BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044G05

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338215.1|  PREDICTED: CDPK-related kinase 5-like              132   1e-31   Solanum tuberosum [potatoes]
ref|XP_009366775.1|  PREDICTED: CDPK-related kinase 5-like              130   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_004232048.1|  PREDICTED: CDPK-related kinase 5                   129   8e-31   Solanum lycopersicum
gb|KHG22049.1|  CDPK-related protein kinase                             128   2e-30   Gossypium arboreum [tree cotton]
ref|XP_009366804.1|  PREDICTED: CDPK-related kinase 5-like              128   3e-30   Pyrus x bretschneideri [bai li]
emb|CDP02477.1|  unnamed protein product                                127   3e-30   Coffea canephora [robusta coffee]
gb|KJB48534.1|  hypothetical protein B456_008G074300                    127   3e-30   Gossypium raimondii
gb|KJB48531.1|  hypothetical protein B456_008G074300                    127   3e-30   Gossypium raimondii
ref|XP_008338287.1|  PREDICTED: CDPK-related kinase 5                   127   5e-30   Malus domestica [apple tree]
gb|KJB48530.1|  hypothetical protein B456_008G074300                    127   5e-30   Gossypium raimondii
gb|AAZ83348.1|  CDPK-related protein kinase                             127   6e-30   Gossypium hirsutum [American cotton]
ref|XP_007204593.1|  hypothetical protein PRUPE_ppa003111mg             125   3e-29   Prunus persica
ref|XP_010103697.1|  CDPK-related protein kinase                        124   5e-29   Morus notabilis
ref|XP_010268648.1|  PREDICTED: CDPK-related kinase 5-like isofor...    124   7e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010268657.1|  PREDICTED: CDPK-related kinase 5-like isofor...    124   8e-29   Nelumbo nucifera [Indian lotus]
ref|XP_008241522.1|  PREDICTED: CDPK-related kinase 5                   123   1e-28   Prunus mume [ume]
ref|XP_010550381.1|  PREDICTED: CDPK-related kinase 5 isoform X2        122   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_010550380.1|  PREDICTED: CDPK-related kinase 5 isoform X1        122   5e-28   Tarenaya hassleriana [spider flower]
ref|XP_002306462.1|  CROOKED family protein                             121   8e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006425845.1|  hypothetical protein CICLE_v10025192mg             118   9e-28   
ref|XP_010268715.1|  PREDICTED: CDPK-related kinase 5                   120   1e-27   Nelumbo nucifera [Indian lotus]
gb|AAL30820.1|AF435452_1  calcium/calmodulin-dependent protein ki...    120   2e-27   Nicotiana tabacum [American tobacco]
ref|XP_009758726.1|  PREDICTED: CDPK-related kinase 5-like isofor...    120   2e-27   Nicotiana sylvestris
gb|KHF98882.1|  CDPK-related protein kinase                             120   2e-27   Gossypium arboreum [tree cotton]
gb|KDP31899.1|  hypothetical protein JCGZ_12360                         120   2e-27   Jatropha curcas
ref|XP_006425847.1|  hypothetical protein CICLE_v10025192mg             118   2e-27   
ref|XP_006425846.1|  hypothetical protein CICLE_v10025192mg             118   2e-27   
ref|XP_006290766.1|  hypothetical protein CARUB_v10016874mg             119   6e-27   Capsella rubella
ref|XP_006290767.1|  hypothetical protein CARUB_v10016874mg             119   6e-27   
gb|KDO79302.1|  hypothetical protein CISIN_1g007253mg                   117   7e-27   Citrus sinensis [apfelsine]
gb|KDO79301.1|  hypothetical protein CISIN_1g007253mg                   117   7e-27   Citrus sinensis [apfelsine]
ref|XP_002876036.1|  hypothetical protein ARALYDRAFT_485401             118   8e-27   
ref|XP_006425849.1|  hypothetical protein CICLE_v10025192mg             118   8e-27   Citrus clementina [clementine]
ref|XP_002310736.1|  hypothetical protein POPTR_0007s11320g             117   2e-26   
ref|XP_011007668.1|  PREDICTED: CDPK-related kinase 5-like              117   2e-26   Populus euphratica
gb|KDO79300.1|  hypothetical protein CISIN_1g007253mg                   117   3e-26   Citrus sinensis [apfelsine]
ref|XP_011039202.1|  PREDICTED: CDPK-related kinase 5-like              116   4e-26   Populus euphratica
gb|KJB43647.1|  hypothetical protein B456_007G210700                    115   6e-26   Gossypium raimondii
gb|KJB43646.1|  hypothetical protein B456_007G210700                    115   8e-26   Gossypium raimondii
ref|XP_002522315.1|  calcium-dependent protein kinase, putative         114   9e-26   
ref|XP_010558347.1|  PREDICTED: CDPK-related kinase 5-like              115   1e-25   Tarenaya hassleriana [spider flower]
gb|AAL30814.1|AF435446_1  calcium/calmodulin-dependent protein ki...    114   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190622.1|  CDPK-related kinase                                   114   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511959.1|  PREDICTED: CDPK-related kinase 5-like              114   2e-25   Cicer arietinum [garbanzo]
gb|EMS61574.1|  Calcium/calmodulin-dependent serine/threonine-pro...    115   3e-25   Triticum urartu
ref|NP_001190048.1|  CDPK-related kinase                                114   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006829951.1|  hypothetical protein AMTR_s00073p00197610          114   3e-25   Amborella trichopoda
gb|EYU44373.1|  hypothetical protein MIMGU_mgv1a003006mg                114   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_002262855.3|  PREDICTED: CDPK-related kinase 5                   113   5e-25   Vitis vinifera
ref|XP_004142011.1|  PREDICTED: CDPK-related protein kinase-like        113   7e-25   Cucumis sativus [cucumbers]
emb|CAN74933.1|  hypothetical protein VITISV_044433                     113   7e-25   Vitis vinifera
gb|EYU39405.1|  hypothetical protein MIMGU_mgv1a0043832mg               110   7e-25   Erythranthe guttata [common monkey flower]
ref|XP_003562581.1|  PREDICTED: calcium/calmodulin-dependent seri...    112   1e-24   Brachypodium distachyon [annual false brome]
emb|CDP18369.1|  unnamed protein product                                105   2e-24   Coffea canephora [robusta coffee]
ref|XP_008457867.1|  PREDICTED: CDPK-related kinase 5-like              112   2e-24   Cucumis melo [Oriental melon]
ref|XP_008668263.1|  PREDICTED: uncharacterized LOC100381527 isof...    111   2e-24   Zea mays [maize]
ref|XP_004148051.1|  PREDICTED: CDPK-related protein kinase-like        111   2e-24   Cucumis sativus [cucumbers]
gb|EAZ16167.1|  hypothetical protein OsJ_31616                          107   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010515424.1|  PREDICTED: CDPK-related kinase 5                   111   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004958484.1|  PREDICTED: calcium/calmodulin-dependent seri...    111   2e-24   Setaria italica
ref|XP_004288057.1|  PREDICTED: CDPK-related kinase 5                   111   3e-24   Fragaria vesca subsp. vesca
ref|XP_011085503.1|  PREDICTED: CDPK-related protein kinase-like        111   3e-24   Sesamum indicum [beniseed]
ref|XP_010503722.1|  PREDICTED: CDPK-related kinase 5-like              111   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010112837.1|  Calcium/calmodulin-dependent serine/threonin...    111   3e-24   
ref|XP_009115721.1|  PREDICTED: CDPK-related kinase 5                   110   4e-24   Brassica rapa
emb|CDY52824.1|  BnaAnng11710D                                          110   4e-24   Brassica napus [oilseed rape]
ref|XP_010271816.1|  PREDICTED: CDPK-related kinase 7-like              110   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_002463267.1|  hypothetical protein SORBIDRAFT_02g040850          110   5e-24   Sorghum bicolor [broomcorn]
gb|KDO53618.1|  hypothetical protein CISIN_1g0074581mg                  104   5e-24   Citrus sinensis [apfelsine]
ref|XP_004984283.1|  PREDICTED: calcium/calmodulin-dependent seri...    110   5e-24   Setaria italica
ref|XP_009611550.1|  PREDICTED: CDPK-related kinase 5                   110   5e-24   Nicotiana tomentosiformis
ref|XP_010028268.1|  PREDICTED: CDPK-related kinase 5                   110   6e-24   Eucalyptus grandis [rose gum]
ref|XP_003624963.1|  Calcium-dependent protein kinase-like protein      110   6e-24   Medicago truncatula
ref|XP_008777902.1|  PREDICTED: calcium/calmodulin-dependent seri...    110   7e-24   Phoenix dactylifera
ref|XP_008798377.1|  PREDICTED: calcium/calmodulin-dependent seri...    110   7e-24   Phoenix dactylifera
ref|XP_010907987.1|  PREDICTED: calcium/calmodulin-dependent seri...    109   9e-24   Elaeis guineensis
ref|XP_010246175.1|  PREDICTED: CDPK-related kinase 1-like              109   9e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004493390.1|  PREDICTED: CDPK-related kinase 7-like              109   1e-23   Cicer arietinum [garbanzo]
dbj|BAK00699.1|  predicted protein                                      109   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001169442.1|  uncharacterized LOC100383313                       109   1e-23   Zea mays [maize]
ref|XP_010907988.1|  PREDICTED: calcium/calmodulin-dependent seri...    109   1e-23   
ref|XP_011099192.1|  PREDICTED: CDPK-related kinase 5 isoform X1        109   1e-23   Sesamum indicum [beniseed]
dbj|BAC16472.1|  putative calcium/calmodulin-dependent protein ki...    109   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002522159.1|  calcium-dependent protein kinase, putative         108   2e-23   
gb|KJB35810.1|  hypothetical protein B456_006G129900                    107   2e-23   Gossypium raimondii
gb|EEC82532.1|  hypothetical protein OsI_27055                          108   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010909915.1|  PREDICTED: CDPK-related kinase 7-like isofor...    108   2e-23   Elaeis guineensis
ref|XP_008377637.1|  PREDICTED: CDPK-related kinase 7-like isofor...    108   2e-23   
ref|XP_008377644.1|  PREDICTED: CDPK-related kinase 7-like isofor...    108   2e-23   
ref|XP_010909914.1|  PREDICTED: CDPK-related kinase 7-like isofor...    108   2e-23   Elaeis guineensis
ref|XP_007028316.1|  CDPK-related kinase 1                              108   3e-23   
sp|P53681.1|CRK_DAUCA  RecName: Full=CDPK-related protein kinase;...    108   3e-23   Daucus carota [carrots]
ref|XP_006836275.1|  hypothetical protein AMTR_s00101p00154790          108   3e-23   Amborella trichopoda
ref|XP_002322616.1|  CDPK-related kinase 1 family protein               108   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_007047191.1|  CDPK-related kinase                                108   3e-23   Theobroma cacao [chocolate]
ref|XP_010673049.1|  PREDICTED: CDPK-related kinase 7-like              108   4e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB35809.1|  hypothetical protein B456_006G129900                    107   4e-23   Gossypium raimondii
ref|XP_010542604.1|  PREDICTED: CDPK-related kinase 1                   107   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_009371242.1|  PREDICTED: CDPK-related kinase 7-like              107   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_006346445.1|  PREDICTED: CDPK-related kinase 5-like              107   4e-23   Solanum tuberosum [potatoes]
ref|NP_001146092.1|  uncharacterized protein LOC100279624               103   4e-23   Zea mays [maize]
ref|XP_008440252.1|  PREDICTED: CDPK-related kinase 5 isoform X1        107   4e-23   Cucumis melo [Oriental melon]
ref|XP_011027259.1|  PREDICTED: CDPK-related kinase 7-like isofor...    107   5e-23   Populus euphratica
ref|XP_008440253.1|  PREDICTED: CDPK-related kinase 5 isoform X2        107   5e-23   Cucumis melo [Oriental melon]
ref|XP_011000411.1|  PREDICTED: CDPK-related kinase 7-like              107   5e-23   Populus euphratica
ref|XP_003518984.1|  PREDICTED: CDPK-related kinase 7-like isofor...    107   7e-23   Glycine max [soybeans]
emb|CDP06189.1|  unnamed protein product                                107   7e-23   Coffea canephora [robusta coffee]
ref|XP_002308892.2|  CDPK-related kinase 1 family protein               107   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010922072.1|  PREDICTED: calcium/calmodulin-dependent seri...    107   8e-23   Elaeis guineensis
ref|XP_003516596.1|  PREDICTED: CDPK-related kinase 5-like              107   8e-23   Glycine max [soybeans]
ref|XP_007163947.1|  hypothetical protein PHAVU_L003400g                107   9e-23   Phaseolus vulgaris [French bean]
gb|KHG24093.1|  Calcium/calmodulin-dependent serine/threonine-pro...    106   9e-23   Gossypium arboreum [tree cotton]
ref|XP_008464945.1|  PREDICTED: CDPK-related kinase 7-like isofor...    106   1e-22   Cucumis melo [Oriental melon]
ref|XP_008464946.1|  PREDICTED: CDPK-related kinase 1-like isofor...    106   1e-22   Cucumis melo [Oriental melon]
ref|XP_009420969.1|  PREDICTED: calcium/calmodulin-dependent seri...    106   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006482068.1|  PREDICTED: CDPK-related kinase 7-like              105   2e-22   Citrus sinensis [apfelsine]
ref|XP_010228587.1|  PREDICTED: calcium/calmodulin-dependent seri...    105   2e-22   
ref|XP_006430539.1|  hypothetical protein CICLE_v10011368mg             105   2e-22   Citrus clementina [clementine]
ref|XP_003557839.1|  PREDICTED: calcium/calmodulin-dependent seri...    105   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_009801386.1|  PREDICTED: CDPK-related kinase 5-like              105   3e-22   Nicotiana sylvestris
ref|XP_004230803.1|  PREDICTED: CDPK-related kinase 5                   105   3e-22   Solanum lycopersicum
ref|XP_004141122.1|  PREDICTED: calcium/calmodulin-dependent seri...    105   3e-22   Cucumis sativus [cucumbers]
ref|XP_009405856.1|  PREDICTED: calcium/calmodulin-dependent seri...    105   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002467812.1|  hypothetical protein SORBIDRAFT_01g034520          105   3e-22   Sorghum bicolor [broomcorn]
ref|XP_009404698.1|  PREDICTED: calcium/calmodulin-dependent seri...    104   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP27484.1|  hypothetical protein JCGZ_20019                         104   5e-22   Jatropha curcas
ref|XP_006360222.1|  PREDICTED: CDPK-related protein kinase-like        104   5e-22   Solanum tuberosum [potatoes]
ref|NP_001140858.1|  uncharacterized LOC100272934                       104   5e-22   Zea mays [maize]
ref|XP_003535908.1|  PREDICTED: CDPK-related kinase 1-like              104   6e-22   Glycine max [soybeans]
ref|XP_008667154.1|  PREDICTED: uncharacterized LOC100272934 isof...    104   6e-22   Zea mays [maize]
ref|XP_008240668.1|  PREDICTED: CDPK-related kinase 7                   104   7e-22   Prunus mume [ume]
ref|XP_004509161.1|  PREDICTED: CDPK-related protein kinase-like        104   8e-22   Cicer arietinum [garbanzo]
ref|XP_009393900.1|  PREDICTED: calcium/calmodulin-dependent seri...    103   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156824.1|  hypothetical protein PHAVU_002G020800g             103   1e-21   Phaseolus vulgaris [French bean]
ref|NP_191235.1|  CDPK-related kinase 7                                 102   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427515.1|  PREDICTED: CDPK-related kinase 7-like isofor...    102   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010516279.1|  PREDICTED: CDPK-related kinase 7                   102   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010504583.1|  PREDICTED: CDPK-related kinase 7-like              102   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006290768.1|  hypothetical protein CARUB_v10016875mg             102   3e-21   
ref|XP_006290769.1|  hypothetical protein CARUB_v10016875mg             102   3e-21   
ref|XP_010427514.1|  PREDICTED: CDPK-related kinase 7-like isofor...    102   3e-21   Camelina sativa [gold-of-pleasure]
gb|AET04065.2|  calmodulin-domain kinase CDPK protein                   102   3e-21   Medicago truncatula
ref|XP_011079071.1|  PREDICTED: CDPK-related kinase 1-like              102   4e-21   Sesamum indicum [beniseed]
ref|XP_003629589.1|  Calcium/calmodulin-dependent protein kinase ...    102   4e-21   
gb|EYU20808.1|  hypothetical protein MIMGU_mgv1a003516mg                101   5e-21   Erythranthe guttata [common monkey flower]
ref|XP_004233433.1|  PREDICTED: CDPK-related kinase 5-like              101   6e-21   Solanum lycopersicum
ref|XP_008658484.1|  PREDICTED: uncharacterized LOC100279633 isof...    101   6e-21   Zea mays [maize]
ref|NP_001146101.1|  uncharacterized LOC100279633                       101   7e-21   Zea mays [maize]
gb|EEC75325.1|  hypothetical protein OsI_11701                          101   8e-21   Oryza sativa Indica Group [Indian rice]
gb|EPS58889.1|  hypothetical protein M569_15923                       98.2    8e-21   Genlisea aurea
ref|XP_007145486.1|  hypothetical protein PHAVU_007G243100g             101   8e-21   Phaseolus vulgaris [French bean]
ref|XP_006402951.1|  hypothetical protein EUTSA_v10005861mg             101   8e-21   Eutrema salsugineum [saltwater cress]
emb|CBI32784.3|  unnamed protein product                                101   9e-21   Vitis vinifera
ref|XP_002282577.1|  PREDICTED: CDPK-related kinase 1                   100   9e-21   Vitis vinifera
ref|NP_001050179.1|  Os03g0366200                                       101   1e-20   
sp|Q10KY3.1|CAMK1_ORYSJ  RecName: Full=Calcium/calmodulin-depende...    101   1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|AAK54157.1|AF368282_1  CaMK1                                         101   1e-20   Oryza sativa [red rice]
ref|XP_009409499.1|  PREDICTED: CDPK-related kinase 5-like              101   1e-20   
ref|XP_011075448.1|  PREDICTED: CDPK-related kinase 1                   100   1e-20   Sesamum indicum [beniseed]
ref|XP_009618516.1|  PREDICTED: CDPK-related kinase 7-like              100   1e-20   Nicotiana tomentosiformis
ref|XP_009761409.1|  PREDICTED: CDPK-related kinase 1-like              100   1e-20   Nicotiana sylvestris
ref|XP_002879911.1|  hypothetical protein ARALYDRAFT_483182             100   2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_002878106.1|  hypothetical protein ARALYDRAFT_486115             100   2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_006362272.1|  PREDICTED: CDPK-related kinase 1-like              100   2e-20   Solanum tuberosum [potatoes]
ref|XP_004249131.1|  PREDICTED: CDPK-related kinase 1                   100   2e-20   Solanum lycopersicum
ref|XP_010525467.1|  PREDICTED: CDPK-related kinase 1-like            99.8    3e-20   Tarenaya hassleriana [spider flower]
gb|EPS59727.1|  hypothetical protein M569_15078                       99.4    3e-20   Genlisea aurea
gb|KCW47909.1|  hypothetical protein EUGRSUZ_K01647                   98.2    4e-20   Eucalyptus grandis [rose gum]
ref|XP_006411380.1|  hypothetical protein EUTSA_v10016437mg           99.4    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010911684.1|  PREDICTED: CDPK-related kinase 5-like            94.7    5e-20   Elaeis guineensis
ref|NP_181647.1|  CDPK-related kinase 1                               99.0    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508754.1|  PREDICTED: CDPK-related kinase 1-like            98.6    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010036359.1|  PREDICTED: CDPK-related kinase 1-like            98.2    9e-20   Eucalyptus grandis [rose gum]
ref|XP_010426596.1|  PREDICTED: CDPK-related kinase 5-like            97.8    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006293901.1|  hypothetical protein CARUB_v10022894mg           97.8    1e-19   Capsella rubella
gb|KFK34914.1|  hypothetical protein AALP_AA5G210000                  97.8    1e-19   Arabis alpina [alpine rockcress]
ref|XP_010517599.1|  PREDICTED: CDPK-related kinase 1 isoform X1      97.4    1e-19   
gb|EPS69494.1|  hypothetical protein M569_05270                       97.8    1e-19   Genlisea aurea
ref|XP_010680435.1|  PREDICTED: CDPK-related kinase 5                 96.7    3e-19   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY22505.1|  BnaC03g23150D                                        96.3    4e-19   Brassica napus [oilseed rape]
gb|KHN47935.1|  CDPK-related protein kinase                           95.5    7e-19   Glycine soja [wild soybean]
ref|XP_010916660.1|  PREDICTED: CDPK-related kinase 5                 95.5    9e-19   Elaeis guineensis
ref|XP_003525704.1|  PREDICTED: CDPK-related kinase 5-like isofor...  95.1    1e-18   Glycine max [soybeans]
ref|XP_009389551.1|  PREDICTED: CDPK-related kinase 5-like            95.1    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47375.1|  BnaC04g24880D                                        94.4    2e-18   Brassica napus [oilseed rape]
ref|XP_008795162.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...  94.4    2e-18   Phoenix dactylifera
ref|XP_009133469.1|  PREDICTED: CDPK-related kinase 1                 94.0    3e-18   Brassica rapa
emb|CDY35427.1|  BnaA03g19330D                                        94.0    3e-18   Brassica napus [oilseed rape]
ref|XP_007155949.1|  hypothetical protein PHAVU_003G2460000g          92.8    4e-18   Phaseolus vulgaris [French bean]
ref|XP_009139075.1|  PREDICTED: CDPK-related kinase 7-like            92.8    6e-18   Brassica rapa
ref|XP_008669867.1|  PREDICTED: calcium/calmodulin-dependent seri...  89.7    6e-18   Zea mays [maize]
gb|KFK36961.1|  hypothetical protein AALP_AA4G195100                  92.0    1e-17   Arabis alpina [alpine rockcress]
emb|CDY23873.1|  BnaC04g01640D                                        91.3    2e-17   Brassica napus [oilseed rape]
emb|CDX79956.1|  BnaA05g02000D                                        91.3    2e-17   
ref|XP_009142724.1|  PREDICTED: CDPK-related kinase 1-like            91.3    2e-17   Brassica rapa
emb|CDY65016.1|  BnaCnng45690D                                        90.9    3e-17   Brassica napus [oilseed rape]
gb|EPS59805.1|  hypothetical protein M569_15001                       86.3    6e-17   Genlisea aurea
ref|XP_006404024.1|  hypothetical protein EUTSA_v10010211mg           89.7    7e-17   Eutrema salsugineum [saltwater cress]
emb|CDX76010.1|  BnaA04g02740D                                        89.7    7e-17   
ref|XP_003611786.1|  CDPK-related protein kinase                      88.2    2e-16   Medicago truncatula
gb|ABK25039.1|  unknown                                               84.7    3e-15   Picea sitchensis
ref|XP_009101966.1|  PREDICTED: CDPK-related kinase 5-like isofor...  84.3    4e-15   Brassica rapa
ref|XP_009101959.1|  PREDICTED: CDPK-related kinase 5-like isofor...  84.3    4e-15   Brassica rapa
ref|XP_002973513.1|  CDK related protein kinase 5                     84.3    4e-15   Selaginella moellendorffii
ref|XP_008654062.1|  PREDICTED: calcium/calmodulin-dependent seri...  80.9    5e-15   Zea mays [maize]
emb|CDY65651.1|  BnaCnng48080D                                        83.2    9e-15   Brassica napus [oilseed rape]
ref|XP_006658886.1|  PREDICTED: calcium/calmodulin-dependent seri...  82.8    1e-14   Oryza brachyantha
gb|KDO86572.1|  hypothetical protein CISIN_1g007498mg                 81.6    2e-14   Citrus sinensis [apfelsine]
ref|XP_003528501.1|  PREDICTED: CDPK-related kinase 5-like            82.4    2e-14   Glycine max [soybeans]
ref|XP_003520170.1|  PREDICTED: CDPK-related kinase 5-like            82.0    2e-14   Glycine max [soybeans]
ref|XP_006651413.1|  PREDICTED: calcium/calmodulin-dependent seri...  82.0    2e-14   
ref|XP_011088749.1|  PREDICTED: CDPK-related protein kinase-like      82.0    2e-14   
dbj|BAK06421.1|  predicted protein                                    82.0    3e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002975545.1|  CDPK-related protein kinase 3                    81.6    3e-14   Selaginella moellendorffii
ref|XP_004166903.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...  81.6    3e-14   
ref|XP_004140506.1|  PREDICTED: CDPK-related protein kinase-like      81.6    3e-14   Cucumis sativus [cucumbers]
ref|XP_006444766.1|  hypothetical protein CICLE_v10019386mg           81.6    3e-14   Citrus clementina [clementine]
ref|XP_008459758.1|  PREDICTED: CDPK-related kinase 3 isoform X1      81.6    3e-14   Cucumis melo [Oriental melon]
gb|EMT32885.1|  hypothetical protein F775_33150                       77.0    3e-14   
ref|XP_004308284.1|  PREDICTED: CDPK-related kinase 3 isoform X1      81.6    4e-14   Fragaria vesca subsp. vesca
ref|XP_002266654.1|  PREDICTED: CDPK-related kinase 3 isoform X1      81.3    4e-14   Vitis vinifera
ref|XP_010661483.1|  PREDICTED: CDPK-related kinase 3 isoform X2      81.3    5e-14   
ref|XP_010507983.1|  PREDICTED: CDPK-related kinase 3-like            81.3    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008236646.1|  PREDICTED: CDPK-related kinase 5-like            80.9    6e-14   Prunus mume [ume]
ref|XP_007199766.1|  hypothetical protein PRUPE_ppa003176mg           80.9    6e-14   Prunus persica
gb|EEE59103.1|  hypothetical protein OsJ_10960                        80.5    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010251747.1|  PREDICTED: CDPK-related kinase 3-like            80.5    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010906427.1|  PREDICTED: CDPK-related kinase 3-like isofor...  80.5    8e-14   
ref|XP_010906425.1|  PREDICTED: CDPK-related kinase 3-like isofor...  80.5    8e-14   
ref|XP_003608023.1|  Calcium/calmodulin-dependent protein kinase ...  80.5    8e-14   Medicago truncatula
ref|XP_010906424.1|  PREDICTED: CDPK-related kinase 3-like isofor...  80.5    8e-14   
ref|XP_010906426.1|  PREDICTED: CDPK-related kinase 3-like isofor...  80.5    9e-14   Elaeis guineensis
ref|XP_002281956.2|  PREDICTED: CDPK-related kinase 5                 80.5    9e-14   Vitis vinifera
emb|CAN82235.1|  hypothetical protein VITISV_007568                   80.1    9e-14   Vitis vinifera
ref|XP_010906428.1|  PREDICTED: CDPK-related kinase 3-like isofor...  80.1    1e-13   
ref|XP_008357862.1|  PREDICTED: CDPK-related kinase 3-like            79.7    1e-13   
ref|XP_009375449.1|  PREDICTED: CDPK-related kinase 3 isoform X1      80.1    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_010267444.1|  PREDICTED: CDPK-related kinase 3 isoform X2      79.7    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010267443.1|  PREDICTED: CDPK-related kinase 3 isoform X1      79.7    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009418319.1|  PREDICTED: CDPK-related kinase 3-like            79.7    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003626588.1|  Calcium dependent protein kinase-like protein    79.3    2e-13   Medicago truncatula
ref|XP_004494853.1|  PREDICTED: CDPK-related kinase 3-like            79.3    2e-13   Cicer arietinum [garbanzo]
ref|XP_004136991.1|  PREDICTED: CDPK-related protein kinase-like      79.0    2e-13   Cucumis sativus [cucumbers]
ref|XP_001751663.1|  predicted protein                                79.0    2e-13   
ref|XP_008776463.1|  PREDICTED: CDPK-related kinase 3-like isofor...  79.0    3e-13   Phoenix dactylifera
ref|XP_008776464.1|  PREDICTED: CDPK-related kinase 3-like isofor...  79.0    3e-13   Phoenix dactylifera
ref|XP_006846568.1|  hypothetical protein AMTR_s00018p00240170        79.0    3e-13   Amborella trichopoda
ref|XP_001763397.1|  predicted protein                                77.8    5e-13   
ref|XP_010100681.1|  CDPK-related protein kinase                      78.2    5e-13   
gb|KFK34304.1|  hypothetical protein AALP_AA5G127600                  77.8    6e-13   Arabis alpina [alpine rockcress]
ref|XP_010107975.1|  CDPK-related protein kinase                      77.8    6e-13   Morus notabilis
ref|XP_008233078.1|  PREDICTED: CDPK-related kinase 3 isoform X1      77.8    6e-13   Prunus mume [ume]
ref|XP_007218866.1|  hypothetical protein PRUPE_ppa003103mg           77.8    7e-13   Prunus persica
ref|XP_010506686.1|  PREDICTED: CDPK-related kinase 3-like            77.8    7e-13   Camelina sativa [gold-of-pleasure]
ref|NP_182193.1|  CDPK-related kinase 3                               77.4    7e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAL30817.1|AF435449_1  calcium/calmodulin-dependent protein ki...  77.4    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518347.1|  PREDICTED: CDPK-related kinase 3                 77.4    7e-13   Camelina sativa [gold-of-pleasure]
gb|AAL58909.1|AF462819_1  At2g46700/T3A4.8                            77.4    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293857.1|  hypothetical protein CARUB_v10022864mg           77.4    7e-13   Capsella rubella
ref|XP_002882085.1|  hypothetical protein ARALYDRAFT_483834           77.4    8e-13   
ref|XP_007051460.1|  CDPK-related kinase 3 isoform 2                  77.0    8e-13   
ref|XP_004290295.1|  PREDICTED: CDPK-related kinase 5-like            77.4    8e-13   Fragaria vesca subsp. vesca
ref|XP_006397861.1|  hypothetical protein EUTSA_v10001366mg           77.4    9e-13   Eutrema salsugineum [saltwater cress]
ref|XP_007051459.1|  CDPK-related kinase 3 isoform 1                  77.0    1e-12   
ref|XP_009407964.1|  PREDICTED: CDPK-related kinase 3-like            76.6    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP28435.1|  hypothetical protein JCGZ_14206                       76.6    1e-12   Jatropha curcas
ref|XP_009391964.1|  PREDICTED: CDPK-related kinase 3-like isofor...  76.6    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ96597.1|  predicted protein                                    76.6    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009796477.1|  PREDICTED: CDPK-related kinase 3                 76.3    2e-12   Nicotiana sylvestris
gb|KDP38227.1|  hypothetical protein JCGZ_04870                       75.9    2e-12   Jatropha curcas
ref|XP_003563563.1|  PREDICTED: CDPK-related kinase 3-like            75.9    3e-12   Brachypodium distachyon [annual false brome]
gb|EEE66354.1|  hypothetical protein OsJ_22648                        75.9    3e-12   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD54109.1|  putative calcium/calmodulin-dependent protein ki...  75.5    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ACF84338.1|  unknown                                               75.5    3e-12   Zea mays [maize]
gb|AAG01179.1|AF289237_1  calcium/calmodulin dependent protein ki...  75.5    3e-12   Zea mays [maize]
ref|NP_001105305.1|  LOC542225                                        75.5    3e-12   
gb|KJB09602.1|  hypothetical protein B456_001G152000                  75.1    4e-12   Gossypium raimondii
gb|KJB09601.1|  hypothetical protein B456_001G152000                  75.1    4e-12   Gossypium raimondii
ref|XP_007156536.1|  hypothetical protein PHAVU_003G294300g           75.5    4e-12   Phaseolus vulgaris [French bean]
gb|KJB09603.1|  hypothetical protein B456_001G152000                  75.1    5e-12   
ref|XP_006657343.1|  PREDICTED: CDPK-related kinase 3-like            75.1    5e-12   
ref|XP_009588677.1|  PREDICTED: CDPK-related kinase 3                 75.1    5e-12   
gb|KJB09598.1|  hypothetical protein B456_001G152000                  75.1    5e-12   
emb|CDY48019.1|  BnaA04g26710D                                        74.7    6e-12   
ref|XP_009142438.1|  PREDICTED: CDPK-related kinase 3                 74.7    6e-12   
gb|KJB41589.1|  hypothetical protein B456_007G111600                  74.3    7e-12   
gb|KHG14961.1|  CDPK-related protein kinase                           74.3    7e-12   
gb|KHG10111.1|  CDPK-related protein kinase                           73.9    9e-12   
gb|KJB41588.1|  hypothetical protein B456_007G111600                  73.9    1e-11   
gb|AFW69484.1|  putative protein kinase superfamily protein           71.6    1e-11   
ref|XP_008668447.1|  PREDICTED: uncharacterized protein LOC100383...  73.9    1e-11   
emb|CDY27530.1|  BnaC04g51710D                                        73.9    1e-11   
ref|XP_008455723.1|  PREDICTED: CDPK-related kinase 1 isoform X1      73.6    1e-11   
ref|XP_004144329.1|  PREDICTED: CDPK-related protein kinase-like      73.6    2e-11   
ref|XP_004230019.1|  PREDICTED: CDPK-related kinase 3                 73.6    2e-11   
ref|XP_010523831.1|  PREDICTED: CDPK-related kinase 3 isoform X1      73.2    2e-11   
ref|XP_006339759.1|  PREDICTED: CDPK-related kinase 3-like isofor...  72.4    3e-11   
gb|AFW69482.1|  putative protein kinase superfamily protein           72.0    4e-11   
ref|XP_002529963.1|  calcium-dependent protein kinase, putative       72.4    4e-11   
ref|XP_001773184.1|  crk2 CDPK-related kinase                         72.4    4e-11   
ref|XP_001751664.1|  predicted protein                                72.0    4e-11   
gb|AFW69483.1|  putative protein kinase superfamily protein           72.0    4e-11   
gb|ACG29980.1|  CDPK-related protein kinase                           72.0    5e-11   
ref|XP_009389129.1|  PREDICTED: CDPK-related kinase 3-like            72.0    5e-11   
gb|KFK37447.1|  hypothetical protein AALP_AA4G258000                  71.6    6e-11   
ref|XP_002463191.1|  hypothetical protein SORBIDRAFT_02g039460        71.6    6e-11   
ref|XP_004505191.1|  PREDICTED: CDPK-related kinase 5-like isofor...  71.2    8e-11   
ref|NP_001146922.1|  LOC100280531                                     71.2    8e-11   
ref|NP_001105740.1|  calcium dependent protein kinase1                71.2    8e-11   
tpg|DAA63631.1|  TPA: LOW QUALITY PROTEIN: putative protein kinas...  71.2    8e-11   
gb|AAV64211.1|  putative CDPK-related protein kinase                  71.2    8e-11   
ref|XP_004505190.1|  PREDICTED: CDPK-related kinase 5-like isofor...  71.2    9e-11   
gb|AFC88293.1|  calcium-dependent protein kinase 6                    71.2    9e-11   
gb|ACG29695.1|  hypothetical protein                                  70.9    1e-10   
ref|XP_004958339.1|  PREDICTED: CDPK-related kinase 5-like            70.9    1e-10   
dbj|BAA12691.1|  CDPK-related protein kinase                          70.9    1e-10   
gb|KJB32431.1|  hypothetical protein B456_005G240400                  70.5    1e-10   
ref|XP_008664763.1|  PREDICTED: CDPK-related kinase 3-like            70.5    1e-10   
gb|KJB32430.1|  hypothetical protein B456_005G240400                  70.5    2e-10   
emb|CDP08633.1|  unnamed protein product                              70.1    2e-10   
gb|KCW63821.1|  hypothetical protein EUGRSUZ_G014961                  67.0    2e-10   
ref|XP_010691967.1|  PREDICTED: CDPK-related kinase 3 isoform X2      69.7    2e-10   
ref|XP_009135616.1|  PREDICTED: CDPK-related kinase 2-like isofor...  69.7    2e-10   
gb|EPS64721.1|  serine/threonine protein kinase pk23                  69.7    2e-10   
ref|XP_009135614.1|  PREDICTED: CDPK-related kinase 2-like isofor...  69.7    3e-10   
ref|XP_010691907.1|  PREDICTED: CDPK-related kinase 3 isoform X1      69.7    3e-10   
emb|CDX82311.1|  BnaA03g35100D                                        69.7    3e-10   
ref|XP_004982632.1|  PREDICTED: CDPK-related kinase 3-like            69.3    3e-10   
emb|CDP05005.1|  unnamed protein product                              69.3    4e-10   
ref|XP_003562669.1|  PREDICTED: CDPK-related kinase 5-like            69.3    4e-10   
dbj|BAC79915.1|  putative CDPK-related protein kinase                 68.9    4e-10   
emb|CDO97150.1|  unnamed protein product                              68.9    5e-10   
ref|XP_006393243.1|  hypothetical protein EUTSA_v10011327mg           68.9    5e-10   
gb|KHG25548.1|  CDPK-related protein kinase                           68.9    5e-10   
ref|XP_008650573.1|  PREDICTED: CDPK-related kinase 3-like            68.2    5e-10   
ref|XP_002273024.1|  PREDICTED: CDPK-related kinase 3 isoform X1      68.6    6e-10   
ref|XP_010933746.1|  PREDICTED: CDPK-related kinase 3-like isofor...  68.6    6e-10   
gb|KDP21986.1|  hypothetical protein JCGZ_03151                       68.6    6e-10   
emb|CAN64098.1|  hypothetical protein VITISV_014897                   68.6    7e-10   
ref|XP_010933745.1|  PREDICTED: CDPK-related kinase 3-like isofor...  68.2    7e-10   
ref|XP_010933744.1|  PREDICTED: CDPK-related kinase 3-like isofor...  68.2    8e-10   
gb|AFW77334.1|  putative protein kinase superfamily protein           67.8    9e-10   
tpg|DAA54911.1|  TPA: putative protein kinase superfamily protein     67.8    1e-09   
ref|XP_008796870.1|  PREDICTED: CDPK-related kinase 3-like            67.8    1e-09   
ref|XP_010066051.1|  PREDICTED: CDPK-related kinase 5                 67.8    1e-09   
ref|XP_008392297.1|  PREDICTED: CDPK-related kinase 5-like            67.8    1e-09   
ref|XP_009347422.1|  PREDICTED: CDPK-related kinase 5-like            67.4    1e-09   
ref|XP_009358061.1|  PREDICTED: CDPK-related kinase 5-like            67.4    1e-09   
ref|XP_002302662.1|  calcium-dependent protein kinase                 67.4    2e-09   
ref|XP_011023116.1|  PREDICTED: CDPK-related kinase 3 isoform X1      67.4    2e-09   
ref|XP_006384440.1|  hypothetical protein POPTR_0004s15110g           67.0    2e-09   
ref|XP_002960835.1|  CPK related protein kinase 5                     67.0    2e-09   
ref|XP_003574184.1|  PREDICTED: CDPK-related kinase 3-like isofor...  66.6    3e-09   
ref|XP_008791674.1|  PREDICTED: CDPK-related kinase 3-like isofor...  66.6    3e-09   
ref|XP_002983837.1|  CPK-related protein kinase 3                     66.2    3e-09   
ref|XP_008791673.1|  PREDICTED: CDPK-related kinase 3-like isofor...  66.2    3e-09   
ref|XP_010523217.1|  PREDICTED: CDPK-related kinase 8 isoform X1      66.2    4e-09   
ref|XP_010523218.1|  PREDICTED: CDPK-related kinase 8 isoform X2      66.2    4e-09   
emb|CDX77233.1|  BnaC08g02780D                                        65.9    5e-09   
ref|XP_002891522.1|  hypothetical protein ARALYDRAFT_474093           65.9    5e-09   
emb|CDY22990.1|  BnaC03g40790D                                        65.5    6e-09   
ref|XP_007218875.1|  hypothetical protein PRUPE_ppa003281mg           65.5    6e-09   
ref|XP_009149741.1|  PREDICTED: CDPK-related kinase 6                 65.5    6e-09   
emb|CDY08129.1|  BnaA06g15970D                                        65.5    6e-09   
ref|XP_004966436.1|  PREDICTED: CDPK-related kinase 3-like            65.5    6e-09   
ref|XP_006406536.1|  hypothetical protein EUTSA_v10020326mg           65.1    7e-09   
ref|NP_001234146.1|  serine/threonine protein kinase pk23             65.1    8e-09   
ref|XP_007135298.1|  hypothetical protein PHAVU_010G117600g           65.1    8e-09   
ref|XP_009387591.1|  PREDICTED: CDPK-related kinase 3-like isofor...  65.1    8e-09   
ref|XP_009387592.1|  PREDICTED: CDPK-related kinase 3-like isofor...  65.1    8e-09   
ref|XP_009112142.1|  PREDICTED: CDPK-related kinase 2                 65.1    9e-09   
emb|CDY18568.1|  BnaA01g26270D                                        65.1    1e-08   
ref|XP_009145826.1|  PREDICTED: CDPK-related kinase 2-like            64.7    1e-08   
ref|XP_011001201.1|  PREDICTED: CDPK-related kinase 5-like            64.7    1e-08   
ref|XP_009366623.1|  PREDICTED: CDPK-related kinase 3-like            64.7    1e-08   
ref|XP_003528772.1|  PREDICTED: CDPK-related kinase 3-like            64.7    1e-08   
ref|NP_175381.1|  CDPK-related kinase 8                               64.3    1e-08   
dbj|BAK07484.1|  predicted protein                                    64.3    1e-08   
gb|EYU32286.1|  hypothetical protein MIMGU_mgv1a003187mg              64.3    1e-08   
ref|XP_011084555.1|  PREDICTED: CDPK-related kinase 6-like            64.3    2e-08   
ref|XP_007136495.1|  hypothetical protein PHAVU_009G050100g           63.9    2e-08   
gb|KDO49132.1|  hypothetical protein CISIN_1g007776mg                 63.9    2e-08   
ref|XP_008376189.1|  PREDICTED: CDPK-related kinase 3                 63.9    2e-08   
ref|XP_003522533.1|  PREDICTED: CDPK-related kinase 4-like            63.9    2e-08   
ref|NP_001065038.1|  Os10g0510700                                     63.9    2e-08   
gb|AAK84452.1|AC087192_13  putative kinase                            63.9    2e-08   
gb|KDO49130.1|  hypothetical protein CISIN_1g007776mg                 63.5    2e-08   
ref|XP_002320890.1|  calcium-dependent protein kinase                 63.9    2e-08   
ref|XP_006480135.1|  PREDICTED: CDPK-related kinase 5-like            63.5    3e-08   
ref|XP_006423061.1|  hypothetical protein CICLE_v10028073mg           63.5    3e-08   
gb|KDO49131.1|  hypothetical protein CISIN_1g007776mg                 63.5    3e-08   
emb|CDX99267.1|  BnaC05g33820D                                        63.5    3e-08   
emb|CDX92303.1|  BnaA05g21040D                                        63.5    3e-08   
ref|XP_003526744.1|  PREDICTED: CDPK-related kinase 6-like            63.5    3e-08   
ref|XP_002521854.1|  calcium-dependent protein kinase, putative       63.5    3e-08   
gb|EYU19682.1|  hypothetical protein MIMGU_mgv1a003314mg              63.2    3e-08   
gb|KFK39251.1|  hypothetical protein AALP_AA3G220000                  63.2    4e-08   
emb|CDY16510.1|  BnaA08g02570D                                        63.2    4e-08   
ref|XP_002877670.1|  hypothetical protein ARALYDRAFT_485296           63.2    4e-08   
ref|XP_010054975.1|  PREDICTED: CDPK-related kinase 3                 63.2    4e-08   
ref|XP_009624841.1|  PREDICTED: CDPK-related kinase 4-like isofor...  62.8    4e-08   
ref|XP_009768686.1|  PREDICTED: CDPK-related kinase 4-like isofor...  62.8    5e-08   
ref|XP_009107289.1|  PREDICTED: CDPK-related kinase 8 isoform X2      62.8    5e-08   
ref|XP_008234671.1|  PREDICTED: CDPK-related kinase 4-like            62.8    5e-08   
ref|XP_011038973.1|  PREDICTED: CDPK-related kinase 3-like            62.4    6e-08   
gb|AAD38059.1|AF153352_1  CDPK-related kinase 2                       62.4    6e-08   
gb|KFK35999.1|  hypothetical protein AALP_AA4G064700                  62.4    6e-08   
ref|NP_188541.1|  CDPK-related kinase 2                               62.4    7e-08   
emb|CDX95464.1|  BnaC01g33560D                                        62.4    7e-08   
ref|XP_004502721.1|  PREDICTED: CDPK-related kinase 4-like            62.4    7e-08   
ref|XP_010466044.1|  PREDICTED: CDPK-related kinase 2-like            62.4    7e-08   
ref|XP_007042370.1|  CDPK-related kinase                              62.0    8e-08   
ref|NP_190506.1|  CDPK-related kinase 6                               62.0    8e-08   
ref|XP_002883163.1|  hypothetical protein ARALYDRAFT_898284           61.6    1e-07   
ref|XP_008644706.1|  PREDICTED: CDPK-related kinase 3-like            61.6    1e-07   
ref|XP_006303933.1|  hypothetical protein CARUB_v10008616mg           61.6    1e-07   
emb|CDX86978.1|  BnaC03g52480D                                        61.6    1e-07   
ref|XP_006394699.1|  hypothetical protein EUTSA_v10003876mg           61.6    1e-07   
ref|XP_009150150.1|  PREDICTED: CDPK-related kinase 6                 61.2    2e-07   
ref|XP_011094288.1|  PREDICTED: CDPK-related kinase 3                 61.2    2e-07   
emb|CDY05930.1|  BnaC08g21070D                                        60.8    2e-07   
ref|XP_010507434.1|  PREDICTED: CDPK-related kinase 2                 60.8    2e-07   
gb|KJB79284.1|  hypothetical protein B456_013G042100                  60.8    2e-07   
gb|EMT18723.1|  CDPK-related protein kinase                           60.8    2e-07   
ref|XP_002874198.1|  hypothetical protein ARALYDRAFT_910482           60.8    2e-07   
gb|KJB23989.1|  hypothetical protein B456_004G123900                  60.8    3e-07   
ref|XP_010421271.1|  PREDICTED: CDPK-related kinase 4                 60.5    3e-07   
gb|EMS51587.1|  Calcium/calmodulin-dependent serine/threonine-pro...  56.6    3e-07   
gb|KJB23990.1|  hypothetical protein B456_004G123900                  60.5    3e-07   
ref|XP_010493602.1|  PREDICTED: CDPK-related kinase 4-like            60.5    3e-07   
ref|XP_009383250.1|  PREDICTED: CDPK-related kinase 3-like            60.5    3e-07   
gb|KJB79283.1|  hypothetical protein B456_013G042100                  60.5    3e-07   
ref|XP_002515635.1|  calcium-dependent protein kinase, putative       60.5    3e-07   
ref|XP_006661945.1|  PREDICTED: CDPK-related kinase 3-like            60.1    4e-07   
gb|KHG30483.1|  CDPK-related protein kinase                           60.1    4e-07   
gb|AAL30818.1|AF435450_1  calcium/calmodulin-dependent protein ki...  60.1    4e-07   
ref|NP_197831.3|  CDPK-related kinase 4 (AtCRK4)                      60.1    4e-07   
emb|CDY00200.1|  BnaA06g21010D                                        60.1    5e-07   
ref|XP_007039175.1|  Calcium-dependent protein kinase (CDPK) fami...  60.1    5e-07   
ref|XP_002313096.2|  hypothetical protein POPTR_0009s10880g           60.1    5e-07   
ref|XP_009107288.1|  PREDICTED: CDPK-related kinase 8 isoform X1      60.1    5e-07   
gb|KHG10876.1|  CDPK-related protein kinase                           59.7    5e-07   
ref|XP_010479393.1|  PREDICTED: CDPK-related kinase 8-like            59.7    5e-07   
ref|XP_006299075.1|  hypothetical protein CARUB_v10015215mg           59.7    6e-07   
ref|XP_006404152.1|  hypothetical protein EUTSA_v10010221mg           59.3    6e-07   
ref|XP_010461799.1|  PREDICTED: CDPK-related kinase 8                 59.3    7e-07   
ref|XP_010500502.1|  PREDICTED: CDPK-related kinase 8-like            59.3    8e-07   
gb|EMS60422.1|  Calcium/calmodulin-dependent serine/threonine-pro...  55.8    8e-07   
emb|CDP05003.1|  unnamed protein product                              57.0    9e-07   
ref|XP_010523557.1|  PREDICTED: CDPK-related kinase 4                 58.9    1e-06   
gb|AAN71903.1|  calcium/calmodulin protein kinase 1                   58.9    1e-06   
ref|XP_006286478.1|  hypothetical protein CARUB_v10000513mg           58.5    2e-06   
ref|XP_010035305.1|  PREDICTED: CDPK-related kinase 4 isoform X1      58.2    2e-06   
gb|EMT10573.1|  Calcium/calmodulin-dependent serine/threonine-pro...  57.8    2e-06   
gb|AFP55594.1|  serine/threonine protein kinase                       57.8    2e-06   
ref|XP_006347491.1|  PREDICTED: CDPK-related kinase 4-like            57.4    3e-06   
ref|XP_002464385.1|  hypothetical protein SORBIDRAFT_01g017320        57.4    3e-06   
emb|CDY27114.1|  BnaA08g07520D                                        53.9    3e-06   
ref|XP_008343806.1|  PREDICTED: CDPK-related kinase 4-like            56.6    5e-06   
ref|XP_010487837.1|  PREDICTED: CDPK-related kinase 2                 56.6    5e-06   
ref|XP_010666160.1|  PREDICTED: CDPK-related kinase 4-like isofor...  56.2    7e-06   
gb|EMS58490.1|  CDPK-related protein kinase                           56.2    8e-06   
ref|XP_009351934.1|  PREDICTED: CDPK-related kinase 4 isoform X1      56.2    9e-06   
ref|XP_009351935.1|  PREDICTED: CDPK-related kinase 4 isoform X2      55.8    9e-06   
ref|XP_010515289.1|  PREDICTED: CDPK-related kinase 6-like isofor...  56.2    9e-06   
ref|XP_010515287.1|  PREDICTED: CDPK-related kinase 6-like isofor...  55.8    1e-05   
gb|KFK27643.1|  hypothetical protein AALP_AA8G409900                  55.8    1e-05   
ref|XP_006290782.1|  hypothetical protein CARUB_v10016886mg           55.5    1e-05   
ref|XP_010426446.1|  PREDICTED: CDPK-related kinase 6-like            55.5    2e-05   
ref|XP_003602328.1|  Calcium dependent protein kinase-like protein    55.1    2e-05   
ref|XP_006409302.1|  hypothetical protein EUTSA_v10023098mg           53.9    3e-05   
gb|EMS67090.1|  hypothetical protein TRIUR3_17067                     51.2    3e-05   
ref|XP_009111629.1|  PREDICTED: CDPK-related kinase 4                 54.3    3e-05   
ref|XP_010503589.1|  PREDICTED: CDPK-related kinase 6 isoform X2      54.3    4e-05   
ref|XP_011043716.1|  PREDICTED: CDPK-related kinase 4-like            54.3    4e-05   
ref|XP_002317812.1|  calcium-dependent protein kinase                 53.9    4e-05   
gb|KFK27721.1|  hypothetical protein AALP_AA8G420900                  53.9    4e-05   
ref|XP_010036366.1|  PREDICTED: CDPK-related kinase 1-like isofor...  53.9    4e-05   
ref|XP_010503588.1|  PREDICTED: CDPK-related kinase 6 isoform X1      53.9    4e-05   
ref|XP_006441211.1|  hypothetical protein CICLE_v10019463mg           53.9    5e-05   
gb|KDO44243.1|  hypothetical protein CISIN_1g0080842mg                53.1    5e-05   
ref|XP_006493176.1|  PREDICTED: CDPK-related kinase 4-like            53.5    6e-05   
emb|CDY19836.1|  BnaA09g04890D                                        53.5    6e-05   
ref|XP_008437650.1|  PREDICTED: CDPK-related kinase 6-like            53.5    7e-05   
ref|XP_004309103.1|  PREDICTED: CDPK-related kinase 4-like            53.5    7e-05   
emb|CDX87128.1|  BnaC09g04430D                                        53.1    8e-05   
emb|CDX80445.1|  BnaC07g29990D                                        52.4    1e-04   
ref|XP_009150973.1|  PREDICTED: CDPK-related kinase 4-like            52.4    1e-04   
emb|CDX88104.1|  BnaA06g26950D                                        52.4    1e-04   
ref|XP_009361299.1|  PREDICTED: CDPK-related kinase 4-like            52.0    2e-04   
emb|CDY06943.1|  BnaA04g23720D                                        52.0    2e-04   
emb|CDY57585.1|  BnaC04g56870D                                        51.6    2e-04   
ref|XP_004145991.1|  PREDICTED: CDPK-related protein kinase-like      51.6    2e-04   
ref|XP_004160410.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...  51.6    2e-04   
ref|XP_008376799.1|  PREDICTED: CDPK-related kinase 4-like            51.2    4e-04   
ref|XP_002437591.1|  hypothetical protein SORBIDRAFT_10g030040        50.4    7e-04   



>ref|XP_006338215.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=610

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 127/178 (71%), Gaps = 14/178 (8%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG CTS+PS    ++ +D  T       +PVK  P+N E+ G  +QQ   KK E + G+K
Sbjct  1    MGACTSRPS----NYSDDSITVAGNRATLPVKATPNNNED-GNSHQQERTKKDEADVGKK  55

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHYLF+KKSP RSPANA S+++  R F R   PP   AKHIRAVLARRH
Sbjct  56   SPFFPFYSPSPAHYLFSKKSPLRSPANASSNSTPRRFFKRPFPPPSP-AKHIRAVLARRH  114

Query  575  GSVKPNGAAIPEGAESE--------GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            GSVKPN +AIPE  E+E         GLDKSFGFSK+FGNKYELGEEVGRGHFGYTC+
Sbjct  115  GSVKPNESAIPEVNETEVGGGGGGGAGLDKSFGFSKNFGNKYELGEEVGRGHFGYTCK  172



>ref|XP_009366775.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 123/174 (71%), Gaps = 14/174 (8%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDW--RNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGG  388
            MG+CTSKPSL    +  ++D    +   +P P         N  G  + R  +K E E  
Sbjct  1    MGLCTSKPSLNSHTFSPQSDSPPTKESSVPPP---------NAAGNGKNRRDEKAEEENV  51

Query  389  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLAR  568
            +KSPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHIRAVLAR
Sbjct  52   KKSPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFKRPFPPPSP-AKHIRAVLAR  110

Query  569  RHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            RHGSVKPN AAIPEG E+EG  GLDKSFGFSKHFGNKYE+GEEVGRGHFGYTC+
Sbjct  111  RHGSVKPNEAAIPEGGEAEGVNGLDKSFGFSKHFGNKYEMGEEVGRGHFGYTCK  164



>ref|XP_004232048.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=607

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 127/178 (71%), Gaps = 17/178 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG CTS+PS    ++  D   +R     +PVK  P+N E+ G  +QQ   KK E + G+K
Sbjct  1    MGACTSRPS----NYAGDSNGNRAT---LPVKSTPNNNED-GNSHQQERTKKDEADVGKK  52

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHYLF+KKSP RSPANA ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPLRSPANASTNSTPRRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  575  GSVKPNGAAIPEGAESE--------GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            GSVKPN +AIPE  E+E         GLDKSFGFSK+FGNKYELGEEVGRGHFGYTC+
Sbjct  112  GSVKPNESAIPEVNETEVGGGGGGGAGLDKSFGFSKNFGNKYELGEEVGRGHFGYTCK  169



>gb|KHG22049.1| CDPK-related protein kinase [Gossypium arboreum]
Length=617

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 115/183 (63%), Gaps = 19/183 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRD--------WRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKK  370
            MG+CTSKPS    D        W ND     N     P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTWNNDIHRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  371  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
                 G+KSPFFPFYSPSPA YLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NSNNEGKKSPFFPFYSPSPAQYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  551  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            RAVLARRHGSVKPN AAIPEG+E+E       GLDKSFGFSKHFG+KYELG+EVGRGHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSEAEAAGATGTGLDKSFGFSKHFGSKYELGDEVGRGHFG  175

Query  713  YTC  721
            YTC
Sbjct  176  YTC  178



>ref|XP_009366804.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 118/172 (69%), Gaps = 10/172 (6%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKPS   R       +       VP+     NGEN  GE       K E E  +K
Sbjct  1    MGLCTSKPSPNSRTHSPQSGSPITKESSVPLPSAAGNGENPSGE-------KAEEENVKK  53

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHIRAVLARRH
Sbjct  54   SPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  112

Query  575  GSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            GSVKPN AAIPEG E EG  GLDKSFGFSKH GNKYE+GEEVGRGHFGYTC+
Sbjct  113  GSVKPNQAAIPEGGEVEGPTGLDKSFGFSKHIGNKYEMGEEVGRGHFGYTCK  164



>emb|CDP02477.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 118/178 (66%), Gaps = 22/178 (12%)
 Frame = +2

Query  215  MGVCTSKPSLE---HRDWRNDQ*TDRNVGIPVPVKD--NPDNGENQGGENQQRNIKKG-E  376
            MGVCTSKPS E   H+D + +         P P KD  NP   ++ GG +  +   K  +
Sbjct  1    MGVCTSKPSPEPNLHQDSKQN---------PTPTKDKNNPAQVKDNGGNSSSQQESKKSD  51

Query  377  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRA  556
             E  +KSP FPFYSPSPAHYLF+KKSPARS AN+       R F          AKHI+A
Sbjct  52   AESAKKSPLFPFYSPSPAHYLFSKKSPARSSANSTPRRFFKRPFPPPSP-----AKHIKA  106

Query  557  VLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            VLA+RHGSVKPN A+IPEG ES+    LDKSFGFSKHFGNKYELGEEVGRGHFGYTC+
Sbjct  107  VLAKRHGSVKPNEASIPEGNESDTVAALDKSFGFSKHFGNKYELGEEVGRGHFGYTCK  164



>gb|KJB48534.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=575

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 116/183 (63%), Gaps = 19/183 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  370
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  371  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  551  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG+KYELG+EVGRGHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFGSKYELGDEVGRGHFG  175

Query  713  YTC  721
            YTC
Sbjct  176  YTC  178



>gb|KJB48531.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
 gb|KJB48532.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
 gb|KJB48533.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=573

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 116/183 (63%), Gaps = 19/183 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  370
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  371  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  551  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG+KYELG+EVGRGHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFGSKYELGDEVGRGHFG  175

Query  713  YTC  721
            YTC
Sbjct  176  YTC  178



>ref|XP_008338287.1| PREDICTED: CDPK-related kinase 5 [Malus domestica]
Length=602

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 120/174 (69%), Gaps = 14/174 (8%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDW--RNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGG  388
            MG+CTSKPSL    +  ++D    +   +P P         N  G    R  +K E E  
Sbjct  1    MGLCTSKPSLNSHTFSPQSDSPPTKESSVPPP---------NAAGNGGNRRDEKAEEENV  51

Query  389  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLAR  568
            +KSPFFPFYSPSPAHY F+KKSPARSP N  S+++  R F R   PP   AKHIRAVLAR
Sbjct  52   KKSPFFPFYSPSPAHYFFSKKSPARSPTNVSSNSTPKRFFKRPFPPPSP-AKHIRAVLAR  110

Query  569  RHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            RHGSVKPN AAIPEG E+E   GLDKSFGFSKHFGNKYE+GEEVGRGHFGYTC+
Sbjct  111  RHGSVKPNEAAIPEGGEAEAVTGLDKSFGFSKHFGNKYEMGEEVGRGHFGYTCK  164



>gb|KJB48530.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=610

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 116/183 (63%), Gaps = 19/183 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  370
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  371  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  551  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG+KYELG+EVGRGHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFGSKYELGDEVGRGHFG  175

Query  713  YTC  721
            YTC
Sbjct  176  YTC  178



>gb|AAZ83348.1| CDPK-related protein kinase [Gossypium hirsutum]
Length=617

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 116/183 (63%), Gaps = 19/183 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  370
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  371  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  551  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG+KYELG+EVGRGHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFGSKYELGDEVGRGHFG  175

Query  713  YTC  721
            YTC
Sbjct  176  YTC  178



>ref|XP_007204593.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
 gb|EMJ05792.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
Length=602

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 121/174 (70%), Gaps = 14/174 (8%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDW--RNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGG  388
            MG+CTSKPS        ++D    +   +  P  D P NGEN   +       K E E  
Sbjct  1    MGICTSKPSPNSHTSSPKSDSPQTKESSVKQP--DAPANGENPRDD-------KPEAENV  51

Query  389  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLAR  568
            +KSPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHIRAVL R
Sbjct  52   KKSPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFKRPFPPPSP-AKHIRAVLLR  110

Query  569  RHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            RHGSVKPN AAIPEG+E+E   GLDKSFGFSKHFGNKYELGEEVGRGHFGYTC+
Sbjct  111  RHGSVKPNEAAIPEGSEAEAATGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCK  164



>ref|XP_010103697.1| CDPK-related protein kinase [Morus notabilis]
 gb|EXB96709.1| CDPK-related protein kinase [Morus notabilis]
Length=603

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 122/174 (70%), Gaps = 15/174 (9%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIP---VPVKDNPDNGENQGGENQQRNIKKGEVEG  385
            MG+C SKPS ++    + Q  + N  +P   +PV DN          +   +++  E + 
Sbjct  1    MGLCVSKPS-QNSVLSDPQPANGNDPVPASHIPVSDN--------AASANGDVRSAESQN  51

Query  386  GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLA  565
            G+KSPFF FYSPSPAHYLF KKSPARSPANA S ++  R F R   PP   AKH++AVLA
Sbjct  52   GKKSPFFSFYSPSPAHYLFGKKSPARSPANASSISTPKRFFRRPFPPPSP-AKHLKAVLA  110

Query  566  RRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            RRHGSVKPN AAIPEG+E E G  LDKSFGFSKHFGNKYE+GEEVGRGHFGYTC
Sbjct  111  RRHGSVKPNEAAIPEGSEGEPGATLDKSFGFSKHFGNKYEMGEEVGRGHFGYTC  164



>ref|XP_010268648.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nelumbo nucifera]
Length=611

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 113/178 (63%), Gaps = 25/178 (14%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDW--RNDQ*TDRNVGIPVPVKDNPDNGENQ-GGENQQRNIK----KG  373
            MG+C S PS     +  R ++          PV++NP   EN   GEN+  N +      
Sbjct  1    MGLCHSTPSPRPNPYSIREEE----------PVQENPRPSENAVNGENEDHNQQQQQQNA  50

Query  374  EVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  553
            E E G+KSPFFPFYSPSPAHY F+KKSPA S  + P            P      AKHIR
Sbjct  51   EAEVGKKSPFFPFYSPSPAHYFFSKKSPAPSSNSTPKRFFKKPFPPPSP------AKHIR  104

Query  554  AVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            AVLARRHGSVKPN AAIPEG ESEG  GLDKSFGFSKHF +KYELG+EVGRGHFGYTC
Sbjct  105  AVLARRHGSVKPNEAAIPEGNESEGIAGLDKSFGFSKHFASKYELGDEVGRGHFGYTC  162



>ref|XP_010268657.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nelumbo nucifera]
Length=601

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 113/178 (63%), Gaps = 25/178 (14%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDW--RNDQ*TDRNVGIPVPVKDNPDNGENQ-GGENQQRNIK----KG  373
            MG+C S PS     +  R ++          PV++NP   EN   GEN+  N +      
Sbjct  1    MGLCHSTPSPRPNPYSIREEE----------PVQENPRPSENAVNGENEDHNQQQQQQNA  50

Query  374  EVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  553
            E E G+KSPFFPFYSPSPAHY F+KKSPA S  + P            P      AKHIR
Sbjct  51   EAEVGKKSPFFPFYSPSPAHYFFSKKSPAPSSNSTPKRFFKKPFPPPSP------AKHIR  104

Query  554  AVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            AVLARRHGSVKPN AAIPEG ESEG  GLDKSFGFSKHF +KYELG+EVGRGHFGYTC
Sbjct  105  AVLARRHGSVKPNEAAIPEGNESEGIAGLDKSFGFSKHFASKYELGDEVGRGHFGYTC  162



>ref|XP_008241522.1| PREDICTED: CDPK-related kinase 5 [Prunus mume]
Length=602

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 120/180 (67%), Gaps = 26/180 (14%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQ--------GGENQQRNIKK  370
            MG+CTSKPS              N     P  D+P   E+          GEN + +  K
Sbjct  1    MGICTSKPS-------------PNSHTSSPKSDSPQTKESSVKQPDASANGENPRDD--K  45

Query  371  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
             E E  +KSPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHI
Sbjct  46   PEAENVKKSPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFRRPFPPPSP-AKHI  104

Query  551  RAVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            RAVL RRHGSVKPN AAIPEG+E+E   GLDKSFGFSKHFGNKYELGEEVGRGHFGYTC+
Sbjct  105  RAVLLRRHGSVKPNEAAIPEGSEAEAATGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCK  164



>ref|XP_010550381.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Tarenaya hassleriana]
Length=614

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 132/177 (75%), Gaps = 9/177 (5%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVP--VKDNPDN---GENQGGENQQRNIKKGEV  379
            MG+CTSK         +D+   RN  +P    VK  P +   GEN   ++Q      G  
Sbjct  1    MGLCTSKSYPSPNSLNSDRNPARNSPVPASDSVKTPPSSSLHGENPSADDQCVENSGGHN  60

Query  380  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAV  559
            EG +KSPFFPFYSPSPAHY F+KK+PARSPA   S NSTP+RFF+RPFPPPSPAKHIRAV
Sbjct  61   EG-KKSPFFPFYSPSPAHYFFSKKTPARSPATTASGNSTPKRFFKRPFPPPSPAKHIRAV  119

Query  560  LARRHGSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            LARRHGSVKPNGAAIPEG+E++GG   LDKSFGFS++F +KYELG+EVGRGHFGYTC
Sbjct  120  LARRHGSVKPNGAAIPEGSEADGGGVGLDKSFGFSRNFSSKYELGDEVGRGHFGYTC  176



>ref|XP_010550380.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Tarenaya hassleriana]
Length=646

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 132/177 (75%), Gaps = 9/177 (5%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVP--VKDNPDN---GENQGGENQQRNIKKGEV  379
            MG+CTSK         +D+   RN  +P    VK  P +   GEN   ++Q      G  
Sbjct  1    MGLCTSKSYPSPNSLNSDRNPARNSPVPASDSVKTPPSSSLHGENPSADDQCVENSGGHN  60

Query  380  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAV  559
            EG +KSPFFPFYSPSPAHY F+KK+PARSPA   S NSTP+RFF+RPFPPPSPAKHIRAV
Sbjct  61   EG-KKSPFFPFYSPSPAHYFFSKKTPARSPATTASGNSTPKRFFKRPFPPPSPAKHIRAV  119

Query  560  LARRHGSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            LARRHGSVKPNGAAIPEG+E++GG   LDKSFGFS++F +KYELG+EVGRGHFGYTC
Sbjct  120  LARRHGSVKPNGAAIPEGSEADGGGVGLDKSFGFSRNFSSKYELGDEVGRGHFGYTC  176



>ref|XP_002306462.1| CROOKED family protein [Populus trichocarpa]
 gb|EEE93458.1| CROOKED family protein [Populus trichocarpa]
Length=607

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 113/173 (65%), Gaps = 7/173 (4%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKPS     +       ++  IP      PD        N   N  K  VE  +K
Sbjct  1    MGICTSKPSPNSTLFSPVAIQAKDNSIPTNDTAKPDPA--TASLNDHTN--KTTVEPVKK  56

Query  395  spffpfyspspAHYLFakksparspanapssnstprrff--rrpfpppspAKHIRAVLAR  568
            SP FPFYSPSPAH  F+KKS         ++++        +RPFPPPSPAKHIRAVLAR
Sbjct  57   SPLFPFYSPSPAHRFFSKKSSPARSPARNAASANSTPKRFFKRPFPPPSPAKHIRAVLAR  116

Query  569  RHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            RHGSVKPN AAIPEG+E+ G GLDKSFGFSKHFGNKYELG+EVGRGHFGYTC+
Sbjct  117  RHGSVKPNEAAIPEGSETGGEGLDKSFGFSKHFGNKYELGDEVGRGHFGYTCQ  169



>ref|XP_006425845.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 ref|XP_006425848.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39085.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39088.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=333

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 118/177 (67%), Gaps = 13/177 (7%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIP---VPVK-DNPDNGENQGGENQQRNIKKGE--  376
            MG+C SKPS      ++D   ++N  +P    P+   +P N E+Q   N+  N+K  +  
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAPSPLNAESQSNNNRT-NVKDNDDA  59

Query  377  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRA  556
            V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+A
Sbjct  60   VIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIKA  115

Query  557  VLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            VLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF NKYELGEEVGRGHFGYTC
Sbjct  116  VLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFANKYELGEEVGRGHFGYTC  172



>ref|XP_010268715.1| PREDICTED: CDPK-related kinase 5 [Nelumbo nucifera]
Length=609

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 112/184 (61%), Gaps = 29/184 (16%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGE---NQGGENQQRNIK------  367
            MG+CTSKPS      R D    R       V +NP   E   N G EN  +  +      
Sbjct  1    MGLCTSKPSP-----RPDLYASREEK---RVPENPKPSEVSVNGGNENHNQQQQHHHQQQ  52

Query  368  ----KGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppps  535
                K E E G+KSPFFPFYSPSPAHYLF+KKSPA S  + P            P     
Sbjct  53   RQQQKAEAEVGKKSPFFPFYSPSPAHYLFSKKSPAPSSNSTPRRFFKKPFPPPSP-----  107

Query  536  pAKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHF  709
             AKHIRAVLARRHGSVKPN AAIPEG ESE   GLDKSFGFSKHF +KYELG+EVGRGHF
Sbjct  108  -AKHIRAVLARRHGSVKPNEAAIPEGNESESIAGLDKSFGFSKHFASKYELGDEVGRGHF  166

Query  710  GYTC  721
            GYTC
Sbjct  167  GYTC  170



>gb|AAL30820.1|AF435452_1 calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana 
tabacum]
Length=602

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 117/176 (66%), Gaps = 18/176 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG CTSKPS    ++  D  T    G   PVK  P N ++    +Q +N    E   G+K
Sbjct  1    MGACTSKPS----NFSVDDITVAGDGAIFPVKSGPSNDDDVNS-HQTKN---DEPSVGKK  52

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHYLF+KKSPA + ++  +     +R F  P P    AKHIR++LARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPATNASSNSTPMRFFKRPFPPPSP----AKHIRSLLARRH  108

Query  575  GSVKPNGAAIPEGAESE------GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            G+VKPN +AIPEG ESE       GLDKSFGFSK+F NKYE+GEEVGRGHFGYTC+
Sbjct  109  GTVKPNESAIPEGNESEVGDGGGAGLDKSFGFSKNFVNKYEMGEEVGRGHFGYTCK  164



>ref|XP_009758726.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009758727.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nicotiana sylvestris]
Length=602

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 114/176 (65%), Gaps = 18/176 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG CTSKPS    ++  D  T    G   PVK  P N ++          KK E   G+K
Sbjct  1    MGACTSKPS----NFSVDDITVAGDGATFPVKSGPSNDDDVNSHQT----KKDEPSVGKK  52

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHYLF+KKSPA + ++  +     +R F  P P    AKHIR++LARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPATNASSNSTPMRFFKRPFPPPSP----AKHIRSLLARRH  108

Query  575  GSVKPNGAAIPEGAESE------GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            G+VKPN +AIPEG ESE       GLDKSFGFSK+F NKYE+G EVGRGHFGYTC+
Sbjct  109  GTVKPNESAIPEGNESEVGDGGGAGLDKSFGFSKNFVNKYEMGVEVGRGHFGYTCK  164



>gb|KHF98882.1| CDPK-related protein kinase [Gossypium arboreum]
Length=626

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 119/192 (62%), Gaps = 28/192 (15%)
 Frame = +2

Query  215  MGVCTSKPSLEHR---DWRNDQ*TDRNVGI-----PVPVKDNPD--NGENQGGENQQRNI  364
            MG+CTSKPS       D RN     RN  I      VP    PD  NG +    +Q +  
Sbjct  1    MGLCTSKPSPNPSFPPDSRNTPIHPRNKDIHHKSNSVPASPLPDVVNGNHNHNLDQAKGT  60

Query  365  KKGEVEG----GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp  532
            ++ E       G+KSPFFPFYSPSPAHYLF+KKSPARS AN+       + F        
Sbjct  61   EEKESSNSNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSANSTPKRFFRKPFPPPSP---  117

Query  533  spAKHIRAVLARRHGSVKPNGAAIPEGAESEGG---------LDKSFGFSKHFGNKYELG  685
              AKHIRAVLARRHGSVKPN +AIPEG+E++G          LDKSFGFSKHFG+KYELG
Sbjct  118  --AKHIRAVLARRHGSVKPNESAIPEGSEADGDGAAGATVAVLDKSFGFSKHFGSKYELG  175

Query  686  EEVGRGHFGYTC  721
            EEVGRGHFGYTC
Sbjct  176  EEVGRGHFGYTC  187



>gb|KDP31899.1| hypothetical protein JCGZ_12360 [Jatropha curcas]
Length=630

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 112/159 (70%), Gaps = 17/159 (11%)
 Frame = +2

Query  299  VPVKD--NPDN-----GENQGGENQQ-------RNIKKGEVEGGRKspffpfyspspAHY  436
            +P KD   PD+     GEN   E+Q+       R  +K  +E  +KSPFF FYSPSPAHY
Sbjct  34   IPPKDGLKPDSSTGNGGENPSNEDQKEKEKENSRKDEKTALETVKKSPFFSFYSPSPAHY  93

Query  437  LFakksparspanapssnstprrff--rrpfpppspAKHIRAVLARRHGSVKPNGAAIPE  610
             F+KKS         ++++        +RPFPPPSPAKHIRAVLARRHGSVKPN AAIPE
Sbjct  94   FFSKKSSPARSPATNAASANSTPKRFFKRPFPPPSPAKHIRAVLARRHGSVKPNEAAIPE  153

Query  611  GAESE-GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            G+E+E  GLDKSFGFSKHFGNKYELG+EVGRGHFGYTC+
Sbjct  154  GSEAEVAGLDKSFGFSKHFGNKYELGDEVGRGHFGYTCQ  192



>ref|XP_006425847.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39087.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=455

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = +2

Query  290  GIPVPVKDNPDNGENQGGENQQRNIKKGE--VEGGRKspffpfyspspAHYLFakkspar  463
            G P+P   +P N E+Q   N+  N+K  +  V  G+KSPFFPFYSPSPAHY F+KKS   
Sbjct  31   GTPIPAP-SPLNAESQSNNNRT-NVKDNDDAVIEGKKSPFFPFYSPSPAHYFFSKKSSPA  88

Query  464  spanapssnstprrffrrpfpppspAKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLD  637
              +   + N   +R F  P P    AKHI+AVLARRHGSVKPN AAIPEG+E E   GL+
Sbjct  89   RSSANSTPNRFFKRPFPPPSP----AKHIKAVLARRHGSVKPNEAAIPEGSEPEPAAGLN  144

Query  638  KSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            KSFGFSKHF NKYELGEEVGRGHFGYTC
Sbjct  145  KSFGFSKHFANKYELGEEVGRGHFGYTC  172



>ref|XP_006425846.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39086.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=429

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = +2

Query  290  GIPVPVKDNPDNGENQGGENQQRNIKKGE--VEGGRKspffpfyspspAHYLFakkspar  463
            G P+P   +P N E+Q   N+  N+K  +  V  G+KSPFFPFYSPSPAHY F+KKS   
Sbjct  31   GTPIPAP-SPLNAESQSNNNRT-NVKDNDDAVIEGKKSPFFPFYSPSPAHYFFSKKSSPA  88

Query  464  spanapssnstprrffrrpfpppspAKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLD  637
              +   + N   +R F  P P    AKHI+AVLARRHGSVKPN AAIPEG+E E   GL+
Sbjct  89   RSSANSTPNRFFKRPFPPPSP----AKHIKAVLARRHGSVKPNEAAIPEGSEPEPAAGLN  144

Query  638  KSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            KSFGFSKHF NKYELGEEVGRGHFGYTC
Sbjct  145  KSFGFSKHFANKYELGEEVGRGHFGYTC  172



>ref|XP_006290766.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23664.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 124/172 (72%), Gaps = 8/172 (5%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKP+  +    +DQ   RN  +P      P      GG   +        EG +K
Sbjct  1    MGLCTSKPNSPN----SDQIPARNSPLPASESVKPSTSSVNGGNPVEDQCVVASNEG-KK  55

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAH  F+KK+P RSPA   S NSTP+RFF+RPFPPPSPAKHIRAVLARRH
Sbjct  56   SPFFPFYSPSPAHSFFSKKTPGRSPATNASGNSTPKRFFKRPFPPPSPAKHIRAVLARRH  115

Query  575  GSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            GSVKPN AAIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  116  GSVKPNSAAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  167



>ref|XP_006290767.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23665.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 124/172 (72%), Gaps = 8/172 (5%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKP+  +    +DQ   RN  +P      P      GG   +        EG +K
Sbjct  1    MGLCTSKPNSPN----SDQIPARNSPLPASESVKPSTSSVNGGNPVEDQCVVASNEG-KK  55

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAH  F+KK+P RSPA   S NSTP+RFF+RPFPPPSPAKHIRAVLARRH
Sbjct  56   SPFFPFYSPSPAHSFFSKKTPGRSPATNASGNSTPKRFFKRPFPPPSPAKHIRAVLARRH  115

Query  575  GSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            GSVKPN AAIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  116  GSVKPNSAAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  167



>gb|KDO79302.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=429

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 117/177 (66%), Gaps = 13/177 (7%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIP---VPVK-DNPDNGENQGGENQQRNIK--KGE  376
            MG+C SKPS      ++D   ++N  +P    P+   +P N E+Q   N+  N+K     
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAPSPLNAESQSNNNRT-NVKGNDDA  59

Query  377  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRA  556
            V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+A
Sbjct  60   VIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIKA  115

Query  557  VLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            VLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF NKYELGEEVGRGHFGYTC
Sbjct  116  VLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFANKYELGEEVGRGHFGYTC  172



>gb|KDO79301.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=455

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 103/148 (70%), Gaps = 10/148 (7%)
 Frame = +2

Query  290  GIPVPVKDNPDNGENQGGENQQRNIK--KGEVEGGRKspffpfyspspAHYLFakkspar  463
            G P+P   +P N E+Q   N+  N+K     V  G+KSPFFPFYSPSPAHY F+KKS   
Sbjct  31   GTPIPAP-SPLNAESQSNNNRT-NVKGNDDAVIEGKKSPFFPFYSPSPAHYFFSKKSSPA  88

Query  464  spanapssnstprrffrrpfpppspAKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLD  637
              +   + N   +R F  P P    AKHI+AVLARRHGSVKPN AAIPEG+E E   GL+
Sbjct  89   RSSANSTPNRFFKRPFPPPSP----AKHIKAVLARRHGSVKPNEAAIPEGSEPEPAAGLN  144

Query  638  KSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            KSFGFSKHF NKYELGEEVGRGHFGYTC
Sbjct  145  KSFGFSKHFANKYELGEEVGRGHFGYTC  172



>ref|XP_002876036.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52295.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 119/174 (68%), Gaps = 20/174 (11%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVP--VKDNPDNGENQGGENQQRNIKKGEVEGG  388
            MG+CTSKP+  +    +DQ   RN  +P    VK +  N +     N +          G
Sbjct  1    MGLCTSKPNSPN----SDQIPARNSPLPASESVKPSSSNEDQCVTTNNE----------G  46

Query  389  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLAR  568
            +KSPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLAR
Sbjct  47   KKSPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLAR  105

Query  569  RHGSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            RHGSVKPN AAIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  106  RHGSVKPNSAAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  159



>ref|XP_006425849.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 ref|XP_006466639.1| PREDICTED: CDPK-related kinase 5-like [Citrus sinensis]
 gb|ESR39089.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=611

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = +2

Query  290  GIPVPVKDNPDNGENQGGENQQRNIKKGE--VEGGRKspffpfyspspAHYLFakkspar  463
            G P+P   +P N E+Q   N+  N+K  +  V  G+KSPFFPFYSPSPAHY F+KKS   
Sbjct  31   GTPIPAP-SPLNAESQSNNNRT-NVKDNDDAVIEGKKSPFFPFYSPSPAHYFFSKKSSPA  88

Query  464  spanapssnstprrffrrpfpppspAKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLD  637
              +   + N   +R F  P P    AKHI+AVLARRHGSVKPN AAIPEG+E E   GL+
Sbjct  89   RSSANSTPNRFFKRPFPPPSP----AKHIKAVLARRHGSVKPNEAAIPEGSEPEPAAGLN  144

Query  638  KSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            KSFGFSKHF NKYELGEEVGRGHFGYTC
Sbjct  145  KSFGFSKHFANKYELGEEVGRGHFGYTC  172



>ref|XP_002310736.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
 gb|EEE91186.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
Length=606

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 105/178 (59%), Gaps = 18/178 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGI-----PVPVKDNPDNGENQGGENQQRNIKKGEV  379
            MG+CTSKPS               + I      +P KD P         N Q N    E 
Sbjct  1    MGICTSKPSPNST-------LSSPIAIQANDNSIPTKDTPRPDPRTPNVNDQNNSTGLE-  52

Query  380  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffr--rpfpppspAKHIR  553
                K   F F+SPSPAHY F+KKS         ++++         RPFPPPSPAKHIR
Sbjct  53   --SVKKSPFNFFSPSPAHYFFSKKSSPARSPARNAASANSTPKRLFKRPFPPPSPAKHIR  110

Query  554  AVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            AVLARRHGSVKPN A IPEG E+E  GL KSFGFSKHFGNKYELG+EVGRGHFGYTC+
Sbjct  111  AVLARRHGSVKPNEATIPEGGEAEAAGLVKSFGFSKHFGNKYELGDEVGRGHFGYTCQ  168



>ref|XP_011007668.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=607

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 116/180 (64%), Gaps = 21/180 (12%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPV--KDN--PDN---GENQGGENQQRNIKKG  373
            MG+CTSKPS            +  +  PV +  KDN  P N     +    +   + KK 
Sbjct  1    MGICTSKPS-----------PNSTLSSPVAIQAKDNSIPTNETAKPDPTTASLNDHTKKT  49

Query  374  EVEGGRKspffpfyspspAHYLFakksparspanapssnstprrff--rrpfpppspAKH  547
             VE  +KSP FPFYSPSPAH  F+KK          ++++        +RPFPPPSPAKH
Sbjct  50   TVEPVKKSPLFPFYSPSPAHRFFSKKPSPARSPARNAASANSTPKRFFKRPFPPPSPAKH  109

Query  548  IRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            IRAVLARRHGSVKPN AAIPEG+E+ G GLDKSFGFSKHFG+ YELG+EVGRGHFGYTC+
Sbjct  110  IRAVLARRHGSVKPNEAAIPEGSEAGGEGLDKSFGFSKHFGSNYELGDEVGRGHFGYTCQ  169



>gb|KDO79300.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=611

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 103/148 (70%), Gaps = 10/148 (7%)
 Frame = +2

Query  290  GIPVPVKDNPDNGENQGGENQQRNIK--KGEVEGGRKspffpfyspspAHYLFakkspar  463
            G P+P   +P N E+Q   N+  N+K     V  G+KSPFFPFYSPSPAHY F+KKS   
Sbjct  31   GTPIPAP-SPLNAESQSNNNRT-NVKGNDDAVIEGKKSPFFPFYSPSPAHYFFSKKSSPA  88

Query  464  spanapssnstprrffrrpfpppspAKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLD  637
              +   + N   +R F  P P    AKHI+AVLARRHGSVKPN AAIPEG+E E   GL+
Sbjct  89   RSSANSTPNRFFKRPFPPPSP----AKHIKAVLARRHGSVKPNEAAIPEGSEPEPAAGLN  144

Query  638  KSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            KSFGFSKHF NKYELGEEVGRGHFGYTC
Sbjct  145  KSFGFSKHFANKYELGEEVGRGHFGYTC  172



>ref|XP_011039202.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=606

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 106/178 (60%), Gaps = 18/178 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGI-----PVPVKDNPDNGENQGGENQQRNIKKGEV  379
            MG+CTSKPS        +      + I      +P KD P         N Q N    E 
Sbjct  1    MGICTSKPS-------PNSTLSSPIAIQAKDNSIPTKDTPRPDPRTPNVNDQNNSTGLE-  52

Query  380  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffr--rpfpppspAKHIR  553
                K   F FYSPSPAHY F+KKS         ++++         RPFPPPSPAKHIR
Sbjct  53   --SVKKSPFNFYSPSPAHYFFSKKSSPARSPARNATSANSTPKRLFKRPFPPPSPAKHIR  110

Query  554  AVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            AVLARRHGSVKPN A IPEG E+E  G+ KSFGFSKHFGNKYELG+EVGRGHFGYTC+
Sbjct  111  AVLARRHGSVKPNEATIPEGGEAEAAGVVKSFGFSKHFGNKYELGDEVGRGHFGYTCQ  168



>gb|KJB43647.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=591

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 118/192 (61%), Gaps = 28/192 (15%)
 Frame = +2

Query  215  MGVCTSKPSLEHR---DWRNDQ*TDRNVGI-----PVPVKDNPD--NGENQGGENQQRNI  364
            MG+CTSKPS       D RN     RN  I      VP    PD  NG      +Q +  
Sbjct  1    MGLCTSKPSPNPSFPPDSRNTPIHPRNKDIHHNSNSVPASPLPDVVNGNRNHNLDQAKGT  60

Query  365  KKGEVEG----GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp  532
            ++ E       G+KSPFFPFYSPSPAHYLF+KKSPARS AN+       + F        
Sbjct  61   EEKESSNSNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSANSTPKRFFRKPFPPPSP---  117

Query  533  spAKHIRAVLARRHGSVKPNGAAIPEGAESEGG---------LDKSFGFSKHFGNKYELG  685
              AKHIRAVLARRHGSVKPN +AIPEG+E++G          LDKSFGFSKHFG+KYELG
Sbjct  118  --AKHIRAVLARRHGSVKPNESAIPEGSEADGDGAAGATGAGLDKSFGFSKHFGSKYELG  175

Query  686  EEVGRGHFGYTC  721
            EEVGRGHFGYTC
Sbjct  176  EEVGRGHFGYTC  187



>gb|KJB43646.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=626

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 118/192 (61%), Gaps = 28/192 (15%)
 Frame = +2

Query  215  MGVCTSKPSLEHR---DWRNDQ*TDRNVGI-----PVPVKDNPD--NGENQGGENQQRNI  364
            MG+CTSKPS       D RN     RN  I      VP    PD  NG      +Q +  
Sbjct  1    MGLCTSKPSPNPSFPPDSRNTPIHPRNKDIHHNSNSVPASPLPDVVNGNRNHNLDQAKGT  60

Query  365  KKGEVEG----GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp  532
            ++ E       G+KSPFFPFYSPSPAHYLF+KKSPARS AN+       + F        
Sbjct  61   EEKESSNSNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSANSTPKRFFRKPFPPPSP---  117

Query  533  spAKHIRAVLARRHGSVKPNGAAIPEGAESEGG---------LDKSFGFSKHFGNKYELG  685
              AKHIRAVLARRHGSVKPN +AIPEG+E++G          LDKSFGFSKHFG+KYELG
Sbjct  118  --AKHIRAVLARRHGSVKPNESAIPEGSEADGDGAAGATGAGLDKSFGFSKHFGSKYELG  175

Query  686  EEVGRGHFGYTC  721
            EEVGRGHFGYTC
Sbjct  176  EEVGRGHFGYTC  187



>ref|XP_002522315.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF39999.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=467

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 58/65 (89%), Gaps = 3/65 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEG---AESEGGLDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIRAVLARRHGSVKPN AAIPEG   A+   GLDKSFGFSKHFGNKYELG+EVGRGHF
Sbjct  128  AKHIRAVLARRHGSVKPNEAAIPEGSEGADMATGLDKSFGFSKHFGNKYELGDEVGRGHF  187

Query  710  GYTCR  724
            GYTC+
Sbjct  188  GYTCK  192



>ref|XP_010558347.1| PREDICTED: CDPK-related kinase 5-like [Tarenaya hassleriana]
Length=615

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 132/177 (75%), Gaps = 9/177 (5%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVP--VKDNPDN---GENQGGENQQRNIKKGEV  379
            MG+CTSK         +D+   RN  +P    VK  P +   GEN  G++Q      G  
Sbjct  1    MGLCTSKSHPSPNSPNSDRNPYRNSPLPASDSVKTPPSSSLHGENPSGDDQCVENGGGRN  60

Query  380  EGGRKspffpfyspspAHYLFakksparspanapss-nstprrffrrpfpppspAKHIRA  556
            EG +KSPFFPFYSPSPAHY F+KK+PARSPA   +S NSTP+RFF+RPFPPPSPAKHIRA
Sbjct  61   EG-KKSPFFPFYSPSPAHYFFSKKTPARSPAKNAASGNSTPKRFFKRPFPPPSPAKHIRA  119

Query  557  VLARRHGSVKPNGAAIPEGAE--SEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            VLARRHGSVKPNGAAIPEG+E  S  GLDK+FGFSK+F +KYELG+EVGRGHFGYTC
Sbjct  120  VLARRHGSVKPNGAAIPEGSEAGSGVGLDKNFGFSKNFSSKYELGDEVGRGHFGYTC  176



>gb|AAL30814.1|AF435446_1 calcium/calmodulin-dependent protein kinase CaMK1 [Arabidopsis 
thaliana]
 emb|CAA70572.1| CDPK-related protein kinase [Arabidopsis thaliana]
Length=601

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 119/172 (69%), Gaps = 12/172 (7%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKP+  +    +DQ   RN  +P        +  +  GE+Q       E   G+K
Sbjct  1    MGLCTSKPNSSN----SDQTPARNSPLPASESVK-PSSSSVNGEDQCVTTTNNE---GKK  52

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  575  GSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            GSVKPN +AIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  112  GSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  163



>ref|NP_190622.1| CDPK-related kinase [Arabidopsis thaliana]
 sp|Q9SCS2.1|CAMK5_ARATH RecName: Full=CDPK-related kinase 5; Short=AtCRK5; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 1 [Arabidopsis 
thaliana]
 emb|CAB62482.1| CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AEE78676.1| CDPK-related kinase [Arabidopsis thaliana]
Length=601

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 119/172 (69%), Gaps = 12/172 (7%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKP+  +    +DQ   RN  +P        +  +  GE+Q       E   G+K
Sbjct  1    MGLCTSKPNSSN----SDQTPARNSPLPASESVK-PSSSSVNGEDQCVTTTNNE---GKK  52

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  575  GSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            GSVKPN +AIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  112  GSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  163



>ref|XP_004511959.1| PREDICTED: CDPK-related kinase 5-like [Cicer arietinum]
Length=587

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 105/171 (61%), Gaps = 24/171 (14%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKPS       N   + R     +P    P++  +Q   N        E E G +
Sbjct  1    MGLCTSKPS------SNPTHSSRKFNTELP---QPNSVTSQPLTNSVNGQNPNETENGNR  51

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAH  F+K SPAR     P    +P             AKHIR++LARRH
Sbjct  52   SPFFPFYSPSPAHNFFSKMSPARKFFKKPFPPPSP-------------AKHIRSLLARRH  98

Query  575  GSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            GSVKPN A+IPEGAE+E    LDK+FGFSKHFGNKY++G+EVGRGHFGYTC
Sbjct  99   GSVKPNEASIPEGAEAEPVAALDKNFGFSKHFGNKYDVGDEVGRGHFGYTC  149



>gb|EMS61574.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Triticum urartu]
Length=903

 Score =   115 bits (288),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/60 (85%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  542  KHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            +HIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF  KYELGEEVGRGHFGYTC
Sbjct  21   RHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHFFAKYELGEEVGRGHFGYTC  80



>ref|NP_001190048.1| CDPK-related kinase [Arabidopsis thaliana]
 gb|AEE78677.1| CDPK-related kinase [Arabidopsis thaliana]
Length=632

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 119/172 (69%), Gaps = 12/172 (7%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKP+  +    +DQ   RN  +P        +  +  GE+Q       E   G+K
Sbjct  1    MGLCTSKPNSSN----SDQTPARNSPLPASESVK-PSSSSVNGEDQCVTTTNNE---GKK  52

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  575  GSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            GSVKPN +AIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  112  GSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  163



>ref|XP_006829951.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
 gb|ERM97367.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
Length=606

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRAVLARRHGSVKPN AAIPEG E+E  LDKSFGFSKHF +KY+LGEEVGRGHFGYT
Sbjct  106  AKHIRAVLARRHGSVKPNEAAIPEGREAEVTLDKSFGFSKHFSSKYDLGEEVGRGHFGYT  165

Query  719  C  721
            C
Sbjct  166  C  166



>gb|EYU44373.1| hypothetical protein MIMGU_mgv1a003006mg [Erythranthe guttata]
Length=616

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 119/181 (66%), Gaps = 14/181 (8%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGEN---------QGGENQQRNIK  367
            MG+CTSKP    +   +     +  G+ +  K+N  + EN           G  +++   
Sbjct  1    MGICTSKPKSSPKPNFHSSDEIKPAGVRIQDKENTVSSENGNNNDGNATSSGNFEEKKRS  60

Query  368  KGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKH  547
            +G  EGG+KSPFFPFYSPSPAHYLF+KKSPARSPA    +     +    P  P   AKH
Sbjct  61   EGNHEGGKKSPFFPFYSPSPAHYLFSKKSPARSPAPGSGTPRRFFKRPFPPPSP---AKH  117

Query  548  IRAVLARRHGSVKPNGAAIPEGAE-SEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            I+AVLARRHGSVKPN AAIPEG E S+G GLD+SFGFSK F +KYELGEEVGRGHFGYTC
Sbjct  118  IKAVLARRHGSVKPNEAAIPEGKEVSDGAGLDRSFGFSKKFYDKYELGEEVGRGHFGYTC  177

Query  722  R  724
            R
Sbjct  178  R  178



>ref|XP_002262855.3| PREDICTED: CDPK-related kinase 5 [Vitis vinifera]
Length=602

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 100/122 (82%), Gaps = 4/122 (3%)
 Frame = +2

Query  365  KKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAK  544
            ++ EVE G+KSPFFPFYSPSPAHYLF+KKSPARSPAN  S+++  R F R   PP   AK
Sbjct  44   RREEVEAGKKSPFFPFYSPSPAHYLFSKKSPARSPANLSSNSTPKRFFKRPFPPPSP-AK  102

Query  545  HIRAVLARRHGSVKPNGAAIPEG---AESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            HIRA LARRHGSVKPN AAIPEG   AE   GLDKSFGFSKHFGNKYE+GEEVGRGHFGY
Sbjct  103  HIRAALARRHGSVKPNEAAIPEGNEAAEGVAGLDKSFGFSKHFGNKYEIGEEVGRGHFGY  162

Query  716  TC  721
            TC
Sbjct  163  TC  164



>ref|XP_004142011.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 ref|XP_004167564.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN48509.1| hypothetical protein Csa_6G490240 [Cucumis sativus]
Length=604

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 119/181 (66%), Gaps = 25/181 (14%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKD----------NPDNGENQGGENQQRNI  364
            MG+C SKPS           +   V +P  ++D          +PD G N+  E ++ + 
Sbjct  1    MGLCVSKPS-----------STTVVAVPA-IQDALPPLETSLPSPDAG-NRTTETREGDK  47

Query  365  KKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAK  544
               ++E  +KSP+FP ++PSPAHYLF+KKSP RSPAN  S+++  R F +   PP   AK
Sbjct  48   TPFDLEVAKKSPYFPLFTPSPAHYLFSKKSPLRSPANVSSNSTPKRFFKKPFPPPSP-AK  106

Query  545  HIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            HI AVLARRHGSVKPN A+IPEG   EG GLDKSFGFSKHF NKYEL EEVG+GHFG+TC
Sbjct  107  HIMAVLARRHGSVKPNEASIPEGNVIEGPGLDKSFGFSKHFRNKYELAEEVGKGHFGHTC  166

Query  722  R  724
            R
Sbjct  167  R  167



>emb|CAN74933.1| hypothetical protein VITISV_044433 [Vitis vinifera]
Length=606

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 99/122 (81%), Gaps = 4/122 (3%)
 Frame = +2

Query  365  KKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAK  544
            ++ EVE G+KSPFFPFYSPSPAHYLF+KKSPAR PAN  S+++  R F R   PP   AK
Sbjct  44   RREEVEAGKKSPFFPFYSPSPAHYLFSKKSPARXPANLSSNSTPKRFFKRPFPPPSP-AK  102

Query  545  HIRAVLARRHGSVKPNGAAIPEG---AESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            HIRA LARRHGSVKPN AAIPEG   AE   GLDKSFGFSKHFGNKYE+GEEVGRGHFGY
Sbjct  103  HIRAALARRHGSVKPNEAAIPEGNEAAEGVAGLDKSFGFSKHFGNKYEIGEEVGRGHFGY  162

Query  716  TC  721
            TC
Sbjct  163  TC  164



>gb|EYU39405.1| hypothetical protein MIMGU_mgv1a0043832mg, partial [Erythranthe 
guttata]
Length=371

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 113/173 (65%), Gaps = 12/173 (7%)
 Frame = +2

Query  215  MGVCTSKP-SLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGR  391
            MGVCTSKP + +  D+ +       V      K+NP    N G EN ++N      + G+
Sbjct  1    MGVCTSKPKTSQELDFNSSGEIKPEVNSIDDGKENPAQSAN-GAENAKKND-----DVGK  54

Query  392  KspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARR  571
            KSPFFPFYSPSPAHY F+KKSPARSPA    +     +    P  P   AKHIRAVLARR
Sbjct  55   KSPFFPFYSPSPAHYFFSKKSPARSPAPTSGTPRRFFKRPFPPPSP---AKHIRAVLARR  111

Query  572  HGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            HGSVKPN AAIPEG E     GLDKSFGF+K+  +KYELGEEVGRGHFGYTC+
Sbjct  112  HGSVKPNEAAIPEGKEVADGNGLDKSFGFTKNLSSKYELGEEVGRGHFGYTCK  164



>ref|XP_003562581.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Brachypodium distachyon]
Length=596

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF  KYELGEEVGRGHFGYT
Sbjct  98   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHFFVKYELGEEVGRGHFGYT  157

Query  719  C  721
            C
Sbjct  158  C  158



>emb|CDP18369.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 95/175 (54%), Gaps = 47/175 (27%)
 Frame = +2

Query  215  MGVCTSKPSLE---HRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEG  385
            MG+CTSKPS E   H+D + +         P+P KD          +N    +K      
Sbjct  1    MGICTSKPSPEPNLHQDSKQN---------PIPTKD----------KNNPAQVK------  35

Query  386  GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLA  565
                          AHYL  KKSPARS  N+ S     R F          AKH +AVLA
Sbjct  36   ------------DKAHYLICKKSPARSSVNSTSKRFFKRPFPPPSP-----AKHNKAVLA  78

Query  566  RRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            +RHG VKPN A+I EG ESE    LDK+FGFSKHFGNKYELGEEVGRGHFGYTC+
Sbjct  79   KRHGFVKPNEASISEGNESEMVAALDKNFGFSKHFGNKYELGEEVGRGHFGYTCK  133



>ref|XP_008457867.1| PREDICTED: CDPK-related kinase 5-like [Cucumis melo]
Length=622

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRAVLARRHGSVKPN  +IPEG+E+EG  GLDK+FGFSKH G+KYELGEEVGRGHFG
Sbjct  121  AKHIRAVLARRHGSVKPNEVSIPEGSEAEGVTGLDKNFGFSKHLGSKYELGEEVGRGHFG  180

Query  713  YTC  721
            YTC
Sbjct  181  YTC  183



>ref|XP_008668263.1| PREDICTED: uncharacterized LOC100381527 isoform X1 [Zea mays]
 tpg|DAA41584.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA41585.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea 
mays]
Length=592

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF  KY+LGEEVGRGHFGYT
Sbjct  94   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHFFAKYDLGEEVGRGHFGYT  153

Query  719  C  721
            C
Sbjct  154  C  154



>ref|XP_004148051.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN62050.1| hypothetical protein Csa_2G292800 [Cucumis sativus]
Length=621

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRAVLARRHGSVKPN  +IPEG E+EG  GLDK+FGFSKH G+KYELGEEVGRGHFG
Sbjct  120  AKHIRAVLARRHGSVKPNEVSIPEGTEAEGVTGLDKNFGFSKHLGSKYELGEEVGRGHFG  179

Query  713  YTC  721
            YTC
Sbjct  180  YTC  182



>gb|EAZ16167.1| hypothetical protein OsJ_31616 [Oryza sativa Japonica Group]
Length=212

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG E+E GLDK FGFSKHF  KYELG+EVGRGHFGYT
Sbjct  97   AKHIRALLARRHGSVKPNEAPIPEGGETEVGLDKGFGFSKHFFAKYELGDEVGRGHFGYT  156

Query  719  C  721
            C
Sbjct  157  C  157



>ref|XP_010515424.1| PREDICTED: CDPK-related kinase 5 [Camelina sativa]
Length=606

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIRAVLARRHGSVKPN +AIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHF
Sbjct  105  AKHIRAVLARRHGSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHF  164

Query  710  GYTC  721
            GYTC
Sbjct  165  GYTC  168



>ref|XP_004958484.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Setaria italica]
Length=592

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF  KY+LGEEVGRGHFGYT
Sbjct  94   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHFFAKYDLGEEVGRGHFGYT  153

Query  719  C  721
            C
Sbjct  154  C  154



>ref|XP_004288057.1| PREDICTED: CDPK-related kinase 5 [Fragaria vesca subsp. vesca]
Length=614

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 120/179 (67%), Gaps = 12/179 (7%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQ------RNIKKGE  376
            MG+CTSKP+  H    + Q +D  VG     ++N  + + +   N+          ++  
Sbjct  1    MGLCTSKPAFPHSTTSSPQ-SDSQVGKDPAKENNSSSADVENPRNEHNGEEKLGGGEEET  59

Query  377  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRA  556
            V   +KSPFFPFYSPSPAHY F+ K          S+ STP RFF+RPFPPPSPAKHIRA
Sbjct  60   VIAVKKSPFFPFYSPSPAHY-FSSKKSPARSPANASAKSTPNRFFKRPFPPPSPAKHIRA  118

Query  557  VLARRHGSVKPNGAAIPEGAESEGGL---DKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            +LARRHG+VKPN  AIPEG+E EGGL   DKSFGFSKH  NKYELGEEVGRGHFGYTC+
Sbjct  119  LLARRHGTVKPN-EAIPEGSEVEGGLTGLDKSFGFSKHLSNKYELGEEVGRGHFGYTCK  176



>ref|XP_011085503.1| PREDICTED: CDPK-related protein kinase-like [Sesamum indicum]
Length=613

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 123/180 (68%), Gaps = 15/180 (8%)
 Frame = +2

Query  215  MGVCTSKP--SLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQR-NI---KKGE  376
            MGVCTSKP  S EH ++ + +    +V +P   +DNP   +  GG  +   N+   KK E
Sbjct  1    MGVCTSKPRPSSEH-NFHSSEEIKPSV-VPGQDEDNPVGLKTNGGNARDSGNLGEKKKNE  58

Query  377  V--EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
               E G+KSPFFPFYSPSPAHYLF+KKSPARSPA    +     +    P  P   AKHI
Sbjct  59   ENHEVGKKSPFFPFYSPSPAHYLFSKKSPARSPAPGSGTPRRFFKKPFPPPSP---AKHI  115

Query  551  RAVLARRHGSVKPNGAAIPEGAE--SEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            +AVLARRHGSVKPN AAIPEG E   + GLDKSFGFSK+F +KYELGEEVGRGHFGYTC+
Sbjct  116  KAVLARRHGSVKPNEAAIPEGKEVAEKTGLDKSFGFSKNFYSKYELGEEVGRGHFGYTCK  175



>ref|XP_010503722.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=606

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 128/175 (73%), Gaps = 13/175 (7%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGE--NQQRNIKKGEVEGG  388
            MG+CTSKP+  +    +DQ   RN  +P      P +    GG     Q  +   E   G
Sbjct  1    MGLCTSKPNSPN----SDQTPARNSPLPASESVKPSSSSVNGGNPVEDQSVVASNE---G  53

Query  389  RKspffpfyspspAHYLFakksparspanapss-nstprrffrrpfpppspAKHIRAVLA  565
            +KSPFFPFYSPSPAH  F+KK+PARSPA   SS NSTP+RFF+RPFPPPSPAKHIRA+LA
Sbjct  54   KKSPFFPFYSPSPAHSFFSKKTPARSPATNASSGNSTPKRFFKRPFPPPSPAKHIRALLA  113

Query  566  RRHGSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            RRHGSVKPN +AIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  114  RRHGSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  168



>ref|XP_010112837.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Morus notabilis]
 gb|EXC34960.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Morus notabilis]
Length=618

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A+IPEG+E + GLDK+FGFSKHFG  YELGEEVGRGHFGYT
Sbjct  82   AKHIRALLARRHGSIKPNEASIPEGSECDVGLDKNFGFSKHFGAHYELGEEVGRGHFGYT  141

Query  719  C  721
            C
Sbjct  142  C  142



>ref|XP_009115721.1| PREDICTED: CDPK-related kinase 5 [Brassica rapa]
Length=594

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRAVLARRHGSVKPN AAIPEG E+EG GLDKSFGFSK F +KYE+G+EVGRGHFGY
Sbjct  95   AKHIRAVLARRHGSVKPNSAAIPEGGEAEGVGLDKSFGFSKSFASKYEVGDEVGRGHFGY  154

Query  716  TC  721
            TC
Sbjct  155  TC  156



>emb|CDY52824.1| BnaAnng11710D [Brassica napus]
Length=594

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRAVLARRHGSVKPN AAIPEG E+EG GLDKSFGFSK F +KYE+G+EVGRGHFGY
Sbjct  95   AKHIRAVLARRHGSVKPNSAAIPEGGEAEGVGLDKSFGFSKSFASKYEVGDEVGRGHFGY  154

Query  716  TC  721
            TC
Sbjct  155  TC  156



>ref|XP_010271816.1| PREDICTED: CDPK-related kinase 7-like [Nelumbo nucifera]
Length=576

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A IPEG+E E GLDK+FGFSKHF +K+ELGEEVGRGHFGYT
Sbjct  78   AKHIKALLARRHGSVKPNEATIPEGSECEVGLDKNFGFSKHFVSKFELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_002463267.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
 gb|EER99788.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
Length=593

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF  +Y+LGEEVGRGHFGYT
Sbjct  95   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHFFARYDLGEEVGRGHFGYT  154

Query  719  C  721
            C
Sbjct  155  C  155



>gb|KDO53618.1| hypothetical protein CISIN_1g0074581mg, partial [Citrus sinensis]
 gb|KDO53619.1| hypothetical protein CISIN_1g0074581mg, partial [Citrus sinensis]
 gb|KDO53620.1| hypothetical protein CISIN_1g0074581mg, partial [Citrus sinensis]
Length=158

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIR++LARRHGSVKPN A+IPEG ES+ GLDK+FGFSK F   YELGEEVGRGHFGYT
Sbjct  78   AKHIRSLLARRHGSVKPNEASIPEGNESDIGLDKNFGFSKQFVAHYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_004984283.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Setaria italica]
Length=588

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEGAE + GLDKSFG+SKHF  KY+LG EVGRGHFGYT
Sbjct  90   AKHIRALLARRHGSVKPNEASIPEGAEPDLGLDKSFGYSKHFAAKYDLGREVGRGHFGYT  149

Query  719  C  721
            C
Sbjct  150  C  150



>ref|XP_009611550.1| PREDICTED: CDPK-related kinase 5 [Nicotiana tomentosiformis]
Length=602

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 118/176 (67%), Gaps = 18/176 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG CTSKPS    ++  D  T       +PVK  P+N ++          KK E   G+K
Sbjct  1    MGACTSKPS----NFSGDNITVAGDVATLPVKSGPNNEDDVNSHQT----KKDEPNVGKK  52

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHYLF+KKSPA + ++  +     +R F  P P    AKHIR++LARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPATNASSNSTPMRFFKRPFPPPSP----AKHIRSLLARRH  108

Query  575  GSVKPNGAAIPEGAESEGG------LDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            G+VKPN +AIPEG+ESE G      LDKSFGFSK+FGNKYE+GEEVGRGHFGYTC+
Sbjct  109  GTVKPNESAIPEGSESEVGGGGGAGLDKSFGFSKNFGNKYEMGEEVGRGHFGYTCK  164



>ref|XP_010028268.1| PREDICTED: CDPK-related kinase 5 [Eucalyptus grandis]
 gb|KCW54983.1| hypothetical protein EUGRSUZ_I00953 [Eucalyptus grandis]
Length=621

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 122/185 (66%), Gaps = 16/185 (9%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGI------PVPVKDNPDNGENQGGENQQRNIKKGE  376
            MG+CTSKP+    D  +     R + +      P   + NPD+G   GG+   R  K+  
Sbjct  1    MGLCTSKPT-SQLDLSSPAPGQRGIAVANGGAGPAEERRNPDSGSVNGGDPGNRVPKEEA  59

Query  377  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrr----pfpppspAK  544
               GRKSPFFPFYSPSPAHY F+KKSPA       ++N++     +R    PFPPPSPAK
Sbjct  60   GGDGRKSPFFPFYSPSPAHYFFSKKSPAGRSPANGNANASANSTPKRFFKRPFPPPSPAK  119

Query  545  HIRAVLARRHGSVKPNGAAIPEGAESEG-----GLDKSFGFSKHFGNKYELGEEVGRGHF  709
            HI+A LA R G+VK N AAIPEG+E+EG     GLDKSFGFSK+FG+KYELG+EVGRGHF
Sbjct  120  HIKAALALRRGTVKQNEAAIPEGSEAEGEGRVTGLDKSFGFSKNFGSKYELGDEVGRGHF  179

Query  710  GYTCR  724
            GYTCR
Sbjct  180  GYTCR  184



>ref|XP_003624963.1| Calcium-dependent protein kinase-like protein [Medicago truncatula]
 gb|ABD33022.1| Protein kinase; Calcium-binding EF-hand [Medicago truncatula]
 gb|AES81181.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=595

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG+E E GLDKSFGFSKHF   +ELG+EVGRGHFGYT
Sbjct  96   AKHIRALLARRHGSVKPNEATIPEGSECEVGLDKSFGFSKHFVTNFELGQEVGRGHFGYT  155

Query  719  C  721
            C
Sbjct  156  C  156



>ref|XP_008777902.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F  KYELGEEVGRGHFGYT
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQFFAKYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_008798377.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F  KYELGEEVGRGHFGYT
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQFFAKYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_010907987.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like isoform X1 [Elaeis guineensis]
Length=577

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F  KYELGEEVGRGHFGYT
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQFFAKYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_010246175.1| PREDICTED: CDPK-related kinase 1-like [Nelumbo nucifera]
Length=576

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHG+VKPN A IPEG+E E GLDKSFGFSKHF  K+ELGEEVGRGHFGYT
Sbjct  78   AKHIKALLARRHGAVKPNEATIPEGSECEVGLDKSFGFSKHFLQKFELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_004493390.1| PREDICTED: CDPK-related kinase 7-like [Cicer arietinum]
Length=593

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG+E E GLDKSFGFSKHF   +ELG+EVGRGHFGYT
Sbjct  94   AKHIRALLARRHGSVKPNEATIPEGSECEVGLDKSFGFSKHFVTHFELGQEVGRGHFGYT  153

Query  719  C  721
            C
Sbjct  154  C  154



>dbj|BAK00699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDK FGFSKHF  KYELGEEVGRGHFGYT
Sbjct  97   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKGFGFSKHFFAKYELGEEVGRGHFGYT  156

Query  719  C  721
            C
Sbjct  157  C  157



>ref|NP_001169442.1| uncharacterized LOC100383313 [Zea mays]
 gb|ACN33785.1| unknown [Zea mays]
 tpg|DAA63857.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=592

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN  +IPEG E E GLDKSFGFSKHF  KY+LGEE+GRGHFGYT
Sbjct  94   AKHIRALLARRHGSVKPNEVSIPEGGEPELGLDKSFGFSKHFFAKYDLGEEIGRGHFGYT  153

Query  719  C  721
            C
Sbjct  154  C  154



>ref|XP_010907988.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like isoform X2 [Elaeis guineensis]
Length=556

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F  KYELGEEVGRGHFGYT
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQFFAKYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_011099192.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Sesamum indicum]
Length=611

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 119/182 (65%), Gaps = 21/182 (12%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TD--RNVGIP-------VPVKDNPDNGENQGGENQQ-RNI  364
            MG+CTSKP    R +     +D  +N  +        VP  +N  N ++ G  +++ RN 
Sbjct  1    MGICTSKP----RPFPEPNLSDECKNAAVSAQDQENAVPAGNNDVNAKSSGNLDEKNRNE  56

Query  365  KKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAK  544
            +K    GG+KSPFFPFYSPSPAHYLF+KKSPARSPA    +     +    P  P   AK
Sbjct  57   EKSG--GGKKSPFFPFYSPSPAHYLFSKKSPARSPAPGSVTPRRFFKRPFPPPSP---AK  111

Query  545  HIRAVLARRHGSVKPNGAAIPEGAE-SEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            HI+AVLARRHGSVKPN AAIPEG E SE   LDKSFGF K F +KYELGEEVGRGHFGYT
Sbjct  112  HIKAVLARRHGSVKPNEAAIPEGKEVSEALSLDKSFGFPKKFYDKYELGEEVGRGHFGYT  171

Query  719  CR  724
            CR
Sbjct  172  CR  173



>dbj|BAC16472.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
 dbj|BAD31271.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
Length=594

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG E+E GLDK FGFSKHF  KYELG+EVGRGHFGYT
Sbjct  96   AKHIRALLARRHGSVKPNEAPIPEGGETEVGLDKGFGFSKHFFAKYELGDEVGRGHFGYT  155

Query  719  C  721
            C
Sbjct  156  C  156



>ref|XP_002522159.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF40200.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=512

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG ES+ GLDK+FG+SKHF + Y+LGEEVGRGHFGYT
Sbjct  81   AKHIRALLARRHGSVKPNEASIPEGNESDIGLDKNFGYSKHFVSHYDLGEEVGRGHFGYT  140

Query  719  C  721
            C
Sbjct  141  C  141



>gb|KJB35810.1| hypothetical protein B456_006G129900 [Gossypium raimondii]
Length=479

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+++LARRHGS+KPN A+IPEG+E E GL+KSFGFSKHF + YELGEEVGRGHFGYT
Sbjct  78   AKHIKSLLARRHGSIKPNEASIPEGSECEVGLNKSFGFSKHFTSHYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>gb|EEC82532.1| hypothetical protein OsI_27055 [Oryza sativa Indica Group]
Length=591

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG E+E GLDK FGFSKHF  KYELG+EVGRGHFGYT
Sbjct  93   AKHIRALLARRHGSVKPNEAPIPEGGEAEVGLDKGFGFSKHFFAKYELGDEVGRGHFGYT  152

Query  719  C  721
            C
Sbjct  153  C  153



>ref|XP_010909915.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Elaeis guineensis]
Length=577

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGF K F +KYELGEEVGRGHFGYT
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFLKQFFSKYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_008377637.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Malus domestica]
Length=578

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E  LDK+FGFSK FG+ YELG+EVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVALDKNFGFSKQFGSHYELGDEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_008377644.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Malus domestica]
Length=577

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E  LDK+FGFSK FG+ YELG+EVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVALDKNFGFSKQFGSHYELGDEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_010909914.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Elaeis guineensis]
Length=601

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGF K F +KYELGEEVGRGHFGYT
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFLKQFFSKYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_007028316.1| CDPK-related kinase 1 [Theobroma cacao]
 gb|EOY08818.1| CDPK-related kinase 1 [Theobroma cacao]
Length=576

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A+IPEG E + GLDK+FGFSKHF + YELGEEVGRGHFGYT
Sbjct  78   AKHIRALLARRHGSIKPNEASIPEGNECDIGLDKNFGFSKHFMSHYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>sp|P53681.1|CRK_DAUCA RecName: Full=CDPK-related protein kinase; AltName: Full=PK421 
[Daucus carota]
 emb|CAA58750.1| CDPK-related protein kinase [Daucus carota]
Length=602

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 115/177 (65%), Gaps = 20/177 (11%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPV-----PVKDNPDNGENQGGENQQRNIKKGEV  379
            MG+C SKPS E  D  N      +  IPV     P +DN    ++     Q  N      
Sbjct  1    MGICVSKPSPEP-DLHN-----HHTSIPVNDTSLPPQDNSIPPKDIAIPAQDNN-----K  49

Query  380  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAV  559
              G+KSPF PFYSPSPAH+LF+KKSPA     A SSNSTP+R F  P P P  AKHI+A 
Sbjct  50   PPGKKSPFLPFYSPSPAHFLFSKKSPAVGSPAAGSSNSTPKRLFPFPPPSP--AKHIKAA  107

Query  560  LARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
             ARRHGSVKPN AAIPE  E +GG  LDKSFGFSK FG+K+E+GEEVGRGHFGYTCR
Sbjct  108  WARRHGSVKPNEAAIPENNEVDGGAGLDKSFGFSKKFGSKFEVGEEVGRGHFGYTCR  164



>ref|XP_006836275.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
 gb|ERM99128.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
Length=580

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN AAIPEG E E GLDK+FGFSKHF  KYE GEE+GRGHFGYT
Sbjct  78   AKHIKALLARRHGSVKPNEAAIPEGNEGELGLDKNFGFSKHFTTKYETGEEIGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_002322616.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
 gb|EEF04377.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
Length=578

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+ES+  LDK+FGFSK F + YELGEEVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSESDIALDKNFGFSKQFVSHYELGEEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_007047191.1| CDPK-related kinase [Theobroma cacao]
 gb|EOX91348.1| CDPK-related kinase [Theobroma cacao]
Length=630

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 120/197 (61%), Gaps = 34/197 (17%)
 Frame = +2

Query  215  MGVCTSKPSL-----EHRDWRNDQ*TDRNVGI-----PVPVKDNPD--NG-------ENQ  337
            MG+CTSKPS         D RN     RN  I      +P    PD  NG       E+Q
Sbjct  1    MGLCTSKPSPNPSFPPKSDSRNTPIHPRNNDIHRKSNSIPASPLPDAVNGNQNRNPTEDQ  60

Query  338  GGENQQRNIKKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrr  517
            G +++++       EG +KSPFFPFYSPSPA YLF+KKSPARS A +       R F   
Sbjct  61   GKDDEEKGNSNSNNEG-KKSPFFPFYSPSPASYLFSKKSPARSSATSTPKRFFRRPFPPP  119

Query  518  pfpppspAKHIRAVLARRHGSVKPNGAAIPEGAESE---------GGLDKSFGFSKHFGN  670
                   AKHIRAVLARRHGSVKPN AAIPEG+E+E          GLDKSFGFSKHFG+
Sbjct  120  SP-----AKHIRAVLARRHGSVKPNEAAIPEGSEAEAAAAAGAGGTGLDKSFGFSKHFGS  174

Query  671  KYELGEEVGRGHFGYTC  721
            KYELG+EVGRGHFGYTC
Sbjct  175  KYELGDEVGRGHFGYTC  191



>ref|XP_010673049.1| PREDICTED: CDPK-related kinase 7-like [Beta vulgaris subsp. vulgaris]
Length=578

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E + GLDK+FGFSK F + YELGEEVGRGHFGYT
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGSECDIGLDKNFGFSKQFAHHYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>gb|KJB35809.1| hypothetical protein B456_006G129900 [Gossypium raimondii]
Length=576

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+++LARRHGS+KPN A+IPEG+E E GL+KSFGFSKHF + YELGEEVGRGHFGYT
Sbjct  78   AKHIKSLLARRHGSIKPNEASIPEGSECEVGLNKSFGFSKHFTSHYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_010542604.1| PREDICTED: CDPK-related kinase 1 [Tarenaya hassleriana]
Length=575

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A+IPEG+E E GLDK+FGFSK F + YELG+EVGRGHFGYT
Sbjct  77   AKHIRALLARRHGSIKPNEASIPEGSECEIGLDKNFGFSKQFASHYELGDEVGRGHFGYT  136

Query  719  C  721
            C
Sbjct  137  C  137



>ref|XP_009371242.1| PREDICTED: CDPK-related kinase 7-like [Pyrus x bretschneideri]
Length=577

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E  LDKSFGFSK F + YELG+EVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVALDKSFGFSKQFVSHYELGDEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_006346445.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=588

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A+L RRHGSVKPN AAIPEG E+EG  LDKSFGFSK F +KYE+GEEVGRGHFGY
Sbjct  88   AKHIKALLLRRHGSVKPNAAAIPEGEETEGANLDKSFGFSKQFASKYEIGEEVGRGHFGY  147

Query  716  TC  721
            TC
Sbjct  148  TC  149



>ref|NP_001146092.1| uncharacterized protein LOC100279624 [Zea mays]
 gb|ACL53208.1| unknown [Zea mays]
 tpg|DAA45496.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=213

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF  KY+LG EVGRGHFG+T
Sbjct  88   AKHIRALLARRHGSVKPNEASIPEGGELDLGLDKSFGYSRHFAAKYDLGREVGRGHFGFT  147

Query  719  C  721
            C
Sbjct  148  C  148



>ref|XP_008440252.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Cucumis melo]
Length=605

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 115/179 (64%), Gaps = 21/179 (12%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPV------PVKDNPDNGENQGGENQQRNIKKG-  373
            MG+C SKPS           +   V +P       P++ +  + +     N+ R  +K  
Sbjct  1    MGLCVSKPS-----------STTVVAVPAIQDALPPLETSLPSVDTGNRSNETREGEKIP  49

Query  374  -EVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
             ++E  +KSP+FP ++PSP HYLF+KKSP RSP N  S+++  R F +   PP   AKHI
Sbjct  50   FDLEVAKKSPYFPPFTPSPVHYLFSKKSPLRSPPNVSSNSTPKRFFKKPFPPPSP-AKHI  108

Query  551  RAVLARRHGSVKPNGAAIPEG-AESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
             AVLARRHGSVKPN A+IPEG    E GLDKSFGFSKHF NKYELGEEVG+GHFG+TCR
Sbjct  109  MAVLARRHGSVKPNEASIPEGNVIEEPGLDKSFGFSKHFRNKYELGEEVGKGHFGHTCR  167



>ref|XP_011027259.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Populus euphratica]
Length=562

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E++ GLDK+FGFSK F + YELGEEVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGNETDIGLDKNFGFSKQFVSHYELGEEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_008440253.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Cucumis melo]
Length=604

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 115/179 (64%), Gaps = 21/179 (12%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPV------PVKDNPDNGENQGGENQQRNIKKG-  373
            MG+C SKPS           +   V +P       P++ +  + +     N+ R  +K  
Sbjct  1    MGLCVSKPS-----------STTVVAVPAIQDALPPLETSLPSVDTGNRSNETREGEKIP  49

Query  374  -EVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  550
             ++E  +KSP+FP ++PSP HYLF+KKSP RSP N  S+++  R F +   PP   AKHI
Sbjct  50   FDLEVAKKSPYFPPFTPSPVHYLFSKKSPLRSPPNVSSNSTPKRFFKKPFPPPSP-AKHI  108

Query  551  RAVLARRHGSVKPNGAAIPEG-AESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
             AVLARRHGSVKPN A+IPEG    E GLDKSFGFSKHF NKYELGEEVG+GHFG+TCR
Sbjct  109  MAVLARRHGSVKPNEASIPEGNVIEEPGLDKSFGFSKHFRNKYELGEEVGKGHFGHTCR  167



>ref|XP_011000411.1| PREDICTED: CDPK-related kinase 7-like [Populus euphratica]
Length=578

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E++ GLDK+FGFSK F + YELGEEVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGNETDIGLDKNFGFSKQFVSHYELGEEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_003518984.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Glycine max]
 gb|KHN27043.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Glycine soja]
Length=583

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN AAIPEG+E E GLDKSFGF+K F   YEL +EVGRGHFGYT
Sbjct  84   AKHIRALLARRHGSVKPNEAAIPEGSECEVGLDKSFGFAKQFSAHYELSDEVGRGHFGYT  143

Query  719  C  721
            C
Sbjct  144  C  144



>emb|CDP06189.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG+E E GLD+SFGF+K+F + YELGEEVGRGHFGYT
Sbjct  79   AKHIRALLARRHGSVKPNEATIPEGSECEIGLDRSFGFAKNFVSHYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_002308892.2| CDPK-related kinase 1 family protein [Populus trichocarpa]
 gb|EEE92415.2| CDPK-related kinase 1 family protein [Populus trichocarpa]
Length=562

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDK+FGFSK F + YELGEEVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGNEIDIGLDKNFGFSKQFASHYELGEEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_010922072.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Elaeis guineensis]
Length=576

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGS KPN A IPEG E+E GLDKSFGFSK F  KYELGEEVGRGHFGYT
Sbjct  78   AKHIKALLARRHGSAKPNEATIPEGNEAELGLDKSFGFSKQFCLKYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_003516596.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=585

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A LARRHGSVKPN AAIPE AE+  GLDK+FGFSKHFGNKYELG EVGRGHFGYT
Sbjct  89   AKHIKAALARRHGSVKPNEAAIPE-AEAVAGLDKNFGFSKHFGNKYELGGEVGRGHFGYT  147

Query  719  C  721
            C
Sbjct  148  C  148



>ref|XP_007163947.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
 gb|ESW35941.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
Length=580

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDKSFGFS HF   YELG EVGRGHFGYT
Sbjct  81   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKSFGFSNHFHAHYELGPEVGRGHFGYT  140

Query  719  C  721
            C
Sbjct  141  C  141



>gb|KHG24093.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Gossypium arboreum]
Length=576

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+++LARRHGS+KPN A+IPEG E E GL+KSFGFSKHF + YELGEEVGRGHFGYT
Sbjct  78   AKHIKSLLARRHGSIKPNEASIPEGNECEVGLNKSFGFSKHFTSHYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_008464945.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Cucumis melo]
Length=600

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FG+SKHF   Y+LGEEVGRGHFGYT
Sbjct  74   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGYSKHFAAHYDLGEEVGRGHFGYT  133

Query  719  C  721
            C
Sbjct  134  C  134



>ref|XP_008464946.1| PREDICTED: CDPK-related kinase 1-like isoform X2 [Cucumis melo]
Length=572

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FG+SKHF   Y+LGEEVGRGHFGYT
Sbjct  74   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGYSKHFAAHYDLGEEVGRGHFGYT  133

Query  719  C  721
            C
Sbjct  134  C  134



>ref|XP_009420969.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=576

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDK+FGFSK   +K+ELGEEVGRGHFGYT
Sbjct  78   AKHIKALLARRHGSVKPNEASIPEGSEVEVGLDKNFGFSKQLFSKFELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_006482068.1| PREDICTED: CDPK-related kinase 7-like [Citrus sinensis]
Length=576

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIR++LARRHGSVKPN A+IPEG ES+ GLDK+FGFSK F   YELGEEVGRGHFGYT
Sbjct  78   AKHIRSLLARRHGSVKPNEASIPEGNESDIGLDKNFGFSKQFVAHYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_010228587.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1 isoform X1 [Brachypodium distachyon]
Length=597

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E    LDKSFGFS+H   KYELG EVGRGHFGYT
Sbjct  94   AKHIRALLARRHGSVKPNAASIPEGSEPGVALDKSFGFSRHLSAKYELGREVGRGHFGYT  153

Query  719  C  721
            C
Sbjct  154  C  154



>ref|XP_006430539.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
 gb|ESR43779.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
Length=576

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIR++LARRHGSVKPN A+IPEG ES+ GLDK+FGFSK F   YELGEEVGRGHFGYT
Sbjct  78   AKHIRSLLARRHGSVKPNEASIPEGNESDIGLDKNFGFSKQFVAHYELGEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_003557839.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1 isoform X2 [Brachypodium distachyon]
Length=592

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E    LDKSFGFS+H   KYELG EVGRGHFGYT
Sbjct  94   AKHIRALLARRHGSVKPNAASIPEGSEPGVALDKSFGFSRHLSAKYELGREVGRGHFGYT  153

Query  719  C  721
            C
Sbjct  154  C  154



>ref|XP_009801386.1| PREDICTED: CDPK-related kinase 5-like [Nicotiana sylvestris]
Length=590

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A+L RRHGSVKPN AAIPEG E+EG  LDKSFGFSK F +KYE+G+EVGRGHFGY
Sbjct  90   AKHIKALLLRRHGSVKPNAAAIPEGEETEGANLDKSFGFSKQFKSKYEVGDEVGRGHFGY  149

Query  716  TC  721
            TC
Sbjct  150  TC  151



>ref|XP_004230803.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=588

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A+L RRHGSVKPN A+IPEG E+EG  LDKSFGFSK F +KYE+GEEVGRGHFGY
Sbjct  88   AKHIKALLLRRHGSVKPNAASIPEGEETEGANLDKSFGFSKQFVSKYEIGEEVGRGHFGY  147

Query  716  TC  721
            TC
Sbjct  148  TC  149



>ref|XP_004141122.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Cucumis sativus]
 ref|XP_004158329.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Cucumis sativus]
 gb|KGN59723.1| hypothetical protein Csa_3G840980 [Cucumis sativus]
Length=573

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FG+SKHF   Y+LG+EVGRGHFGYT
Sbjct  75   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGYSKHFAAHYDLGDEVGRGHFGYT  134

Query  719  C  721
            C
Sbjct  135  C  135



>ref|XP_009405856.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=573

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GL+K+FGFSK F +K+ELGEEVGRGHFGYT
Sbjct  75   AKHIKALLARRHGSVKPNEASIPEGSEVELGLNKNFGFSKQFFSKFELGEEVGRGHFGYT  134

Query  719  C  721
            C
Sbjct  135  C  135



>ref|XP_002467812.1| hypothetical protein SORBIDRAFT_01g034520 [Sorghum bicolor]
 gb|EER94810.1| hypothetical protein SORBIDRAFT_01g034520 [Sorghum bicolor]
Length=592

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF  KY+LG EVGRGHFG+T
Sbjct  94   AKHIRALLARRHGSVKPNEASIPEGGEPDLGLDKSFGYSRHFAAKYDLGREVGRGHFGFT  153

Query  719  C  721
            C
Sbjct  154  C  154



>ref|XP_009404698.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=575

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A IPEG+E E GLDK+FGFSK   +K+ELGEE+GRGHFGYT
Sbjct  78   AKHIKALLARRHGSVKPNEAPIPEGSEVEVGLDKNFGFSKQLFSKFELGEEIGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>gb|KDP27484.1| hypothetical protein JCGZ_20019 [Jatropha curcas]
Length=577

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E +  LDK+FGFSK F + YELGEEVGRGHFGYT
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGNECDIALDKNFGFSKQFVSHYELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_006360222.1| PREDICTED: CDPK-related protein kinase-like [Solanum tuberosum]
Length=590

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 101/170 (59%), Gaps = 18/170 (11%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG CTSKPS E     ND        IP        N E+   EN+    K+G  E G+K
Sbjct  1    MGGCTSKPSPEPNYSNNDLYAPDGTAIPAKA-----NNEDNSLENKS---KEG-AEVGKK  51

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHY F+KKSPA S          P             AKHIRAVLARRH
Sbjct  52   SPFFPFYSPSPAHYFFSKKSPANSTPRRFFKRPFPPPSP---------AKHIRAVLARRH  102

Query  575  GSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            GSVKPN        E  GGLDKSFGFSK+FGNKYELGEEVGRGHFGYTC+
Sbjct  103  GSVKPNAIPEGNELEGGGGLDKSFGFSKNFGNKYELGEEVGRGHFGYTCK  152



>ref|NP_001140858.1| uncharacterized LOC100272934 [Zea mays]
 gb|ACF84827.1| unknown [Zea mays]
 tpg|DAA45495.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=586

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF  KY+LG EVGRGHFG+T
Sbjct  88   AKHIRALLARRHGSVKPNEASIPEGGELDLGLDKSFGYSRHFAAKYDLGREVGRGHFGFT  147

Query  719  C  721
            C
Sbjct  148  C  148



>ref|XP_003535908.1| PREDICTED: CDPK-related kinase 1-like [Glycine max]
Length=583

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPE +E E GLDKSFGF+K F   YEL +EVGRGHFGYT
Sbjct  84   AKHIRALLARRHGSVKPNEASIPEASECELGLDKSFGFAKQFSAHYELSDEVGRGHFGYT  143

Query  719  C  721
            C
Sbjct  144  C  144



>ref|XP_008667154.1| PREDICTED: uncharacterized LOC100272934 isoform X1 [Zea mays]
Length=658

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF  KY+LG EVGRGHFG+T
Sbjct  160  AKHIRALLARRHGSVKPNEASIPEGGELDLGLDKSFGYSRHFAAKYDLGREVGRGHFGFT  219

Query  719  C  721
            C
Sbjct  220  C  220



>ref|XP_008240668.1| PREDICTED: CDPK-related kinase 7 [Prunus mume]
Length=576

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FGFSK F   YELG+EVGRGHFGYT
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGFSKQFVAHYELGDEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_004509161.1| PREDICTED: CDPK-related protein kinase-like [Cicer arietinum]
Length=582

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPN-GAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIR++LARRHGSVKPN GA+I EG+E+E    LDK+FGFSKHFGNKYE+GEEVGRGHF
Sbjct  78   AKHIRSLLARRHGSVKPNIGASISEGSEAETVAPLDKNFGFSKHFGNKYEVGEEVGRGHF  137

Query  710  GYTC  721
            GYTC
Sbjct  138  GYTC  141



>ref|XP_009393900.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=577

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDK+FGF K   +K+ELGEEVGRGHFGYT
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKNFGFLKQIFSKFELGEEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_007156824.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
 gb|ESW28818.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
Length=589

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 1/60 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARRHGSVKPN AAIPE AE+  GLDK+FGFSKH GNKYE+G+EVGRGHFGYT
Sbjct  93   AKHIRAALARRHGSVKPNEAAIPE-AEAVAGLDKNFGFSKHLGNKYEVGDEVGRGHFGYT  151



>ref|NP_191235.1| CDPK-related kinase 7 [Arabidopsis thaliana]
 sp|Q9LET1.1|CAMK7_ARATH RecName: Full=CDPK-related kinase 7; Short=AtCRK7; AltName: Full=Calcium/calmodulin-dependent 
protein kinase CRK7 [Arabidopsis 
thaliana]
 emb|CAC00739.1| calcium-dependent protein kinase-like [Arabidopsis thaliana]
 gb|AEE79562.1| CDPK-related kinase 7 [Arabidopsis thaliana]
Length=577

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFASHYEIDGEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_010427515.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Camelina sativa]
Length=584

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  85   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFASHYEIDGEVGRGHFGYT  144

Query  719  C  721
            C
Sbjct  145  C  145



>ref|XP_010516279.1| PREDICTED: CDPK-related kinase 7 [Camelina sativa]
Length=582

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  83   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFASHYEIDGEVGRGHFGYT  142

Query  719  C  721
            C
Sbjct  143  C  143



>ref|XP_010504583.1| PREDICTED: CDPK-related kinase 7-like [Camelina sativa]
Length=582

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  83   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFASHYEIDGEVGRGHFGYT  142

Query  719  C  721
            C
Sbjct  143  C  143



>ref|XP_006290768.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
 gb|EOA23666.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
Length=568

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFSSHYEIDGEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_006290769.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
 gb|EOA23667.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
Length=604

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFSSHYEIDGEVGRGHFGYT  139

Query  719  C  721
            C
Sbjct  140  C  140



>ref|XP_010427514.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Camelina sativa]
Length=611

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  85   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFASHYEIDGEVGRGHFGYT  144

Query  719  C  721
            C
Sbjct  145  C  145



>gb|AET04065.2| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=581

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAA-IPEGAE--SEGGLDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIR++LARRHGSVKPNGAA I EG+E  S   LDK+FGFSKHFG+KY+LGEEVGRGHF
Sbjct  77   AKHIRSLLARRHGSVKPNGAASISEGSEGESVAPLDKNFGFSKHFGSKYQLGEEVGRGHF  136

Query  710  GYTC  721
            GYTC
Sbjct  137  GYTC  140



>ref|XP_011079071.1| PREDICTED: CDPK-related kinase 1-like [Sesamum indicum]
Length=579

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A+LARRHGSVKPN A IPEG+E E  GLDK+FGFSK+F + YELGEEVGRGHFGY
Sbjct  80   AKHIKALLARRHGSVKPNEATIPEGSECEIIGLDKNFGFSKNFTSHYELGEEVGRGHFGY  139

Query  716  TC  721
            TC
Sbjct  140  TC  141



>ref|XP_003629589.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
Length=607

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAA-IPEGAE--SEGGLDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIR++LARRHGSVKPNGAA I EG+E  S   LDK+FGFSKHFG+KY+LGEEVGRGHF
Sbjct  77   AKHIRSLLARRHGSVKPNGAASISEGSEGESVAPLDKNFGFSKHFGSKYQLGEEVGRGHF  136

Query  710  GYTC  721
            GYTC
Sbjct  137  GYTC  140



>gb|EYU20808.1| hypothetical protein MIMGU_mgv1a003516mg [Erythranthe guttata]
Length=580

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A+LARRHGSVKPN A IPEG+E E  GLDK+FGFSK+F + YELGEEVGRGHFGY
Sbjct  81   AKHIKALLARRHGSVKPNEATIPEGSECEIIGLDKNFGFSKNFVSHYELGEEVGRGHFGY  140

Query  716  TC  721
            TC
Sbjct  141  TC  142



>ref|XP_004233433.1| PREDICTED: CDPK-related kinase 5-like [Solanum lycopersicum]
Length=591

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 105/170 (62%), Gaps = 17/170 (10%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG CTSKPS E     ND       G  +P KDN          N + +  K   E G+K
Sbjct  1    MGGCTSKPSPEPNYSNNDLYAPD--GTAIPAKDN----------NSEDSKSKEGAEVGKK  48

Query  395  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  574
            SPFFPFYSPSPAHY F+KKSPARSP+N+       R F          AKHIRAVLARRH
Sbjct  49   SPFFPFYSPSPAHYFFSKKSPARSPSNSTPRRFFKRPFPPPSP-----AKHIRAVLARRH  103

Query  575  GSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTCR  724
            GSVKPN        E  GGLDKSFGFSK+F NKYELGEEVGRGHFGYTC+
Sbjct  104  GSVKPNAIPEGNELEGGGGLDKSFGFSKNFENKYELGEEVGRGHFGYTCK  153



>ref|XP_008658484.1| PREDICTED: uncharacterized LOC100279633 isoform X1 [Zea mays]
Length=598

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+I EG E + GLDKSFG+S+HF  KY+LG EVGRGHFG+T
Sbjct  91   AKHIRALLARRHGSVKPNEASISEGGEPDLGLDKSFGYSRHFAAKYDLGREVGRGHFGFT  150

Query  719  C  721
            C
Sbjct  151  C  151



>ref|NP_001146101.1| uncharacterized LOC100279633 [Zea mays]
 gb|ACL53229.1| unknown [Zea mays]
 gb|AFW88296.1| putative protein kinase superfamily protein [Zea mays]
Length=595

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+I EG E + GLDKSFG+S+HF  KY+LG EVGRGHFG+T
Sbjct  91   AKHIRALLARRHGSVKPNEASISEGGEPDLGLDKSFGYSRHFAAKYDLGREVGRGHFGFT  150

Query  719  C  721
            C
Sbjct  151  C  151



>gb|EEC75325.1| hypothetical protein OsI_11701 [Oryza sativa Indica Group]
Length=596

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF  KYELG EVGRGHFGYT
Sbjct  98   AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFAAKYELGREVGRGHFGYT  157

Query  719  C  721
            C
Sbjct  158  C  158



>gb|EPS58889.1| hypothetical protein M569_15923, partial [Genlisea aurea]
Length=251

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 2/64 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI +VLARRHG+VKPN AAIPE  E      LDKSFGFSK F +KY+LG EVGRGHFG
Sbjct  46   AKHIMSVLARRHGTVKPNEAAIPEAKEVSEAASLDKSFGFSKKFCDKYDLGAEVGRGHFG  105

Query  713  YTCR  724
            YTCR
Sbjct  106  YTCR  109



>ref|XP_007145486.1| hypothetical protein PHAVU_007G243100g [Phaseolus vulgaris]
 gb|ESW17480.1| hypothetical protein PHAVU_007G243100g [Phaseolus vulgaris]
Length=577

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARR GSVKPN A+IPEG+E E GLDK FGF+K+F   YE+ EEVGRGHFGYT
Sbjct  78   AKHIRALLARRQGSVKPNEASIPEGSECEIGLDKRFGFAKNFSAHYEISEEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_006402951.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
 gb|ESQ44404.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
Length=576

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A+IPEG+E + GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  78   AKHIRALLARRHGSIKPNEASIPEGSECDVGLDKKFGFSKQFASHYEIDGEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>emb|CBI32784.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG E E GLDK+FGFSK F   YE+GEEVGRGHFGYT
Sbjct  96   AKHIRALLARRHGSVKPNEATIPEGNECEVGLDKNFGFSKQFVAHYEMGEEVGRGHFGYT  155



>ref|XP_002282577.1| PREDICTED: CDPK-related kinase 1 [Vitis vinifera]
Length=575

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A IPEG E E GLDK+FGFSK F   YE+GEEVGRGHFGYT
Sbjct  78   AKHIRALLARRHGSVKPNEATIPEGNECEVGLDKNFGFSKQFVAHYEMGEEVGRGHFGYT  137



>ref|NP_001050179.1| Os03g0366200 [Oryza sativa Japonica Group]
 dbj|BAF12093.1| Os03g0366200 [Oryza sativa Japonica Group]
Length=597

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF  KYELG EVGRGHFGYT
Sbjct  99   AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFAAKYELGREVGRGHFGYT  158

Query  719  C  721
            C
Sbjct  159  C  159



>sp|Q10KY3.1|CAMK1_ORYSJ RecName: Full=Calcium/calmodulin-dependent serine/threonine-protein 
kinase 1; AltName: Full=Calcium/calmodulin-binding serine/threonine-protein 
kinase; Short=CaM-binding protein kinase; 
AltName: Full=OsCBK [Oryza sativa Japonica Group]
 gb|ABF96128.1| CDPK-related protein kinase, putative, expressed [Oryza sativa 
Japonica Group]
Length=600

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF  KYELG EVGRGHFGYT
Sbjct  102  AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFAAKYELGREVGRGHFGYT  161

Query  719  C  721
            C
Sbjct  162  C  162



>gb|AAK54157.1|AF368282_1 CaMK1 [Oryza sativa]
Length=597

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF  KYELG EVGRGHFGYT
Sbjct  99   AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFAAKYELGREVGRGHFGYT  158

Query  719  C  721
            C
Sbjct  159  C  159



>ref|XP_009409499.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG----GLDKSFGFSKHFGNKYELGEEVGRGH  706
            AKHIRA+LARRHGSVKPN AAIPE    EG    GLDKSFGFSK F +KYE+GEEVGRGH
Sbjct  101  AKHIRALLARRHGSVKPNEAAIPEDEGEEGRAVAGLDKSFGFSKGFTSKYEIGEEVGRGH  160

Query  707  FGYTC  721
            FGYTC
Sbjct  161  FGYTC  165



>ref|XP_011075448.1| PREDICTED: CDPK-related kinase 1 [Sesamum indicum]
Length=579

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A+LARRHGSVKPN A IPEG+E E  GLDK+FGFSK+F + YELGEE+GRGHFGY
Sbjct  80   AKHIKALLARRHGSVKPNEATIPEGSECEIIGLDKNFGFSKNFISHYELGEEIGRGHFGY  139

Query  716  TC  721
            TC
Sbjct  140  TC  141



>ref|XP_009618516.1| PREDICTED: CDPK-related kinase 7-like [Nicotiana tomentosiformis]
Length=577

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK+FG+SK+F + YELGEEVGRGHFGYT
Sbjct  79   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKNFGYSKNFLSHYELGEEVGRGHFGYT  138



>ref|XP_009761409.1| PREDICTED: CDPK-related kinase 1-like [Nicotiana sylvestris]
Length=577

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK+FG+SK+F + YELGEEVGRGHFGYT
Sbjct  79   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKNFGYSKNFLSHYELGEEVGRGHFGYT  138



>ref|XP_002879911.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56170.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARR+GSVKPN  +IPEG E E GLDKSFGFSK F + YE+  EVGRGHFGYT
Sbjct  79   AKHIRAFLARRYGSVKPNAVSIPEGKECEIGLDKSFGFSKQFASHYEIDGEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_002878106.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54365.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHG VKPN A+IPEG+E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  79   AKHIRALLARRHGFVKPNEASIPEGSECEVGLDKKFGFSKQFASHYEIDGEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_006362272.1| PREDICTED: CDPK-related kinase 1-like [Solanum tuberosum]
Length=574

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK FG+SK+F + Y+LGEEVGRGHFGYT
Sbjct  76   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKIFGYSKNFDSHYDLGEEVGRGHFGYT  135



>ref|XP_004249131.1| PREDICTED: CDPK-related kinase 1 [Solanum lycopersicum]
Length=574

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK FG+SK+F + Y+LGEEVGRGHFGYT
Sbjct  76   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKIFGYSKNFDSHYDLGEEVGRGHFGYT  135



>ref|XP_010525467.1| PREDICTED: CDPK-related kinase 1-like [Tarenaya hassleriana]
Length=573

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRA+LARRHGS++PN A+IPEG+E E  GLDK+FGFSK FG+ YE+ +E+GRGHFGY
Sbjct  74   AKHIRALLARRHGSIRPNEASIPEGSECEEIGLDKNFGFSKQFGSHYEINDELGRGHFGY  133

Query  716  TC  721
            TC
Sbjct  134  TC  135



>gb|EPS59727.1| hypothetical protein M569_15078, partial [Genlisea aurea]
Length=568

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A+LARRHGS+KPNGA+IPEG+E E  GLDK+FGF K+F   YELGEEVGRGHFG+
Sbjct  78   AKHIKALLARRHGSIKPNGASIPEGSECEVIGLDKNFGFCKNFVGHYELGEEVGRGHFGF  137

Query  716  TC  721
            TC
Sbjct  138  TC  139



>gb|KCW47909.1| hypothetical protein EUGRSUZ_K01647 [Eucalyptus grandis]
Length=437

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A LA+R+G+VKPN  AIPEG E E GLDK+FGFSK F + YE+GEE+GRGHFGYT
Sbjct  102  AKHIKAFLAKRYGAVKPNEVAIPEGGECEIGLDKNFGFSKQFVSHYEMGEEIGRGHFGYT  161

Query  719  C  721
            C
Sbjct  162  C  162



>ref|XP_006411380.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
 gb|ESQ52833.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
Length=576

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARR GS KPN A+IPEG E E GLDKSFGFSKHF + YE+  EVGRGHFGYT
Sbjct  78   AKHIRAFLARRSGSTKPNEASIPEGKEFEIGLDKSFGFSKHFASHYEIDGEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_010911684.1| PREDICTED: CDPK-related kinase 5-like, partial [Elaeis guineensis]
Length=194

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE----GAESEGGLDKSFGFSKHFGNKYELGEEVGRGH  706
            AKHIRAVLARRHGSVKPN A IPE    G  S  GLDK+F F K F +KYELGEEVGRGH
Sbjct  107  AKHIRAVLARRHGSVKPNEAVIPEEEGEGGRSVAGLDKNFRFEKGFASKYELGEEVGRGH  166

Query  707  FGYTC  721
            FGYTC
Sbjct  167  FGYTC  171



>ref|NP_181647.1| CDPK-related kinase 1 [Arabidopsis thaliana]
 sp|O80673.1|CAMK1_ARATH RecName: Full=CDPK-related kinase 1; Short=AtCRK1; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 3; AltName: 
Full=Calmodulin-binding protein kinase 3; Short=AtCBK3; Short=CaM-binding 
protein kinase 3 [Arabidopsis thaliana]
 gb|AAD38058.1|AF153351_1 CDPK-related kinase 1 [Arabidopsis thaliana]
 gb|AAL30816.1|AF435448_1 calcium/calmodulin-dependent protein kinase CaMK3 [Arabidopsis 
thaliana]
 gb|AAD12016.1| CPDK-related protein kinase [Arabidopsis thaliana]
 gb|AEC09936.1| CDPK-related kinase 1 [Arabidopsis thaliana]
Length=576

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARR+GSVKPN  +IPEG E E GLDKSFGFSK F + YE+  EVGRGHFGYT
Sbjct  78   AKHIRAFLARRYGSVKPNEVSIPEGKECEIGLDKSFGFSKQFASHYEIDGEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>ref|XP_010508754.1| PREDICTED: CDPK-related kinase 1-like [Camelina sativa]
Length=577

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARR+GS+KPN  +IPEG E E GLDKSFGFSK F + YE+  EVGRGHFGYT
Sbjct  79   AKHIRAFLARRYGSIKPNEVSIPEGKECEIGLDKSFGFSKQFASHYEIDGEVGRGHFGYT  138

Query  719  C  721
            C
Sbjct  139  C  139



>ref|XP_010036359.1| PREDICTED: CDPK-related kinase 1-like [Eucalyptus grandis]
 gb|KCW47910.1| hypothetical protein EUGRSUZ_K01647 [Eucalyptus grandis]
Length=600

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A LA+R+G+VKPN  AIPEG E E GLDK+FGFSK F + YE+GEE+GRGHFGYT
Sbjct  102  AKHIKAFLAKRYGAVKPNEVAIPEGGECEIGLDKNFGFSKQFVSHYEMGEEIGRGHFGYT  161

Query  719  C  721
            C
Sbjct  162  C  162



>ref|XP_010426596.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=607

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 128/176 (73%), Gaps = 14/176 (8%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGE--NQQRNIKKGEVEGG  388
            MG+CTSKP+  +    +DQ   RN  +P      P +    GG     Q  +   E   G
Sbjct  1    MGLCTSKPNSPN----SDQTPARNSPLPASESVKPSSSSVNGGNPVEDQSVVPSNE---G  53

Query  389  RKspffpfyspspAHYLFakksparspanapss-nstprrffrrpfpppspAKHIRAVLA  565
            +KSPFFPFYSPSPAH  F+KK+PARSPA   SS NSTP+RFF+RPFPPPSPAKHIRAVLA
Sbjct  54   KKSPFFPFYSPSPAHSFFSKKTPARSPATNASSGNSTPKRFFKRPFPPPSPAKHIRAVLA  113

Query  566  RRHGSVKPNGAAIPEGAESEGG----LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            RRHGSVKPN +AIPEG+E+EGG    LDKSFGFSK F +KYELG+EVGRGHFGYTC
Sbjct  114  RRHGSVKPNSSAIPEGSEAEGGGGVGLDKSFGFSKSFASKYELGDEVGRGHFGYTC  169



>ref|XP_006293901.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
 gb|EOA26799.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
Length=576

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARR+GS+KPN A+IPEG E E GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  78   AKHIRAFLARRYGSIKPNEASIPEGKECEIGLDKRFGFSKQFASHYEIDGEVGRGHFGYT  137

Query  719  C  721
            C
Sbjct  138  C  138



>gb|KFK34914.1| hypothetical protein AALP_AA5G210000 [Arabis alpina]
Length=582

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARR+GSVKPN A+IPEG+E + GLDK FGFSK F + YE+  EVGRGHFGYT
Sbjct  84   AKHIRAFLARRYGSVKPNEASIPEGSECDVGLDKKFGFSKQFVSHYEIDGEVGRGHFGYT  143

Query  719  C  721
            C
Sbjct  144  C  144



>ref|XP_010517599.1| PREDICTED: CDPK-related kinase 1 isoform X1 [Camelina sativa]
 ref|XP_010517600.1| PREDICTED: CDPK-related kinase 1 isoform X2 [Camelina sativa]
Length=571

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKH+RA LARR+GS+KPN  +IPEG E E GLDKSFGFSK F + YE+  EVGRGHFGYT
Sbjct  73   AKHLRAFLARRYGSIKPNEVSIPEGKECEIGLDKSFGFSKQFASHYEIDGEVGRGHFGYT  132

Query  719  C  721
            C
Sbjct  133  C  133



>gb|EPS69494.1| hypothetical protein M569_05270 [Genlisea aurea]
Length=657

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+AVLARRHGSVKPN +++P+  + +  GLDKSFGF+K+F +K+ELGEEVGRGHFGY
Sbjct  97   AKHIKAVLARRHGSVKPNESSLPDNNKLDAAGLDKSFGFAKNFYSKFELGEEVGRGHFGY  156

Query  716  TCR  724
            TCR
Sbjct  157  TCR  159



>ref|XP_010680435.1| PREDICTED: CDPK-related kinase 5 [Beta vulgaris subsp. vulgaris]
Length=598

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 113/178 (63%), Gaps = 30/178 (17%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  394
            MG+CTSKP  E                 +P    P++  N+      RN   GE+   +K
Sbjct  1    MGMCTSKPPTETH---------------LPDPKLPEDSTNE--HPPARN--SGEIPA-KK  40

Query  395  spffpfyspspAHYLFakksparspanapssnstprrff---rrpfpppspAKHIRAVLA  565
            SPFF  YSPSPAHYLF+KKSP  SPA   SSNS         +RPFPPPSPAKHI+AVLA
Sbjct  41   SPFFGIYSPSPAHYLFSKKSPLWSPATNASSNSNSNTPKRFFKRPFPPPSPAKHIKAVLA  100

Query  566  RRHGSVKPNGA-AIPEGAESEGG------LDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            RR G+VKPN A +IPEG+ES  G      LDK FGFSKHFG+KYE+GEEVGRGHFGYT
Sbjct  101  RRQGTVKPNVAGSIPEGSESSSGGVNGVGLDKRFGFSKHFGDKYEVGEEVGRGHFGYT  158



>emb|CDY22505.1| BnaC03g23150D [Brassica napus]
Length=568

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSV-KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRA LARR+GS  KPNG  IPEG E E GLDKSFGFSKHF + YE+  EVGRGHFGY
Sbjct  69   AKHIRAFLARRNGSTNKPNGVTIPEGKEFEIGLDKSFGFSKHFASHYEIDGEVGRGHFGY  128

Query  716  TC  721
            TC
Sbjct  129  TC  130



>gb|KHN47935.1| CDPK-related protein kinase [Glycine soja]
Length=579

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 93/175 (53%), Gaps = 40/175 (23%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGG------ENQQRNIKKGE  376
            MG+CTSKP  ++                     NP N  +          N   N++K  
Sbjct  1    MGLCTSKPRAKNA--------------------NPTNSSSLNSHTHFTDPNADENLRKNH  40

Query  377  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRA  556
                +KSP FPFY+PSPAH+LF+ KSPA +                        AKHIRA
Sbjct  41   TPTPKKSPLFPFYTPSPAHHLFSGKSPAPANPRRVFRPPPSP------------AKHIRA  88

Query  557  VLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            VLARRHGSVKPN A IPE  +    LDK+FGFSK F +K+E+G+EVGRGHFGYTC
Sbjct  89   VLARRHGSVKPNEATIPE--DEVVTLDKNFGFSKQFEHKFEVGDEVGRGHFGYTC  141



>ref|XP_010916660.1| PREDICTED: CDPK-related kinase 5 [Elaeis guineensis]
Length=609

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE----GAESEGGLDKSFGFSKHFGNKYELGEEVGRGH  706
            AKHIRAVLARRHGSVKPN  AIPE       +  GLDK+FGF K F +KYE+GEE+GRGH
Sbjct  106  AKHIRAVLARRHGSVKPNETAIPEEDGEAGRAVAGLDKNFGFEKGFTSKYEIGEEIGRGH  165

Query  707  FGYTC  721
            FGYTC
Sbjct  166  FGYTC  170



>ref|XP_003525704.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Glycine max]
Length=578

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 95/175 (54%), Gaps = 41/175 (23%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGG------ENQQRNIKKGE  376
            MG+CTSKP  ++                     NP N  +          N   N++K  
Sbjct  1    MGLCTSKPRAKNA--------------------NPTNSSSLNSHTHFTDPNADENLRKNH  40

Query  377  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRA  556
                +KSP FPFY+PSPAH+LF+ KSPA +         +P             AKHIRA
Sbjct  41   TPTPKKSPLFPFYTPSPAHHLFSGKSPAPANPRRFFRPPSP-------------AKHIRA  87

Query  557  VLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            VLARRHGSVKPN A IPE  +    LDK+FGFSK F +K+E+G+EVGRGHFGYTC
Sbjct  88   VLARRHGSVKPNEATIPE--DEVVTLDKNFGFSKQFEHKFEVGDEVGRGHFGYTC  140



>ref|XP_009389551.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESE----GGLDKSFGFSKHFGNKYELGEEVGRGH  706
            AKHIRAVLARR GSVKPN AAIP     E     GLDK+FGFSK F +KYE+GEEVGRGH
Sbjct  101  AKHIRAVLARRLGSVKPNEAAIPADDREERRAASGLDKNFGFSKGFASKYEIGEEVGRGH  160

Query  707  FGYTC  721
            FGYTC
Sbjct  161  FGYTC  165



>emb|CDY47375.1| BnaC04g24880D [Brassica napus]
Length=574

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGS-VKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRA LARRHGS  KP+ A+IPEG+E E GLDK+FGFSK FG+ YE+  EVGRGHFG+
Sbjct  75   AKHIRAFLARRHGSSTKPDQASIPEGSECEVGLDKAFGFSKQFGSYYEIDGEVGRGHFGF  134

Query  716  TC  721
            TC
Sbjct  135  TC  136



>ref|XP_008795162.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related kinase 5-like [Phoenix 
dactylifera]
Length=609

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE----GAESEGGLDKSFGFSKHFGNKYELGEEVGRGH  706
            AKHIRAVLARRHGSVKPN  AIPE       +  GLDK+FGF K F +KYE+GEE+GRGH
Sbjct  106  AKHIRAVLARRHGSVKPNETAIPEEDGEAGRAVTGLDKNFGFEKGFVSKYEIGEEIGRGH  165

Query  707  FGYTC  721
            FGYTC
Sbjct  166  FGYTC  170



>ref|XP_009133469.1| PREDICTED: CDPK-related kinase 1 [Brassica rapa]
Length=567

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSV-KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRA LARR+GS  KPN  +IPEG E E GLDKSFGFSKHF + YE+  EVGRGHFGY
Sbjct  68   AKHIRAFLARRNGSTNKPNEVSIPEGKEFEIGLDKSFGFSKHFASHYEIDGEVGRGHFGY  127

Query  716  TC  721
            TC
Sbjct  128  TC  129



>emb|CDY35427.1| BnaA03g19330D [Brassica napus]
Length=567

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSV-KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRA LARR+GS  KPN  +IPEG E E GLDKSFGFSKHF + YE+  EVGRGHFGY
Sbjct  68   AKHIRAFLARRNGSTNKPNEVSIPEGKEFEIGLDKSFGFSKHFASHYEIDGEVGRGHFGY  127

Query  716  TC  721
            TC
Sbjct  128  TC  129



>ref|XP_007155949.1| hypothetical protein PHAVU_003G2460000g, partial [Phaseolus vulgaris]
 gb|ESW27943.1| hypothetical protein PHAVU_003G2460000g, partial [Phaseolus vulgaris]
Length=474

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRAVLARRHGSVKPN A IPE  +    LDK+FGFSK F  K+E+G EVGRGHFGYT
Sbjct  79   AKHIRAVLARRHGSVKPNEATIPE--DEVVALDKNFGFSKQFEQKFEVGGEVGRGHFGYT  136

Query  719  C  721
            C
Sbjct  137  C  137



>ref|XP_009139075.1| PREDICTED: CDPK-related kinase 7-like [Brassica rapa]
Length=575

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGS-VKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRA LARRHGS  KP+ A+IPEG+E E GLDK+FGFSK FG  YE+  EVGRGHFG+
Sbjct  76   AKHIRAFLARRHGSSAKPDRASIPEGSECEVGLDKAFGFSKQFGAYYEIDGEVGRGHFGF  135

Query  716  TC  721
            TC
Sbjct  136  TC  137



>ref|XP_008669867.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Zea mays]
Length=246

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LARRHGSVK    +I EG E + GLDKSFG+S+HF  KY+LG EVGRGHFG+T
Sbjct  91   AKHIRALLARRHGSVK----SISEGGEPDLGLDKSFGYSRHFAAKYDLGREVGRGHFGFT  146

Query  719  C  721
            C
Sbjct  147  C  147



>gb|KFK36961.1| hypothetical protein AALP_AA4G195100 [Arabis alpina]
Length=579

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA LARR+GS K N  +IPEG E E GLDKSFGFSK FG+ YE+  EVGRGHFGYT
Sbjct  81   AKHIRAFLARRNGSNKRNEVSIPEGKECEIGLDKSFGFSKQFGSHYEIDGEVGRGHFGYT  140

Query  719  C  721
            C
Sbjct  141  C  141



>emb|CDY23873.1| BnaC04g01640D [Brassica napus]
Length=578

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSV--KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRA LARRHGS    P+  +IPEG E E GLDKSFGFSKHF + YE+  EVGRGHFG
Sbjct  78   AKHIRAFLARRHGSSAKPPSEVSIPEGEEFEIGLDKSFGFSKHFASHYEIDGEVGRGHFG  137

Query  713  YTC  721
            YTC
Sbjct  138  YTC  140



>emb|CDX79956.1| BnaA05g02000D [Brassica napus]
Length=577

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSV--KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRA LARRHGS    P+  +IPEG E E GLDKSFGFSKHF + YE+  EVGRGHFG
Sbjct  77   AKHIRAFLARRHGSSAKPPSEVSIPEGEEFEIGLDKSFGFSKHFASHYEIDGEVGRGHFG  136

Query  713  YTC  721
            YTC
Sbjct  137  YTC  139



>ref|XP_009142724.1| PREDICTED: CDPK-related kinase 1-like [Brassica rapa]
Length=577

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSV--KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRA LARRHGS    P+  +IPEG E E GLDKSFGFSKHF + YE+  EVGRGHFG
Sbjct  77   AKHIRAFLARRHGSSAKPPSEVSIPEGEEFEIGLDKSFGFSKHFASHYEIDGEVGRGHFG  136

Query  713  YTC  721
            YTC
Sbjct  137  YTC  139



>emb|CDY65016.1| BnaCnng45690D [Brassica napus]
Length=594

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRAVLARRHGSVKPN AAIPEG+E+EG GLDKSFGFSK F +KYELG+EVGRGHFGY
Sbjct  95   AKHIRAVLARRHGSVKPNSAAIPEGSEAEGVGLDKSFGFSKSFSSKYELGDEVGRGHFGY  154

Query  716  TC  721
            TC
Sbjct  155  TC  156



>gb|EPS59805.1| hypothetical protein M569_15001, partial [Genlisea aurea]
Length=195

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A LARRHGSVKPN AA     ++EG  LDK FGF+K+F +++++GEEVGRGHFGY
Sbjct  67   AKHIKAALARRHGSVKPNEAAGESKNQAEGANLDKRFGFAKNFYSRFDMGEEVGRGHFGY  126

Query  716  TCR  724
            TCR
Sbjct  127  TCR  129



>ref|XP_006404024.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
 gb|ESQ45477.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
Length=614

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIRAVLARRHGSVKPN AAIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHF
Sbjct  113  AKHIRAVLARRHGSVKPNSAAIPEGSEAEGGGVGLDKSFGFSKSFSSKYELGDEVGRGHF  172

Query  710  GYTC  721
            GYTC
Sbjct  173  GYTC  176



>emb|CDX76010.1| BnaA04g02740D [Brassica napus]
Length=570

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGS-VKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRA LARRHGS  KP+ A+IPEG+E E  LDK+FGFSK FG  YE+  EV RGHFG+
Sbjct  71   AKHIRAFLARRHGSSAKPDRASIPEGSECEARLDKAFGFSKQFGAYYEIDGEVARGHFGF  130

Query  716  TC  721
            TC
Sbjct  131  TC  132



>ref|XP_003611786.1| CDPK-related protein kinase [Medicago truncatula]
 gb|AES94744.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=587

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 5/63 (8%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIR++LARR GSV+    +IPEG E E    LDK+FGFSKHFG++YE+G+EVGRGHFG
Sbjct  90   AKHIRSLLARRRGSVE---VSIPEGGEEETVVALDKNFGFSKHFGSRYEVGDEVGRGHFG  146

Query  713  YTC  721
            YTC
Sbjct  147  YTC  149



>gb|ABK25039.1| unknown [Picea sitchensis]
Length=589

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A LA+R G+ KP    IPE G E+E  LDKSFG+SK+F +KYELG EVGRGHFG+
Sbjct  93   AKHIKASLAKRQGAPKPKDGPIPEDGVENERPLDKSFGYSKNFASKYELGHEVGRGHFGH  152

Query  716  TC  721
            TC
Sbjct  153  TC  154



>ref|XP_009101966.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Brassica rapa]
Length=578

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 50/63 (79%), Gaps = 6/63 (10%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRAVLARRHGSVK    AIPEG   E    LDKSFGFSK F +KYE+GEEVGRGHFG
Sbjct  82   AKHIRAVLARRHGSVK----AIPEGGGGESEVGLDKSFGFSKGFSSKYEVGEEVGRGHFG  137

Query  713  YTC  721
            YTC
Sbjct  138  YTC  140



>ref|XP_009101959.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Brassica rapa]
Length=608

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 50/63 (79%), Gaps = 6/63 (10%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRAVLARRHGSVK    AIPEG   E    LDKSFGFSK F +KYE+GEEVGRGHFG
Sbjct  82   AKHIRAVLARRHGSVK----AIPEGGGGESEVGLDKSFGFSKGFSSKYEVGEEVGRGHFG  137

Query  713  YTC  721
            YTC
Sbjct  138  YTC  140



>ref|XP_002973513.1| CDK related protein kinase 5 [Selaginella moellendorffii]
 gb|EFJ25173.1| CDK related protein kinase 5 [Selaginella moellendorffii]
Length=579

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A LA+RHG+ KP   +IPEG++ E  LDK+FG+ K+F +KYELG E+G GHFG+T
Sbjct  83   AKHIQAALAKRHGTAKPKEGSIPEGSDVEKPLDKNFGYGKNFTSKYELGHEIGHGHFGHT  142

Query  719  C  721
            C
Sbjct  143  C  143



>ref|XP_008654062.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Zea mays]
Length=215

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHIRA+LAR HGSVK    +I EG E + GLDKSFG+S+HF  KY+LG EVGR HFG+T
Sbjct  91   AKHIRALLARSHGSVK----SISEGGEPDLGLDKSFGYSRHFAAKYDLGREVGRDHFGFT  146



>emb|CDY65651.1| BnaCnng48080D [Brassica napus]
Length=585

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 49/63 (78%), Gaps = 6/63 (10%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRAVLARRHGSVK     IPEG   E    LDKSFGFSK F +KYE+GEEVGRGHFG
Sbjct  89   AKHIRAVLARRHGSVK----TIPEGGGGESEVGLDKSFGFSKGFSSKYEMGEEVGRGHFG  144

Query  713  YTC  721
            YTC
Sbjct  145  YTC  147



>ref|XP_006658886.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Oryza brachyantha]
Length=504

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  584  KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            +PN A+IPEG E E GLDKSFGFSKHF  KYELG+EVGRGHFGYTC
Sbjct  21   RPNEASIPEGGEPELGLDKSFGFSKHFFAKYELGDEVGRGHFGYTC  66



>gb|KDO86572.1| hypothetical protein CISIN_1g007498mg [Citrus sinensis]
Length=422

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP  + IPE  G E E  LDKSFG++K+FG KYELG+EVGRGHFG
Sbjct  102  AKHIKASLAKRLGGGKPKESTIPEERGTEPEQSLDKSFGYNKNFGAKYELGKEVGRGHFG  161

Query  713  YTC  721
            +TC
Sbjct  162  HTC  164



>ref|XP_003528501.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRAVLARR G      AAIPE G E    LDK FGFSK F ++ E+GEEVGRGHFGY
Sbjct  98   AKHIRAVLARRQGKKASATAAIPEEGEEGAADLDKRFGFSKEFTSRLEVGEEVGRGHFGY  157

Query  716  TC  721
            TC
Sbjct  158  TC  159



>ref|XP_003520170.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRAVLARR G      AAIPE G E    LDK FGFSK F ++ E+GEEVGRGHFGY
Sbjct  98   AKHIRAVLARRQGKKASATAAIPEEGEEGAADLDKRFGFSKEFTSRLEVGEEVGRGHFGY  157

Query  716  TC  721
            TC
Sbjct  158  TC  159



>ref|XP_006651413.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Oryza brachyantha]
Length=515

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  578  SVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            SVKPN A+IPE  E   GLDKSFGFSKHF  KYELG EVGRGHFGYTC
Sbjct  28   SVKPNEASIPESGEPGVGLDKSFGFSKHFAAKYELGREVGRGHFGYTC  75



>ref|XP_011088749.1| PREDICTED: CDPK-related protein kinase-like [Sesamum indicum]
Length=559

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKH++AVL R H +VKP+  AI EG E E  LDKSFGFS  FG+++++GEEVGRGHFGYT
Sbjct  60   AKHLKAVLLRTHAAVKPSAGAIKEGEEEEPELDKSFGFSNKFGSRFQVGEEVGRGHFGYT  119

Query  719  C  721
            C
Sbjct  120  C  120



>dbj|BAK06421.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 5/63 (8%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIR  LARRHG  +P   AIPE  +S+GG  LDK FGF+K F  KY+LG+EVGRGHFG
Sbjct  94   AKHIRQALARRHGPSRP---AIPEEGDSDGGRGLDKGFGFNKGFAAKYDLGDEVGRGHFG  150

Query  713  YTC  721
            YTC
Sbjct  151  YTC  153



>ref|XP_002975545.1| CDPK-related protein kinase 3 [Selaginella moellendorffii]
 gb|EFJ23174.1| CDPK-related protein kinase 3 [Selaginella moellendorffii]
Length=579

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI+A LA+RHG+ KP   +IPEG++ E  LDK+F + K+F +KYELG E+G GHFG+T
Sbjct  83   AKHIQAALAKRHGTAKPKEGSIPEGSDVEKPLDKNFVYGKNFTSKYELGHEIGHGHFGHT  142

Query  719  C  721
            C
Sbjct  143  C  143



>ref|XP_004166903.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related protein kinase-like 
[Cucumis sativus]
Length=609

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  GAE E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  111  AKHIKASLAKRFGYTKPKEGPIPEERGAEPEQLLDKSFGYGKNFGAKYELGKEVGRGHFG  170

Query  713  YTC  721
            +TC
Sbjct  171  HTC  173



>ref|XP_004140506.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN46527.1| hypothetical protein Csa_6G106790 [Cucumis sativus]
Length=609

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  GAE E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  111  AKHIKASLAKRFGYTKPKEGPIPEERGAEPEQLLDKSFGYGKNFGAKYELGKEVGRGHFG  170

Query  713  YTC  721
            +TC
Sbjct  171  HTC  173



>ref|XP_006444766.1| hypothetical protein CICLE_v10019386mg [Citrus clementina]
 ref|XP_006491344.1| PREDICTED: CDPK-related kinase 3-like [Citrus sinensis]
 gb|ESR58006.1| hypothetical protein CICLE_v10019386mg [Citrus clementina]
 gb|KDO86571.1| hypothetical protein CISIN_1g007498mg [Citrus sinensis]
Length=601

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP  + IPE  G E E  LDKSFG++K+FG KYELG+EVGRGHFG
Sbjct  102  AKHIKASLAKRLGGGKPKESTIPEERGTEPEQSLDKSFGYNKNFGAKYELGKEVGRGHFG  161

Query  713  YTC  721
            +TC
Sbjct  162  HTC  164



>ref|XP_008459758.1| PREDICTED: CDPK-related kinase 3 isoform X1 [Cucumis melo]
Length=609

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  GAE E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  111  AKHIKASLAKRFGYTKPKEGPIPEERGAEPEQLLDKSFGYGKNFGAKYELGKEVGRGHFG  170

Query  713  YTC  721
            +TC
Sbjct  171  HTC  173



>gb|EMT32885.1| hypothetical protein F775_33150 [Aegilops tauschii]
Length=127

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  542  KHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            KHIRA++ R HG  KPN A+IPEG E + G+DK F F KHF  KYELGEE    HFGYT
Sbjct  24   KHIRALMGRGHGPAKPNEASIPEGGEPKLGMDKGFSFCKHFFGKYELGEEASCIHFGYT  82



>ref|XP_004308284.1| PREDICTED: CDPK-related kinase 3 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=608

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP  + IPE  G E E  LDKSFG+SK+FG KYELG+EVGRGHFG
Sbjct  110  AKHIKASLAKRFGQ-KPKESPIPEEQGVEPEQSLDKSFGYSKNFGAKYELGKEVGRGHFG  168

Query  713  YTC  721
            +TC
Sbjct  169  HTC  171



>ref|XP_002266654.1| PREDICTED: CDPK-related kinase 3 isoform X1 [Vitis vinifera]
 emb|CBI38688.3| unnamed protein product [Vitis vinifera]
Length=591

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A LA+R G  KP    IPE G E E  LDKSFG+ K+FG KYELG+EVGRGHFG+
Sbjct  93   AKHIKASLAKRLGPAKPKEGPIPEEGTEPEQLLDKSFGYGKNFGAKYELGKEVGRGHFGH  152

Query  716  TC  721
            TC
Sbjct  153  TC  154



>ref|XP_010661483.1| PREDICTED: CDPK-related kinase 3 isoform X2 [Vitis vinifera]
Length=570

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A LA+R G  KP    IPE G E E  LDKSFG+ K+FG KYELG+EVGRGHFG+
Sbjct  93   AKHIKASLAKRLGPAKPKEGPIPEEGTEPEQLLDKSFGYGKNFGAKYELGKEVGRGHFGH  152

Query  716  TC  721
            TC
Sbjct  153  TC  154



>ref|XP_010507983.1| PREDICTED: CDPK-related kinase 3-like [Camelina sativa]
Length=596

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A L +R G VKP    IPE  G E E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  97   AKHIKASLIKRLGGVKPKEGPIPEERGTEPEQSLDKSFGYGKNFGAKYELGKEVGRGHFG  156

Query  713  YTC  721
            +TC
Sbjct  157  HTC  159



>ref|XP_008236646.1| PREDICTED: CDPK-related kinase 5-like [Prunus mume]
Length=596

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+AVLARR G       AIPE AE E G  LDK FGFSK   ++ E+G+EVGRGHFG
Sbjct  96   AKHIKAVLARRLGKKASASVAIPEDAEDEDGVELDKRFGFSKELTSRLEVGDEVGRGHFG  155

Query  713  YTC  721
            YTC
Sbjct  156  YTC  158



>ref|XP_007199766.1| hypothetical protein PRUPE_ppa003176mg [Prunus persica]
 gb|EMJ00965.1| hypothetical protein PRUPE_ppa003176mg [Prunus persica]
Length=596

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+AVLARR G       AIPE AE E G  LDK FGFSK   ++ E+G+EVGRGHFG
Sbjct  96   AKHIKAVLARRLGKKASASVAIPEDAEDEDGVELDKRFGFSKELTSRLEVGDEVGRGHFG  155

Query  713  YTC  721
            YTC
Sbjct  156  YTC  158



>gb|EEE59103.1| hypothetical protein OsJ_10960 [Oryza sativa Japonica Group]
Length=574

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  584  KPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
            +PN A IPEG E+E GLDK FGFSKHF  KYELG+EVGRGHFGYTC
Sbjct  91   RPNEAPIPEGGETEVGLDKGFGFSKHFFAKYELGDEVGRGHFGYTC  136



>ref|XP_010251747.1| PREDICTED: CDPK-related kinase 3-like [Nelumbo nucifera]
 ref|XP_010251754.1| PREDICTED: CDPK-related kinase 3-like [Nelumbo nucifera]
Length=592

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A +A+R G  KP    IPE GA+ E  LDKSFG+ K+FG KYELG+EVGRGHFG+
Sbjct  95   AKHIKASIAKRLGPPKPKEGPIPEDGADVERPLDKSFGYGKNFGAKYELGKEVGRGHFGH  154

Query  716  TC  721
            TC
Sbjct  155  TC  156



>ref|XP_010906427.1| PREDICTED: CDPK-related kinase 3-like isoform X4 [Elaeis guineensis]
Length=587

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  G E E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  103  AKHIKAALAKRLGPPKPKEGPIPEDGGEEVERPLDKSFGYGKNFGAKYELGKEVGRGHFG  162

Query  713  YTC  721
            +TC
Sbjct  163  HTC  165



>ref|XP_010906425.1| PREDICTED: CDPK-related kinase 3-like isoform X2 [Elaeis guineensis]
Length=605

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  G E E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  103  AKHIKAALAKRLGPPKPKEGPIPEDGGEEVERPLDKSFGYGKNFGAKYELGKEVGRGHFG  162

Query  713  YTC  721
            +TC
Sbjct  163  HTC  165



>ref|XP_003608023.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
 gb|AES90220.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=592

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHIRAVLARR G  K   AAIPE G E  G LDK FGFSK F +K E+GEEVGRGHFGY
Sbjct  93   AKHIRAVLARRQG--KKEAAAIPEEGEEGAGDLDKRFGFSKDFASKLEVGEEVGRGHFGY  150

Query  716  T  718
            T
Sbjct  151  T  151



>ref|XP_010906424.1| PREDICTED: CDPK-related kinase 3-like isoform X1 [Elaeis guineensis]
Length=606

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  G E E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  103  AKHIKAALAKRLGPPKPKEGPIPEDGGEEVERPLDKSFGYGKNFGAKYELGKEVGRGHFG  162

Query  713  YTC  721
            +TC
Sbjct  163  HTC  165



>ref|XP_010906426.1| PREDICTED: CDPK-related kinase 3-like isoform X3 [Elaeis guineensis]
Length=601

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  G E E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  103  AKHIKAALAKRLGPPKPKEGPIPEDGGEEVERPLDKSFGYGKNFGAKYELGKEVGRGHFG  162

Query  713  YTC  721
            +TC
Sbjct  163  HTC  165



>ref|XP_002281956.2| PREDICTED: CDPK-related kinase 5 [Vitis vinifera]
 emb|CBI32452.3| unnamed protein product [Vitis vinifera]
Length=584

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 94/175 (54%), Gaps = 36/175 (21%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEG-GR  391
            MG+C SKP                       K NP   E+         + K E EG G+
Sbjct  1    MGICASKPP----------------------KQNPYAPESLEPSATPGAVSKDEAEGPGK  38

Query  392  KspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARR  571
            +SPFFPFYSPSPAHYLF+KKSPA   A++       R F          AKHI+AVLARR
Sbjct  39   RSPFFPFYSPSPAHYLFSKKSPAVRSASSTPRRFFKRPFPPPSP-----AKHIKAVLARR  93

Query  572  HGSVKPNGAAIPEGAESEGG-----LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
             G      AAIPEG   E       LDKSFGFSK F +KYE+GEEVGRGHFGYTC
Sbjct  94   QGK---KAAAIPEGEGEEEEAAAGGLDKSFGFSKQFTSKYEVGEEVGRGHFGYTC  145



>emb|CAN82235.1| hypothetical protein VITISV_007568 [Vitis vinifera]
Length=584

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 94/175 (54%), Gaps = 36/175 (21%)
 Frame = +2

Query  215  MGVCTSKPSLEHRDWRNDQ*TDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEG-GR  391
            MG+C SKP                       K NP   E+         + K E EG G+
Sbjct  1    MGICASKPP----------------------KQNPYAPESLEPSATPGAVSKDEAEGPGK  38

Query  392  KspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARR  571
            +SPFFPFYSPSPAHYLF+KKSPA   A++       R F          AKHI+AVLARR
Sbjct  39   RSPFFPFYSPSPAHYLFSKKSPAVRSASSTPRRFFKRPFPPPSP-----AKHIKAVLARR  93

Query  572  HGSVKPNGAAIPEGAESEGG-----LDKSFGFSKHFGNKYELGEEVGRGHFGYTC  721
             G      AAIPEG   E       LDKSFGFSK F +KYE+GEEVGRGHFGYTC
Sbjct  94   QGK---KAAAIPEGEGEEEEAAAGGLDKSFGFSKQFTSKYEVGEEVGRGHFGYTC  145



>ref|XP_010906428.1| PREDICTED: CDPK-related kinase 3-like isoform X5 [Elaeis guineensis]
Length=585

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  G E E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  103  AKHIKAALAKRLGPPKPKEGPIPEDGGEEVERPLDKSFGYGKNFGAKYELGKEVGRGHFG  162

Query  713  YTC  721
            +TC
Sbjct  163  HTC  165



>ref|XP_008357862.1| PREDICTED: CDPK-related kinase 3-like [Malus domestica]
Length=480

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 4/63 (6%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP  + IPE  GAE E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  100  AKHIKASLAKRFG--KPKESPIPEEGGAEPEQSLDKSFGYGKNFGAKYELGKEVGRGHFG  157

Query  713  YTC  721
            +TC
Sbjct  158  HTC  160



>ref|XP_009375449.1| PREDICTED: CDPK-related kinase 3 isoform X1 [Pyrus x bretschneideri]
Length=597

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 4/63 (6%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP  + IPE  GAE E  LDKSFG+ K+FG KYELG+EVGRGHFG
Sbjct  100  AKHIKASLAKRFG--KPKESPIPEEGGAEPEQSLDKSFGYGKNFGAKYELGKEVGRGHFG  157

Query  713  YTC  721
            +TC
Sbjct  158  HTC  160



>ref|XP_010267444.1| PREDICTED: CDPK-related kinase 3 isoform X2 [Nelumbo nucifera]
Length=552

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A LA+R G  +P    IPE G + E  LDKSFG+ K+FG KYELG+EVGRGHFG+
Sbjct  91   AKHIKATLAKRLGPPRPKEGPIPEHGTDVERPLDKSFGYGKNFGAKYELGKEVGRGHFGH  150

Query  716  TC  721
            TC
Sbjct  151  TC  152



>ref|XP_010267443.1| PREDICTED: CDPK-related kinase 3 isoform X1 [Nelumbo nucifera]
Length=588

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A LA+R G  +P    IPE G + E  LDKSFG+ K+FG KYELG+EVGRGHFG+
Sbjct  91   AKHIKATLAKRLGPPRPKEGPIPEHGTDVERPLDKSFGYGKNFGAKYELGKEVGRGHFGH  150

Query  716  TC  721
            TC
Sbjct  151  TC  152



>ref|XP_009418319.1| PREDICTED: CDPK-related kinase 3-like [Musa acuminata subsp. 
malaccensis]
Length=599

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHI+A LA+R GS KP   +IPE    E     LDKSFG+ K+FG+KYELG+EVGRGHF
Sbjct  99   AKHIKAALAKRLGSEKPKEGSIPEAVTGEAEQPPLDKSFGYGKNFGSKYELGKEVGRGHF  158

Query  710  GYTC  721
            G TC
Sbjct  159  GNTC  162



>ref|XP_003626588.1| Calcium dependent protein kinase-like protein [Medicago truncatula]
 gb|AES82806.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=596

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEG-GLDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIR  LA+R G  KP    IPE  G E++   LDKSFG+SK+FG KYELG+EVGRGHF
Sbjct  96   AKHIRESLAKRLGKAKPKEGPIPEEHGVETDSQSLDKSFGYSKNFGAKYELGKEVGRGHF  155

Query  710  GYTC  721
            G+TC
Sbjct  156  GHTC  159



>ref|XP_004494853.1| PREDICTED: CDPK-related kinase 3-like [Cicer arietinum]
Length=593

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIR  LA+R G  KP    IPE +  EG    LDKSFG+SK+FG KYELG+EVGRGHF
Sbjct  93   AKHIRESLAKRLGKAKPKEGPIPEESGVEGDSQSLDKSFGYSKNFGAKYELGKEVGRGHF  152

Query  710  GYTC  721
            G+TC
Sbjct  153  GHTC  156



>ref|XP_004136991.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 ref|XP_008454927.1| PREDICTED: CDPK-related kinase 5 [Cucumis melo]
 gb|KGN43947.1| hypothetical protein Csa_7G074310 [Cucumis sativus]
Length=603

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHIRAVLARR G    + AAIPE  + E G  LDK FGFSK   ++ E+GEEVGRGHFG
Sbjct  102  AKHIRAVLARRLGKKAGSTAAIPEEGDEESGIELDKRFGFSKELTSRLEVGEEVGRGHFG  161

Query  713  YTC  721
            YTC
Sbjct  162  YTC  164



>ref|XP_001751663.1| predicted protein [Physcomitrella patens]
 gb|EDQ83980.1| predicted protein [Physcomitrella patens]
Length=546

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI++ L +RHG+    G ++PE  E+E  LDK F +SK F NKYELG EVGRGHFG+T
Sbjct  48   AKHIQSSLVKRHGAKPKEGGSVPESVENEKPLDKHFRYSKDFMNKYELGHEVGRGHFGHT  107

Query  719  C  721
            C
Sbjct  108  C  108



>ref|XP_008776463.1| PREDICTED: CDPK-related kinase 3-like isoform X1 [Phoenix dactylifera]
Length=597

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  G E E  LDK+FG+ K+FG KYELG+EVGRGHFG
Sbjct  95   AKHIKAALAKRLGPPKPKEGPIPEDGGEEVERPLDKNFGYGKNFGAKYELGKEVGRGHFG  154

Query  713  YTC  721
            +TC
Sbjct  155  HTC  157



>ref|XP_008776464.1| PREDICTED: CDPK-related kinase 3-like isoform X2 [Phoenix dactylifera]
Length=593

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  KP    IPE  G E E  LDK+FG+ K+FG KYELG+EVGRGHFG
Sbjct  95   AKHIKAALAKRLGPPKPKEGPIPEDGGEEVERPLDKNFGYGKNFGAKYELGKEVGRGHFG  154

Query  713  YTC  721
            +TC
Sbjct  155  HTC  157



>ref|XP_006846568.1| hypothetical protein AMTR_s00018p00240170 [Amborella trichopoda]
 gb|ERN08243.1| hypothetical protein AMTR_s00018p00240170 [Amborella trichopoda]
Length=587

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGY  715
            AKHI+A L +R G  KP    IPE G E E  LDK+FG+SK+F +KYELG+EVGRGHFG+
Sbjct  89   AKHIKASLVKRLGPQKPKEGPIPEDGTEVERPLDKNFGYSKNFTSKYELGKEVGRGHFGH  148

Query  716  TC  721
            TC
Sbjct  149  TC  150



>ref|XP_001763397.1| predicted protein [Physcomitrella patens]
 gb|EDQ71927.1| predicted protein [Physcomitrella patens]
Length=547

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFGYT  718
            AKHI++ L +RHG+    G AIPE  + E  LDK FG+ K+F  KYELG EVGRGHFG+T
Sbjct  49   AKHIQSSLVKRHGAKPKEGGAIPEAVDGEKPLDKHFGYHKNFATKYELGHEVGRGHFGHT  108

Query  719  C  721
            C
Sbjct  109  C  109



>ref|XP_010100681.1| CDPK-related protein kinase [Morus notabilis]
 gb|EXB83843.1| CDPK-related protein kinase [Morus notabilis]
Length=663

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFGNKYELGEEVGRGHFG  712
            AKHI+A LA+R G  +P    IPE  G E E  LDK+FG+SK+ G KYELG EVGRGHFG
Sbjct  178  AKHIKASLAKRLGHGRPKDGPIPEERGVEPEQALDKTFGYSKNLGAKYELGAEVGRGHFG  237

Query  713  YTC  721
            +TC
Sbjct  238  HTC  240



>gb|KFK34304.1| hypothetical protein AALP_AA5G127600 [Arabis alpina]
Length=598

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 56/64 (88%), Gaps = 6/64 (9%)
 Frame = +2

Query  539  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG---LDKSFGFSKHFGNKYELGEEVGRGHF  709
            AKHIRAVLARRHGSVK   +AIPEG+E+EGG   LDKSFGFSK F +KYELG+EVGRGHF
Sbjct  100  AKHIRAVLARRHGSVK---SAIPEGSEAEGGGVGLDKSFGFSKSFSSKYELGDEVGRGHF  156

Query  710  GYTC  721
            GYTC
Sbjct  157  GYTC  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440