALTRE  157



>gb|AFY41657.1| acetolactate synthase, small subunit [Nostoc sp. PCC 7107]
Length=181

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+ +FARRGYNIESLAVG  +   +   T+VV+G D++++Q+ 
Sbjct  11   KHTLSVLVEDEAGVLSRISSLFARRGYNIESLAVGQAEQGGVSRITMVVAGDDRIIEQIT  70

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D++  P VERELML+K+NA  + ++E++ LA IFRA+VVD++E F+T
Sbjct  71   KQLYKLVNVLKVQDITETPCVERELMLLKVNANSTHRSEVIELAQIFRARVVDVAEDFLT  130

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  131  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  166



>ref|WP_009756687.1| MULTISPECIES: acetolactate synthase [Fischerella]
 gb|EHC16251.1| acetolactate synthase, small subunit [Fischerella sp. JSC-11]
Length=173

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  +T++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITETPCVERELMLLKVNATSNTRSEIVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG+KE+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLKEIARTGKIALTRE  157



>ref|WP_017303099.1| acetolactate synthase [Spirulina subsalsa]
Length=172

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q++
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRIIEQLI  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL++VLKV+D+++ P VERELMLIK+NA  S +AE++ +A +FRA++VD+SE  +T
Sbjct  62   KQLYKLISVLKVQDITQVPCVERELMLIKVNASASNRAEVIEIAQVFRARIVDMSEDTLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAIVQMLNKFGIREIARTGKIALVRE  157



>ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cucumis sativus]
Length=412

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQVV  432
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKAL TIVVSGT+KVL+QV+
Sbjct  83   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALLTIVVSGTEKVLEQVI  142

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            EQL+KLVNVLKVEDLS   QVERELMLIK+NAE + +AEI  L D+FRAK+VDIS+  VT
Sbjct  143  EQLHKLVNVLKVEDLSSVQQVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDDSVT  202

Query  613  IE-VTGD  630
            IE V GD
Sbjct  203  IETVKGD  209


 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  253  VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQ  426
            ++ HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GTD+ + +
Sbjct  240  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  299

Query  427  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHF  606
            +V+ L +L +V +V DL+  P  ERELMLIK+ A  S + +++ +A IFRAK VD+S+H 
Sbjct  300  LVQHLYRLADVHEVRDLTHIPFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHT  359

Query  607  VTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +T+E+TGD  KM A+ R L+ +GI E+ARTG++AL RE
Sbjct  360  ITLELTGDLHKMVALQRLLEPYGICEVARTGRVALVRE  397



>ref|WP_012598844.1| acetolactate synthase [Cyanothece sp. PCC 7424]
 gb|ACK69899.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7424]
Length=175

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VVSG D +++Q+ 
Sbjct  2    KHTLSVLVQDEAGVLTRIAGLFARRGFNIESLAVGPAEQLGISRITMVVSGDDGIIEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELMLIK++A    +AE++ LA +FRA+VVDISE  +T
Sbjct  62   KQLYKLINVLKVQDITQIPCVERELMLIKVSASAINRAEVIELAQVFRARVVDISEETLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGIKE+ARTGK+AL RE
Sbjct  122  LEVVGDPGKMVAIVQMLNKFGIKEIARTGKVALVRE  157



>ref|WP_011141136.1| acetolactate synthase [Gloeobacter violaceus]
 ref|NP_924082.1| acetolactate synthase 3 regulatory subunit [Gloeobacter violaceus 
PCC 7421]
 dbj|BAC89077.1| acetolactate synthase small subunit [Gloeobacter violaceus PCC 
7421]
Length=175

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G + RIAG+FARRG+NIESLAVG  +       T+VV+G ++ ++Q+ 
Sbjct  2    KHTLSVLVEDEAGALTRIAGMFARRGFNIESLAVGSAEQSGTTRITMVVAGDEQAVEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL+KL+NVL+V+D++  P VERELMLIK+NA  +T++EI+ LA +FRA++VD++E  VT
Sbjct  62   KQLHKLINVLRVQDITTIPCVERELMLIKVNATTATRSEIIELATVFRARIVDVAEESVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EVTGDPGKM A+++ L +FGIKE+ARTGKI+L RE
Sbjct  122  VEVTGDPGKMVAIIQMLTRFGIKEIARTGKISLTRE  157



>ref|WP_012626204.1| acetolactate synthase [Cyanothece sp. PCC 7425]
 gb|ACL43106.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7425]
Length=172

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDDQIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  S ++EI+ L +IFRAKVVD+SE  +T
Sbjct  62   KQLYKLINVLKVQDVTEIPCVERELMLVKVNASASNRSEILELVNIFRAKVVDVSEESLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFGI+E+ARTGKI L RE
Sbjct  122  IEVAGDPGKMVAIIQVLLKFGIREIARTGKICLTRE  157



>ref|WP_019508465.1| acetolactate synthase [Pleurocapsa sp. PCC 7319]
Length=174

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G ++V++Q++
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQMGISRITMVVPGDEQVIEQLI  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL++VLKV+D+S +P VERELMLIK+NA  + +AE++ +  IFRA++VD+SE  +T
Sbjct  62   KQLYKLISVLKVQDISHQPCVERELMLIKVNANAANRAEVIQITQIFRARIVDLSEEALT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGK+ A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKIVAIIQMLNKFGIREIARTGKIALTRE  157



>ref|WP_017322778.1| acetolactate synthase [cyanobacterium PCC 7702]
Length=172

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+DL+  P VERELML+K+NA  +T++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDLTEIPCVERELMLLKVNATSTTRSEIVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_035154634.1| acetolactate synthase [Calothrix sp. 336/3]
 gb|KFB84426.1| acetolactate synthase [Calothrix sp. 336/3]
Length=172

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DESG+++RIAG+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDESGVLSRIAGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  S ++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITETPCVERELMLLKVNATSSNRSEIVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKI L RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIVLTRE  157



>dbj|BAB76326.1| acetolactate synthase [Nostoc sp. PCC 7120]
 gb|ABA21657.1| acetolactate synthase, small subunit [Anabaena variabilis ATCC 
29413]
Length=182

 Score =   189 bits (479),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIA +FARRG+NIESLAVG  ++  +   T+VV G D+V++Q+ 
Sbjct  11   KHTLSVLVEDEAGVLSRIASLFARRGFNIESLAVGSGEEGGVSRITMVVPGDDRVIEQLT  70

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D++  P VERELML+K+NA  S ++E++ LA IFRA+VVD++E  +T
Sbjct  71   KQLYKLVNVLKVQDITETPCVERELMLLKVNATSSNRSEVIELAQIFRARVVDVAEDSLT  130

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFGI+E+ARTGKIAL RE
Sbjct  131  LEVVGDPGKMVAIVQVLQKFGIREIARTGKIALTRE  166



>ref|WP_041456726.1| MULTISPECIES: acetolactate synthase [Nostocaceae]
Length=173

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIA +FARRG+NIESLAVG  ++  +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIASLFARRGFNIESLAVGSGEEGGVSRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D++  P VERELML+K+NA  S ++E++ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLVNVLKVQDITETPCVERELMLLKVNATSSNRSEVIELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFGI+E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGIREIARTGKIALTRE  157



>ref|WP_036481766.1| acetolactate synthase [Myxosarcina sp. GI1]
Length=174

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q++
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGISRITMVVPGDDRIIEQLI  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL++VLKV+D++ +P VERELML+K+NA  S +AE++ +  IFRA++VD+SE  +T
Sbjct  62   KQLYKLISVLKVQDITEKPCVERELMLVKVNATSSNRAEVIQVTQIFRARIVDMSEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAIIQMLNKFGIREIARTGKIALVRE  157



>ref|WP_015230978.1| acetolactate synthase small subunit [Dactylococcopsis salina]
 gb|AFZ52004.1| acetolactate synthase, small subunit [Dactylococcopsis salina 
PCC 8305]
Length=176

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRGYNIESLAVG  + + +   T+VV G D+ ++Q+ 
Sbjct  3    KHTLSVLVEDEAGVLTRIAGLFARRGYNIESLAVGPAEKEGISRITMVVPGDDRTIEQLT  62

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELMLIK+NA  S +AE++ LA +FRA+VVDISE  +T
Sbjct  63   KQLYKLINVLKVQDVTQLPCVERELMLIKVNATASGRAEVIELAQVFRARVVDISEDTLT  122

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGI+E+ARTGKI L R+
Sbjct  123  LEVVGDPGKMVAIIKMLHKFGIREIARTGKITLVRD  158



>gb|KJB38010.1| hypothetical protein B456_006G233200 [Gossypium raimondii]
Length=312

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 116/165 (70%), Gaps = 36/165 (22%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESG+INRIAG FARRGYNIE LAVGLNKDKALFTIVVSGT+ VLQQ 
Sbjct  72   KVKRHTISVFVGDESGMINRIAGDFARRGYNIEFLAVGLNKDKALFTIVVSGTETVLQQ-  130

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
                        VED+S EPQVERELML+K+  +             FRA          
Sbjct  131  ------------VEDISNEPQVERELMLVKVTMDPK-----------FRA----------  157

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
              EVTGDPGKM AV RNL KFGIKE+ART KIALRREKMG +APF
Sbjct  158  --EVTGDPGKMLAVQRNLSKFGIKEIARTAKIALRREKMGASAPF  200



>ref|WP_017715305.1| acetolactate synthase [Oscillatoria sp. PCC 10802]
Length=173

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLARIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  + ++EI+ LA IFRA+VVD+SE  VT
Sbjct  62   KQLYKLINVLKVQDITETPCVERELMLLKVNATSANRSEIVELAQIFRARVVDVSEESVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A ++ L KFGI+E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAFVQVLNKFGIREIARTGKIALTRE  157



>gb|KJB38011.1| hypothetical protein B456_006G233200 [Gossypium raimondii]
Length=315

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 116/165 (70%), Gaps = 36/165 (22%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +VKRHTISVFVGDESG+INRIAG FARRGYNIE LAVGLNKDKALFTIVVSGT+ VLQQ 
Sbjct  72   KVKRHTISVFVGDESGMINRIAGDFARRGYNIEFLAVGLNKDKALFTIVVSGTETVLQQ-  130

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFV  609
                        VED+S EPQVERELML+K+  +             FRA          
Sbjct  131  ------------VEDISNEPQVERELMLVKVTMDPK-----------FRA----------  157

Query  610  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREKMGETAPF  744
              EVTGDPGKM AV RNL KFGIKE+ART KIALRREKMG +APF
Sbjct  158  --EVTGDPGKMLAVQRNLSKFGIKEIARTAKIALRREKMGASAPF  200



>ref|WP_013322899.1| acetolactate synthase [Cyanothece sp. PCC 7822]
 gb|ADN14794.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7822]
Length=175

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D +++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDGIIEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELML+K+NA  + +AE++ LA +FRA+VVDISE  +T
Sbjct  62   KQLYKLINVLKVQDITQIPCVERELMLVKVNASAAFRAEVIELAQVFRARVVDISEDTLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGIKE+ARTGK+AL RE
Sbjct  122  LEVVGDPGKMVAIVQMLNKFGIKEIARTGKVALVRE  157



>dbj|BAH56811.1| AT2G31810 [Arabidopsis thaliana]
Length=264

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLQQV  429
            +V++HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT++VLQQV
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  430  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDIS  597
            +EQL KLVNVLKVED+S EPQVERELML+K+NA   ++AEIMWL D F++K    S
Sbjct  143  IEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFQSKSCRYS  198



>ref|WP_036020223.1| acetolactate synthase [Leptolyngbya sp. PCC 7375]
Length=176

 Score =   188 bits (477),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQAGISRITMVVPGDDGVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV D++ +P VERELML+K+NA  ST+AEI+  A IFRA+VVD+S+  +T
Sbjct  62   KQLYKLINVLKVNDITEKPCVERELMLLKVNATSSTRAEIINFAQIFRARVVDVSDESLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L +FG++E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAIVQVLDRFGVREIARTGKIALTRE  157



>gb|EKV00810.1| acetolactate synthase, small subunit [Leptolyngbya sp. PCC 7375]
Length=199

 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 126/157 (80%), Gaps = 2/157 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  25   KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQAGISRITMVVPGDDGVIEQLT  84

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV D++ +P VERELML+K+NA  ST+AEI+  A IFRA+VVD+S+  +T
Sbjct  85   KQLYKLINVLKVNDITEKPCVERELMLLKVNATSSTRAEIINFAQIFRARVVDVSDESLT  144

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRREK  723
            IEV GDPGKM A+++ L +FG++E+ARTGKIAL RE 
Sbjct  145  IEVVGDPGKMVAIVQVLDRFGVREIARTGKIALTRES  181



>ref|WP_017313402.1| MULTISPECIES: acetolactate synthase [Stigonematales]
 gb|KIY11765.1| acetolactate synthase [Mastigocladus laminosus UU774]
Length=173

 Score =   188 bits (477),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDWVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ L+ IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITETPCVERELMLLKVNATSSTRSEIVELSQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG+KE+ARTGKI+L RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLKEIARTGKISLTRE  157



>ref|WP_017319158.1| acetolactate synthase [Mastigocladopsis repens]
Length=173

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+V+ G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQPGISRITMVIPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ +A IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDVTEIPSVERELMLLKVNATSSTRSEIVEIAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_009767679.1| acetolactate synthase, small subunit [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68565.1| acetolactate synthase, small subunit [Oscillatoriales cyanobacterium 
JSC-12]
Length=177

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQIGISRITMVVPGDDRIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITEVPCVERELMLMKVNANSSTRSEIIELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLNKFGLREIARTGKIALTRE  157



>ref|WP_015125829.1| acetolactate synthase small subunit [Synechococcus sp. PCC 6312]
 gb|AFY62289.1| acetolactate synthase, small subunit [Synechococcus sp. PCC 6312]
Length=172

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQLGISRITMVVPGDDTVIEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+KLNA  + ++E++ L  IFRAKVVD+S+  VT
Sbjct  62   KQLYKLINVLKVQDITTTPCVERELMLLKLNATPANRSEVLELVQIFRAKVVDVSDDSVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ + KFGI+E+ARTGKIAL RE
Sbjct  122  IEVAGDPGKMVAIVQMVNKFGIREIARTGKIALVRE  157



>ref|WP_017286074.1| acetolactate synthase [Leptolyngbya boryana]
Length=175

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDDRIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NV+KV+D++  P VERELML+K+NA  ST++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVIKVQDITEVPCVERELMLLKVNAGSSTRSEIVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALSRE  157



>ref|WP_028946400.1| acetolactate synthase [Synechocystis sp. PCC 6714]
 gb|AIE73291.1| Acetolactate synthase small subunit [Synechocystis sp. PCC 6714]
Length=172

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +  D +  T+VV G +  ++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNV+KV+D++  P VERELML+K++A    +AE++ LA +FRA++VDISE  VT
Sbjct  62   KQLYKLVNVIKVQDITETPCVERELMLVKVSASAPNRAEVIELAQVFRARIVDISEDTVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+L+ L KFGIKE+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRE  157



>gb|KIJ82940.1| acetolactate synthase [Scytonema tolypothrichoides VB-61278]
Length=173

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+ +FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISSLFARRGFNIESLAVGPAEQSGISRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ L+ IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITETPCVERELMLLKVNATSSTRSEIVELSQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_026732404.1| acetolactate synthase [Fischerella sp. PCC 9605]
Length=172

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  +T++EI+ +A IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNATSTTRSEIVEIAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_014407139.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 sp|Q55141.2|ILVH_SYNY3 RecName: Full=Acetolactate synthase small subunit; AltName: Full=Acetohydroxy-acid 
synthase small subunit; Short=AHAS; Short=ALS 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAK51060.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 dbj|BAL30058.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL33227.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL36396.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. PCC-P]
Length=172

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +  D +  T+VV G +  ++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNV+KV+D++  P VERELML+K++A    +AE++ LA +FRA++VDISE  VT
Sbjct  62   KQLYKLVNVIKVQDITETPCVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+L+ L KFGIKE+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRE  157



>dbj|BAM54375.1| acetolactate synthase 3 regulatory subunit [Synechocystis sp. 
PCC 6803]
Length=175

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +  D +  T+VV G +  ++Q+ 
Sbjct  5    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLT  64

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNV+KV+D++  P VERELML+K++A    +AE++ LA +FRA++VDISE  VT
Sbjct  65   KQLYKLVNVIKVQDITETPCVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTVT  124

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+L+ L KFGIKE+ARTGKIAL RE
Sbjct  125  IEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRE  160



>ref|WP_015164258.1| acetolactate synthase small subunit [Pseudanabaena sp. PCC 7367]
 gb|AFY69285.1| acetolactate synthase, small subunit [Pseudanabaena sp. PCC 7367]
Length=168

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HTISV V DE+G++ RIA +FARRG+NIESLAVG  +   L   T+VV G D+V++Q+V
Sbjct  2    KHTISVVVEDEAGVLTRIASLFARRGFNIESLAVGSAEQNGLSRITMVVPGDDRVIEQIV  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QLNKL+NV+ V DL++ P VERELM+IK+NA  ST++EI+ +A IFR++VVD+S+  +T
Sbjct  62   KQLNKLINVITVRDLTQIPCVERELMMIKVNAGPSTRSEIIEIAQIFRSRVVDVSDDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGK+ A+ + L+KFGI+E+ARTGKI+L RE
Sbjct  122  IEVVGDPGKIVAIGKMLQKFGIREVARTGKISLTRE  157



>ref|WP_015145546.1| acetolactate synthase small subunit [Pleurocapsa minor]
 gb|AFY79248.1| acetolactate synthase, small subunit [Pleurocapsa sp. PCC 7327]
Length=172

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G +++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDERIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  S +AE++ LA +FRA++VDISE  +T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLVKVNATSSNRAEVIELAQVFRARIVDISEETLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  VEVVGDPGKMVAIVQMLNKFGIREIARTGKIALIRE  157



>ref|WP_006277889.1| acetolactate synthase [Cylindrospermopsis raciborskii]
 gb|EFA69276.1| Acetolactate synthase, small subunit [Cylindrospermopsis raciborskii 
CS-505]
Length=177

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIA +FARRG+NIESLAVG  + + +   T+VV G D+VL+Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIASLFARRGFNIESLAVGPAEQEGISRITMVVPGDDRVLEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  + +++++ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDVTETPCVERELMLLKVNANSTNRSQVVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L+KFG+KE+ARTGKI+L RE
Sbjct  122  IEVVGDPGKMVAIVQVLQKFGLKEIARTGKISLTRE  157



>ref|WP_009342538.1| acetolactate synthase [Raphidiopsis brookii]
 gb|EFA73522.1| Acetolactate synthase, small subunit [Raphidiopsis brookii D9]
Length=177

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIA +FARRG+NIESLAVG  + + +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIASLFARRGFNIESLAVGPAEQEGISRITMVVPGDDRVIEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  + ++E++ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDVTETPCVERELMLLKVNANSTNRSEVVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L+KFG+KE+ARTGKI+L RE
Sbjct  122  IEVVGDPGKMVAIVQVLQKFGLKEIARTGKISLTRE  157



>ref|WP_019487064.1| MULTISPECIES: acetolactate synthase [Kamptonema]
Length=172

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +       T+VV G D++++Q+ 
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGFSRITMVVPGDDRIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  +T++EI+ LA IFRA+VVDI E  +T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLMKVNATSATRSEIVELAQIFRARVVDIGEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGIKE+ARTGK++L RE
Sbjct  122  LEVVGDPGKMVAIVQVLNKFGIKEIARTGKVSLTRE  157



>ref|WP_016859689.1| acetolactate synthase [Fischerella muscicola]
Length=173

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDWVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ L+ IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNATSSTRSEIVELSQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG+KE+ARTGKI+L RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLKEIARTGKISLTRE  157



>ref|WP_011056724.1| MULTISPECIES: acetolactate synthase [Thermosynechococcus]
 ref|NP_681670.1| acetolactate synthase 3 regulatory subunit [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC08432.1| acetolactate synthase small subunit [Thermosynechococcus elongatus 
BP-1]
 gb|AHB89434.1| acetolactate synthase regulatory subunit IlvH [Thermosynechococcus 
sp. NK55a]
Length=172

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQIGISRITMVVPGDDAVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ L  IFRAKVVD+S+  + 
Sbjct  62   KQLYKLINVLKVQDITTIPCVERELMLLKVNATASTRSEILELVQIFRAKVVDVSDDSLI  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV+GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  IEVSGDPGKMVALVQMLNKFGIREIARTGKIALVRE  157



>ref|WP_018397129.1| acetolactate synthase [filamentous cyanobacterium ESFC-1]
Length=172

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HTISV V DE+G++ RIA +FARRG+NIESLAVG  +   +   T+VV G D  ++Q++
Sbjct  2    KHTISVLVEDEAGVLTRIASLFARRGFNIESLAVGPAEQVGISRITMVVPGDDGTIEQLI  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D+++ P VERELML+K+NA  S +AE++ LA +FRA++VDISE  +T
Sbjct  62   KQLYKLVNVLKVQDITQVPCVERELMLLKINATASNRAEVIELAQVFRARIVDISEETLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFGI+E+ARTGK+AL R+
Sbjct  122  IEVVGDPGKMVAIVQMLNKFGIREIARTGKVALPRD  157



>ref|WP_037218077.1| acetolactate synthase [Richelia intracellularis]
 emb|CDN11675.1| Acetolactate synthase small subunit [Richelia intracellularis]
Length=172

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DESG+++RIA +FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDESGVLSRIANLFARRGFNIESLAVGEAEQGGVSRITMVVHGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV D++  P VERELML+K+NA  ST++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLVNVLKVHDITEVPCVERELMLLKVNASSSTRSEIVELAQIFRARVVDVAEDALT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKI+L RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKISLPRE  157



>ref|WP_012408560.1| acetolactate synthase [Nostoc punctiforme]
 gb|ACC80545.1| acetolactate synthase, small subunit [Nostoc punctiforme PCC 
73102]
Length=172

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D++  P VERELML+K+NA  S ++E++ L+ IFRA+VVD++E  +T
Sbjct  62   KQLYKLVNVLKVQDITETPCVERELMLLKVNASSSNRSEVIELSQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_036532119.1| acetolactate synthase [Neosynechococcus sphagnicola]
 gb|KGF73142.1| acetolactate synthase [Neosynechococcus sphagnicola sy1]
Length=172

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G ++V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDNRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA+ + ++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITESPCVERELMLLKVNADSANRSEIVELAQIFRARVVDVAEESLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLNKFGIREIARTGKIALTRE  157



>ref|WP_017740695.1| acetolactate synthase [Scytonema hofmanni]
Length=172

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGISRITMVVQGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  S ++EI+ L+ IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDVTEIPCVERELMLLKVNATSSNRSEIVELSQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_010873502.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 ref|NP_442206.1| acetolactate synthase 3 regulatory subunit [Synechocystis sp. 
PCC 6803]
 dbj|BAA10276.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 gb|AGF52568.1| acetolactate synthase [Synechocystis sp. PCC 6803]
Length=188

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +  D +  T+VV G +  ++Q+ 
Sbjct  18   KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLT  77

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNV+KV+D++  P VERELML+K++A    +AE++ LA +FRA++VDISE  VT
Sbjct  78   KQLYKLVNVIKVQDITETPCVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTVT  137

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+L+ L KFGIKE+ARTGKIAL RE
Sbjct  138  IEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRE  173



>emb|CBN54307.1| acetolactate synthase 3 regulatory subunit [ [[Oscillatoria] 
sp. PCC 6506]
Length=194

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 126/159 (79%), Gaps = 2/159 (1%)
 Frame = +1

Query  250  RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQ  423
            R  +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +       T+VV G D++++
Sbjct  21   RKMKHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGFSRITMVVPGDDRIIE  80

Query  424  QVVEQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEH  603
            Q+ +QL KL+NVLKV+D++  P VERELML+K+NA  +T++EI+ LA IFRA+VVDI E 
Sbjct  81   QLTKQLYKLINVLKVQDITEIPCVERELMLMKVNATSATRSEIVELAQIFRARVVDIGED  140

Query  604  FVTIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
             +T+EV GDPGKM A+++ L KFGIKE+ARTGK++L RE
Sbjct  141  SLTLEVVGDPGKMVAIVQVLNKFGIKEIARTGKVSLTRE  179



>ref|WP_015139015.1| acetolactate synthase small subunit [Nostoc sp. PCC 7524]
 gb|AFY48577.1| acetolactate synthase, small subunit [Nostoc sp. PCC 7524]
Length=173

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIA +FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIASLFARRGFNIESLAVGAAEQGGVSRITMVVHGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNVLKV+D++  P VERELML+K+NA  S ++E++ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLVNVLKVQDITETPCVERELMLLKVNATSSNRSEVIELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKI+L RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKISLTRE  157



>gb|ABB17340.1| acetolactate synthase [Coleofasciculus chthonoplastes IPPAS B-270]
Length=172

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIA +FARRG+NIESLAVG  +  D +  T+VV+G D+V++Q+V
Sbjct  2    KHTLSVLVEDEAGVLTRIAALFARRGFNIESLAVGTGEQGDVSRVTMVVNGNDQVIEQIV  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ LA IFR++VVD+++  + 
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLVKVNATSSTRSEIVELAQIFRSRVVDVADDSLI  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A  + L+KFGI+E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAFAQVLQKFGIREIARTGKIALTRE  157



>ref|WP_026099569.1| acetolactate synthase [Prochlorothrix hollandica]
Length=174

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            RHT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    RHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGVSRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL K VNVLKV+D++  P VERELML+K+NA  + ++EI+ L +IFRAKVVD+SE  + 
Sbjct  62   KQLYKQVNVLKVQDVTETPAVERELMLLKVNASSAARSEILELVEIFRAKVVDVSEDSLI  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L+KFGI+E+ARTGK+AL RE
Sbjct  122  IEVVGDPGKMVAIVQVLQKFGIREIARTGKLALTRE  157



>ref|WP_012595734.1| MULTISPECIES: acetolactate synthase [Cyanothece]
 gb|ACK66467.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 8801]
 gb|ACV02465.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 8802]
Length=172

 Score =   186 bits (471),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D  ++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAETVGVSRITMVVPGDDDTIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV D+++ P VERELMLIK+NA  + +AE++ L  +FRA++VDISE  VT
Sbjct  62   KQLYKLINVLKVNDITQTPCVERELMLIKVNASAANRAEVIELVQVFRARIVDISEETVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  VEVVGDPGKMVAIVQMLNKFGIREVARTGKIALVRE  157



>ref|WP_009631788.1| acetolactate synthase, small subunit [Synechocystis sp. PCC 7509]
Length=172

 Score =   186 bits (471),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DESG+++RIAG+FARRG+NIESLAVG  +   +   T+VV G +++++Q+ 
Sbjct  2    KHTLSVLVEDESGVLSRIAGLFARRGFNIESLAVGAAEQGGMSRITMVVPGDEQIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KLVNV+KV+D++  P VERELML+K+NA  + ++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLVNVIKVQDITEIPCVERELMLLKVNASSANRSEIVGLAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLEKFGLQEIARTGKIALTRE  157



>ref|WP_008314262.1| acetolactate synthase, small subunit [Leptolyngbya sp. PCC 6406]
Length=176

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D+ ++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDQAIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  +T+AEI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDVTEVPCVERELMLLKVNANSTTRAEIVGLAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L +FG++E+ARTGK+AL RE
Sbjct  122  LEVVGDPGKMVAIVQVLNRFGLREIARTGKVALTRE  157



>ref|WP_007304707.1| acetolactate synthase [Crocosphaera watsonii]
 gb|EAM51559.1| Acetolactate synthase, small subunit [Crocosphaera watsonii WH 
8501]
 gb|EHJ13596.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0003]
 emb|CCQ59733.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0401]
 emb|CCQ49426.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
8502]
 emb|CCQ58541.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0005]
 emb|CCQ65782.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0402]
Length=173

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D  ++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDNSIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV D+++ P VERELML+K+N   + +AE++ +A +FRA++VDIS+  VT
Sbjct  62   KQLYKLINVLKVNDITQTPCVERELMLLKVNVSAANRAEVLEVAQVFRARIVDISDDTVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAIMKMLSKFGIREVARTGKIALTRE  157



>ref|WP_015196808.1| acetolactate synthase small subunit [Calothrix parietina]
 gb|AFZ00155.1| acetolactate synthase, small subunit [Calothrix sp. PCC 6303]
Length=172

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEKSGISRITMVVPGDDRIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV D++  P VERELML+K+NA    ++EI+ LA IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVLDITETPCVERELMLLKVNASSGNRSEIVELAQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG+KE+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLKEIARTGKIALTRE  157



>gb|KIE11579.1| acetolactate synthase [Tolypothrix bouteillei VB521301]
Length=172

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+G+FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGISRITMVVQGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  + ++E++ L+ IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDVTETPCVERELMLLKVNATSTNRSEVVELSQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_006453777.1| acetolactate synthase [Synechococcus sp. PCC 7335]
 gb|EDX84032.1| acetolactate synthase, small subunit [Synechococcus sp. PCC 7335]
Length=172

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DESG++ RIAG+FARRG+NIESLAVG  ++  +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDESGVLTRIAGLFARRGFNIESLAVGPAEEAGISRITMVVPGDDLVIEQLA  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELMLIK+NA    +AE++ LA IFRA+VVD+S+  VT
Sbjct  62   KQLYKLINVLKVQDITETPSVERELMLIKVNANSENRAEVVGLAQIFRARVVDVSKESVT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGK+ A+ + LK FG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKLVAIEQMLKPFGVQEIARTGKIALIRE  157



>ref|WP_041040884.1| acetolactate synthase [Tolypothrix campylonemoides]
 gb|KIJ73843.1| acetolactate synthase [Tolypothrix campylonemoides VB511288]
Length=172

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RI+ +FARRG+NIESLAVG  +   +   T+VV G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRISSLFARRGFNIESLAVGPAEQPGISRITMVVPGDDRVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA  ST++EI+ ++ IFRA+VVD++E  +T
Sbjct  62   KQLYKLINVLKVQDITETPCVERELMLLKVNATSSTRSEIVEISQIFRARVVDVAEDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFG++E+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRE  157



>ref|WP_010477416.1| MULTISPECIES: acetolactate synthase [Acaryochloris]
 gb|ABW27133.1| acetolactate synthase, small subunit [Acaryochloris marina MBIC11017]
Length=172

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G ++ ++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQIGVSRITMVVPGDNRSIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELMLIK+NA  S ++EI+ +  IFRAKVVD+SE  +T
Sbjct  62   KQLYKLINVLKVQDITEVPCVERELMLIKVNAAASLRSEIVEIVQIFRAKVVDVSEDALT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV+GDPGKM A+++ L KFGI+E+ARTGKIAL RE
Sbjct  122  IEVSGDPGKMVAIVQMLNKFGIQEIARTGKIALTRE  157



>ref|WP_023076484.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
 gb|ESA32600.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
Length=178

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G D V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQTGVSRITMVVPGDDSVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV D++ +P VERELML+K+NA  +T++EI+  A IFRA+VVD+S+  +T
Sbjct  62   KQLYKLINVLKVNDITEKPCVERELMLLKVNANSNTRSEIINFAQIFRARVVDVSDDSLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L +FG++E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAIVQVLDRFGVREIARTGKIALTRE  157



>ref|WP_041622928.1| acetolactate synthase [Oscillatoria nigro-viridis]
Length=172

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA   T++EI+ LA IFRA+VVDI +  +T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L +FGIKE+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLNRFGIKEIARTGKIALTRE  157



>emb|CCI14937.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9806]
Length=185

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G +  ++Q+ 
Sbjct  13   KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLT  72

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELMLIK+NA    +AE++ LA +FRA++VDISE  +T
Sbjct  73   KQLYKLINVLKVQDITQTPCVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLT  132

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFG++E+ARTGKIAL RE
Sbjct  133  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRE  168



>ref|WP_039887977.1| acetolactate synthase [Microcoleus vaginatus]
Length=172

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G D++++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D++  P VERELML+K+NA   T++EI+ LA IFRA+VVDI +  +T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L +FGIKE+ARTGKIAL RE
Sbjct  122  LEVVGDPGKMVAIVQVLNRFGIKEIARTGKIALTRE  157



>ref|WP_043999720.1| acetolactate synthase [Microcystis aeruginosa]
Length=174

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G +  ++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELMLIK+NA    +AE++ LA +FRA++VDISE  +T
Sbjct  62   KQLYKLINVLKVQDITQTPCVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFG++E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRE  157



>ref|WP_017660939.1| acetolactate synthase [Geitlerinema sp. PCC 7105]
Length=172

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV+G D+V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGGISRITMVVNGNDQVIEQIT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NV+KV+D++  P VERELMLIK+NA  +T++EI+ LA IFRA++VD+++  + 
Sbjct  62   KQLYKLINVIKVQDITDVPCVERELMLIKVNASSTTRSEIVELAQIFRARIVDVADDSLI  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A ++ L+KFGI+E+ARTGKIAL RE
Sbjct  122  IEVVGDPGKMVAFVQVLQKFGIREVARTGKIALIRE  157



>ref|WP_006527479.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 73106]
 gb|ELR99701.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 73106]
Length=171

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKD--KALFTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   ++  T+VV G ++V++Q+ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQTGRSRITMVVPGDEQVIEQLT  61

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NV+KV+D++  P VERELMLIK+NA  +++ EI+ LA +FRA++VDIS+  +T
Sbjct  62   KQLYKLINVIKVQDITTIPCVERELMLIKVNANSASRGEIIELAQVFRARIVDISDDTLT  121

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            +EV GDPGKM A+++ L+KFGIKE+ARTGKIAL RE
Sbjct  122  VEVVGDPGKMVAIVQMLEKFGIKEIARTGKIALIRE  157



>emb|CCI18700.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9807]
Length=185

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = +1

Query  259  RHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLQQVV  432
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G +  ++Q+ 
Sbjct  13   KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLT  72

Query  433  EQLNKLVNVLKVEDLSREPQVERELMLIKLNAELSTKAEIMWLADIFRAKVVDISEHFVT  612
            +QL KL+NVLKV+D+++ P VERELMLIK+NA    +AE++ LA +FRA++VDISE  +T
Sbjct  73   KQLYKLINVLKVQDITQTPCVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLT  132

Query  613  IEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  720
            IEV GDPGKM A+++ L KFG++E+ARTGKIAL RE
Sbjct  133  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRE  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420