BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044A23

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP41926.1|  hypothetical protein JCGZ_26944                         330   2e-108   Jatropha curcas
gb|KJB68286.1|  hypothetical protein B456_010G236500                    328   2e-107   Gossypium raimondii
gb|KJB68285.1|  hypothetical protein B456_010G236500                    328   2e-107   Gossypium raimondii
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    328   2e-107   
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    328   3e-107   Eucalyptus grandis [rose gum]
gb|KHG09631.1|  Serine incorporator 3                                   327   8e-107   Gossypium arboreum [tree cotton]
ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   325   2e-106   Tarenaya hassleriana [spider flower]
gb|KJB67012.1|  hypothetical protein B456_010G170100                    324   3e-106   Gossypium raimondii
gb|EPS57849.1|  hypothetical protein M569_16968                         318   6e-106   Genlisea aurea
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g             322   7e-106   
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       324   8e-106   Glycine max [soybeans]
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    324   9e-106   
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            323   1e-105   Solanum lycopersicum
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                323   1e-105   Erythranthe guttata [common monkey flower]
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                323   2e-105   Erythranthe guttata [common monkey flower]
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             323   2e-105   Eutrema salsugineum [saltwater cress]
gb|KJB67006.1|  hypothetical protein B456_010G170100                    323   3e-105   Gossypium raimondii
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    322   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    322   4e-105   Solanum tuberosum [potatoes]
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    322   4e-105   Nicotiana sylvestris
emb|CDX81752.1|  BnaC08g38490D                                          322   5e-105   
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    322   5e-105   Nicotiana sylvestris
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    322   5e-105   Solanum tuberosum [potatoes]
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        322   5e-105   Brassica rapa
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       322   6e-105   Cicer arietinum [garbanzo]
ref|XP_002890152.1|  TMS membrane family protein                        322   7e-105   
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              322   7e-105   Brassica rapa
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            322   8e-105   Sesamum indicum [beniseed]
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              321   9e-105   
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            321   1e-104   Populus euphratica
gb|ABK96018.1|  unknown                                                 321   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002297693.2|  TMS membrane family protein                        321   1e-104   
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            320   2e-104   Populus euphratica
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             320   2e-104   Phaseolus vulgaris [French bean]
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            320   3e-104   Sesamum indicum [beniseed]
gb|KJB68287.1|  hypothetical protein B456_010G236500                    319   6e-104   Gossypium raimondii
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    319   6e-104   Nicotiana tomentosiformis
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    319   6e-104   Nicotiana tomentosiformis
ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        319   7e-104   
emb|CDY70974.1|  BnaAnng35710D                                          319   7e-104   Brassica napus [oilseed rape]
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             318   1e-103   Capsella rubella
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            318   1e-103   Vitis vinifera
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       318   2e-103   Citrus sinensis [apfelsine]
emb|CDO98258.1|  unnamed protein product                                317   3e-103   Coffea canephora [robusta coffee]
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             317   5e-103   Citrus clementina [clementine]
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       317   5e-103   Glycine max [soybeans]
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            316   1e-102   
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            316   1e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009354238.1|  PREDICTED: probable serine incorporator            316   1e-102   Pyrus x bretschneideri [bai li]
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            315   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   315   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            315   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            314   6e-102   Pyrus x bretschneideri [bai li]
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            310   3e-100   Elaeis guineensis
emb|CDX83957.1|  BnaC08g16880D                                          320   6e-100   
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            308   1e-99    
ref|XP_010107188.1|  putative serine incorporator                       308   1e-99    Morus notabilis
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       307   4e-99    
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    305   2e-98    Elaeis guineensis
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    305   2e-98    Elaeis guineensis
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             305   3e-98    Prunus persica
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            305   3e-98    Prunus mume [ume]
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            304   6e-98    Phoenix dactylifera
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    303   2e-97    Cucumis melo [Oriental melon]
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            299   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            298   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN80335.1|  hypothetical protein VITISV_009414                     295   6e-95    Vitis vinifera
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    296   7e-95    Medicago truncatula
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    294   3e-94    Phoenix dactylifera
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              293   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            290   1e-92    Brachypodium distachyon [annual false brome]
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          290   2e-92    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048364.1|  Os02g0792900                                       289   5e-92    
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       288   6e-92    Setaria italica
ref|NP_001130490.1|  hypothetical protein precursor                     288   7e-92    Zea mays [maize]
gb|ACL54492.1|  unknown                                                 287   3e-91    Zea mays [maize]
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          286   7e-91    Sorghum bicolor [broomcorn]
emb|CDY52849.1|  BnaA09g56410D                                          284   2e-90    Brassica napus [oilseed rape]
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    285   2e-90    Medicago truncatula
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          284   4e-90    Amborella trichopoda
gb|EMT13726.1|  Putative serine incorporator                            279   3e-88    
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       276   4e-87    
ref|XP_011466994.1|  PREDICTED: serine incorporator 3                   276   4e-87    Fragaria vesca subsp. vesca
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       274   1e-86    
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             269   2e-84    
gb|ABR16232.1|  unknown                                                 263   3e-82    Picea sitchensis
gb|ABR17762.1|  unknown                                                 263   4e-82    Picea sitchensis
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            256   3e-79    Nelumbo nucifera [Indian lotus]
gb|AFK46909.1|  unknown                                                 252   2e-78    Lotus japonicus
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                   251   2e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              250   5e-77    
ref|XP_008799134.1|  PREDICTED: probable serine incorporator            248   3e-76    Phoenix dactylifera
ref|XP_001765634.1|  predicted protein                                  240   3e-73    
ref|XP_002882452.1|  TMS membrane family protein                        237   5e-72    Arabidopsis lyrata subsp. lyrata
emb|CDY24707.1|  BnaA05g31060D                                          236   7e-72    Brassica napus [oilseed rape]
ref|XP_009129653.1|  PREDICTED: probable serine incorporator            236   7e-72    Brassica rapa
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...    236   2e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KDO46126.1|  hypothetical protein CISIN_1g032312mg                   227   2e-71    Citrus sinensis [apfelsine]
ref|XP_010103434.1|  putative serine incorporator                       235   3e-71    Morus notabilis
gb|KJB28194.1|  hypothetical protein B456_005G040500                    231   3e-71    Gossypium raimondii
emb|CDY05246.1|  BnaC05g45570D                                          234   5e-71    
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg             234   5e-71    Citrus clementina [clementine]
ref|XP_008223013.1|  PREDICTED: probable serine incorporator            234   7e-71    Prunus mume [ume]
ref|XP_008340909.1|  PREDICTED: probable serine incorporator            234   8e-71    Malus domestica [apple tree]
emb|CDO98987.1|  unnamed protein product                                234   9e-71    Coffea canephora [robusta coffee]
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg             233   1e-70    
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg             233   3e-70    Prunus persica
gb|KJB28193.1|  hypothetical protein B456_005G040500                    233   3e-70    Gossypium raimondii
gb|KDP40096.1|  hypothetical protein JCGZ_02094                         232   3e-70    Jatropha curcas
ref|XP_010486107.1|  PREDICTED: probable serine incorporator            232   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010464184.1|  PREDICTED: probable serine incorporator            232   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010436570.1|  PREDICTED: probable serine incorporator            232   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336             231   7e-70    
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126             230   7e-70    
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                   230   2e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                   230   3e-69    Solanum lycopersicum
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg             229   3e-69    Eutrema salsugineum [saltwater cress]
ref|XP_010938752.1|  PREDICTED: probable serine incorporator            229   4e-69    Elaeis guineensis
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...    229   5e-69    
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like              229   7e-69    Solanum tuberosum [potatoes]
ref|XP_010237604.1|  PREDICTED: probable serine incorporator            229   8e-69    Brachypodium distachyon [annual false brome]
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                   228   2e-68    Vitis vinifera
ref|XP_009799680.1|  PREDICTED: probable serine incorporator            227   3e-68    Nicotiana sylvestris
ref|XP_009623079.1|  PREDICTED: probable serine incorporator            227   4e-68    Nicotiana tomentosiformis
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative              226   1e-67    Ricinus communis
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like       226   1e-67    Setaria italica
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2        226   1e-67    Tarenaya hassleriana [spider flower]
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1        225   1e-67    Tarenaya hassleriana [spider flower]
ref|XP_011090806.1|  PREDICTED: probable serine incorporator            224   7e-67    Sesamum indicum [beniseed]
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840          223   2e-66    Sorghum bicolor [broomcorn]
gb|KCW60869.1|  hypothetical protein EUGRSUZ_H03603                     222   2e-66    Eucalyptus grandis [rose gum]
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                   222   3e-66    Eucalyptus grandis [rose gum]
ref|NP_001130812.1|  uncharacterized protein LOC100191916               222   4e-66    Zea mays [maize]
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...    221   9e-66    Pyrus x bretschneideri [bai li]
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...    221   1e-65    Pyrus x bretschneideri [bai li]
ref|XP_009342179.1|  PREDICTED: probable serine incorporator            221   1e-65    Pyrus x bretschneideri [bai li]
ref|XP_008390818.1|  PREDICTED: probable serine incorporator            220   3e-65    
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg                219   6e-65    Erythranthe guttata [common monkey flower]
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                   219   6e-65    Cucumis melo [Oriental melon]
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like              218   9e-65    Cucumis sativus [cucumbers]
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...    218   1e-64    
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like       218   2e-64    Oryza brachyantha
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like       217   2e-64    Cicer arietinum [garbanzo]
gb|EPS68630.1|  hypothetical protein M569_06136                         216   4e-64    Genlisea aurea
gb|ACJ84561.1|  unknown                                                 214   2e-63    Medicago truncatula
gb|ABF97020.1|  TMS membrane family protein, putative, expressed        210   5e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002312742.1|  TMS membrane family protein                        211   9e-62    Populus trichocarpa [western balsam poplar]
ref|NP_001050476.1|  Os03g0454100                                       210   1e-61    
ref|XP_011010290.1|  PREDICTED: probable serine incorporator            209   3e-61    Populus euphratica
ref|XP_004296950.1|  PREDICTED: probable serine incorporator            209   4e-61    Fragaria vesca subsp. vesca
dbj|BAJ86142.1|  predicted protein                                      206   6e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                   201   3e-58    Citrus sinensis [apfelsine]
gb|KHN37564.1|  Putative serine incorporator                            201   3e-58    Glycine soja [wild soybean]
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g             201   6e-58    Phaseolus vulgaris [French bean]
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                     185   4e-53    Eucalyptus grandis [rose gum]
gb|AFK34472.1|  unknown                                                 181   3e-52    Lotus japonicus
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like       173   6e-48    
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like              164   1e-45    Fragaria vesca subsp. vesca
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777              165   6e-45    
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130          159   9e-43    
gb|EMS53525.1|  putative serine incorporator                            157   2e-42    Triticum urartu
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...    158   1e-41    Coccomyxa subellipsoidea C-169
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...    145   1e-37    Zea mays [maize]
gb|KIZ05916.1|  putative serine incorporator                            142   6e-36    Monoraphidium neglectum
ref|XP_011397622.1|  putative serine incorporator                       142   7e-36    Auxenochlorella protothecoides
gb|AAF30310.1|AC018907_10  hypothetical protein                         137   8e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg             131   1e-32    
ref|XP_002506090.1|  predicted protein                                  130   2e-31    Micromonas commoda
emb|CAN71158.1|  hypothetical protein VITISV_036762                     127   5e-31    Vitis vinifera
ref|XP_006366267.1|  PREDICTED: cell wall integrity and stress re...    117   4e-29    Solanum tuberosum [potatoes]
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749              120   5e-28    Volvox carteri f. nagariensis
ref|XP_005850950.1|  hypothetical protein CHLNCDRAFT_48549              117   4e-27    Chlorella variabilis
ref|XP_003062471.1|  predicted protein                                  114   7e-26    Micromonas pusilla CCMP1545
ref|XP_001696805.1|  hypothetical protein CHLREDRAFT_192111             106   5e-24    Chlamydomonas reinhardtii
ref|XP_001753882.1|  predicted protein                                97.1    5e-20    
ref|XP_001416509.1|  predicted protein                                91.7    4e-18    Ostreococcus lucimarinus CCE9901
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891            87.0    2e-16    
ref|XP_001770496.1|  predicted protein                                84.3    2e-15    
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397           81.6    1e-14    Selaginella moellendorffii
ref|XP_002966499.1|  hypothetical protein SELMODRAFT_85365            82.0    1e-14    
ref|XP_003075128.1|  OJ1249_F12.26 gene product (ISS)                 80.9    3e-14    
emb|CEG01070.1|  TMS membrane protein/tumour differentially expre...  80.9    3e-14    Ostreococcus tauri
ref|XP_011091387.1|  PREDICTED: probable serine incorporator          77.8    4e-13    Sesamum indicum [beniseed]
gb|EJU04752.1|  TMS membrane protein                                  77.4    6e-13    Dacryopinax primogenitus
gb|KIJ14234.1|  hypothetical protein PAXINDRAFT_163421                77.4    7e-13    Paxillus involutus ATCC 200175
gb|EEH05886.1|  DNA mismatch repair protein pms1                      78.2    7e-13    Histoplasma capsulatum G186AR
gb|EGC49614.1|  DNA mismatch repair protein                           78.2    8e-13    Histoplasma capsulatum H88
gb|EER41787.1|  DNA mismatch repair protein                           78.2    8e-13    Histoplasma capsulatum H143
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           75.9    1e-12    Selaginella moellendorffii
ref|XP_008039450.1|  hypothetical protein TRAVEDRAFT_168740           76.3    2e-12    Trametes versicolor FP-101664 SS1
gb|KDQ57032.1|  hypothetical protein JAAARDRAFT_35631                 75.1    4e-12    Jaapia argillacea MUCL 33604
ref|XP_009161557.1|  hypothetical protein HMPREF1120_09034            72.8    2e-11    Exophiala dermatitidis NIH/UT8656
gb|KGQ04935.1|  Membrane protein TMS1                                 72.4    3e-11    Beauveria bassiana D1-5
gb|KIV97946.1|  hypothetical protein PV10_01642                       72.0    3e-11    Exophiala mesophila
ref|XP_005646031.1|  Serinc-domain-containing protein                 71.6    4e-11    Coccomyxa subellipsoidea C-169
ref|XP_008731904.1|  hypothetical protein G647_09379                  72.0    4e-11    Cladophialophora carrionii CBS 160.54
gb|KIK77929.1|  hypothetical protein PAXRUDRAFT_834805                71.6    5e-11    Paxillus rubicundulus Ve08.2h10
ref|XP_002968524.1|  hypothetical protein SELMODRAFT_89240            71.6    5e-11    
gb|KFH68151.1|  hypothetical protein MVEG_06880                       71.6    6e-11    Mortierella verticillata NRRL 6337
ref|XP_007744780.1|  hypothetical protein A1O5_05994                  71.2    8e-11    Cladophialophora psammophila CBS 110553
gb|KIW58600.1|  hypothetical protein PV05_03105                       70.9    8e-11    Exophiala xenobiotica
ref|NP_001053258.1|  Os04g0506300                                     70.9    8e-11    
ref|XP_006668148.1|  membrane protein TMS1, putative                  70.9    8e-11    Cordyceps militaris CM01
gb|KIW94765.1|  hypothetical protein Z519_04742                       70.9    9e-11    Cladophialophora bantiana CBS 173.52
ref|XP_002426175.1|  serine incorporator, putative                    70.5    1e-10    Pediculus humanus corporis [human body lice]
ref|XP_007709253.1|  hypothetical protein COCCADRAFT_88158            70.5    1e-10    Bipolaris zeicola 26-R-13
gb|KIV83375.1|  hypothetical protein PV11_05406                       70.5    1e-10    Exophiala sideris
gb|EMD93772.1|  hypothetical protein COCHEDRAFT_1132482               70.5    1e-10    Bipolaris maydis C5
gb|KIM58348.1|  hypothetical protein SCLCIDRAFT_1218695               70.5    1e-10    Scleroderma citrinum Foug A
ref|XP_007687418.1|  hypothetical protein COCMIDRAFT_93798            70.5    1e-10    Bipolaris oryzae ATCC 44560
ref|XP_007701878.1|  hypothetical protein COCSADRAFT_121304           70.1    2e-10    Bipolaris sorokiniana ND90Pr
gb|EMS18351.1|  TMS membrane protein family                           70.1    2e-10    Rhodotorula toruloides NP11
gb|EUN26863.1|  hypothetical protein COCVIDRAFT_99736                 70.1    2e-10    Bipolaris victoriae FI3
ref|XP_002515588.1|  conserved hypothetical protein                   69.7    2e-10    Ricinus communis
gb|KIX04087.1|  hypothetical protein Z518_07640                       69.7    2e-10    Rhinocladiella mackenziei CBS 650.93
ref|XP_006340916.1|  PREDICTED: probable serine incorporator-like     69.7    2e-10    Solanum tuberosum [potatoes]
gb|KIW63213.1|  hypothetical protein PV04_10077                       69.7    2e-10    Phialophora americana
gb|KDN52824.1|  TMS membrane protein/tumor differentially express...  69.7    2e-10    Tilletiaria anomala UBC 951
ref|XP_007761600.1|  hypothetical protein A1O7_09422                  69.7    3e-10    Cladophialophora yegresii CBS 114405
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          69.3    3e-10    Nelumbo nucifera [Indian lotus]
gb|KHN33071.1|  hypothetical protein glysoja_010062                   65.5    3e-10    Glycine soja [wild soybean]
ref|NP_001279601.1|  serine incorporator 3 precursor                  69.3    3e-10    Callorhinchus milii [Australian ghost shark]
ref|XP_004346817.1|  hypothetical protein CAOG_05132                  68.9    3e-10    Capsaspora owczarzaki ATCC 30864
ref|XP_008024685.1|  hypothetical protein SETTUDRAFT_168930           69.3    3e-10    Exserohilum turcica Et28A
gb|KIW83119.1|  hypothetical protein Z517_02363                       68.9    4e-10    Fonsecaea pedrosoi CBS 271.37
gb|KIX97644.1|  hypothetical protein Z520_06422                       68.9    4e-10    Fonsecaea multimorphosa CBS 102226
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               68.9    4e-10    Rhizopus microsporus
gb|EST08485.1|  endosomal membrane protein, EMP70                     68.9    4e-10    Kalmanozyma brasiliensis GHG001
gb|EYU43805.1|  hypothetical protein MIMGU_mgv1a018435mg              68.6    5e-10    Erythranthe guttata [common monkey flower]
ref|XP_007338591.1|  TMS membrane protein/tumor differentially ex...  68.6    5e-10    
gb|ESA19644.1|  hypothetical protein GLOINDRAFT_19362                 68.6    5e-10    
ref|XP_001703677.1|  predicted protein                                68.2    5e-10    Chlamydomonas reinhardtii
gb|KIZ04409.1|  Serine incorporator 3                                 68.2    6e-10    Monoraphidium neglectum
ref|XP_006295917.1|  hypothetical protein CARUB_v10025054mg           68.6    6e-10    
dbj|BAM19260.1|  membrane protein tms1d                               68.2    6e-10    Papilio polytes
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          68.2    6e-10    Tarenaya hassleriana [spider flower]
ref|XP_008600130.1|  serine incorporator                              68.6    6e-10    Beauveria bassiana ARSEF 2860
ref|XP_006414928.1|  hypothetical protein EUTSA_v10025402mg           68.2    7e-10    Eutrema salsugineum [saltwater cress]
gb|EGU10891.1|  putative Membrane protein                             68.2    7e-10    Rhodotorula toruloides ATCC 204091
gb|KDP32305.1|  hypothetical protein JCGZ_13230                       68.2    7e-10    Jatropha curcas
ref|XP_001538371.1|  conserved hypothetical protein                   68.6    7e-10    Histoplasma capsulatum NAm1
gb|ABK22983.1|  unknown                                               67.8    7e-10    Picea sitchensis
gb|KIW26131.1|  hypothetical protein PV07_09255                       68.2    8e-10    Cladophialophora immunda
ref|XP_003653050.1|  hypothetical protein THITE_2115040               68.2    8e-10    Thielavia terrestris NRRL 8126
gb|KIL67495.1|  hypothetical protein M378DRAFT_258687                 68.2    8e-10    Amanita muscaria Koide BX008
ref|XP_002626102.1|  serine incorporator                              67.8    9e-10    Blastomyces gilchristii SLH14081
gb|EEQ92459.1|  membrane protein TMS1                                 67.8    9e-10    
ref|XP_003936453.1|  PREDICTED: serine incorporator 3                 67.8    1e-09    Saimiri boliviensis boliviensis
gb|KIW39489.1|  hypothetical protein PV06_08096                       67.8    1e-09    Exophiala oligosperma
gb|EXX52304.1|  Tms1p                                                 67.4    1e-09    Rhizophagus irregularis DAOM 197198w
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          67.4    1e-09    
ref|XP_002841809.1|  hypothetical protein                             67.4    1e-09    Tuber melanosporum Mel28
gb|KIW14122.1|  hypothetical protein PV08_06903                       67.4    1e-09    Exophiala spinifera
emb|CEG74953.1|  hypothetical protein RMATCC62417_10078               67.4    1e-09    Rhizopus microsporus
emb|CEG74954.1|  hypothetical protein RMATCC62417_10078               67.4    1e-09    Rhizopus microsporus
ref|XP_004247941.2|  PREDICTED: probable serine incorporator          67.4    1e-09    
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          67.0    2e-09    
ref|XP_010047746.1|  PREDICTED: probable serine incorporator isof...  67.0    2e-09    Eucalyptus grandis [rose gum]
ref|XP_009545469.1|  hypothetical protein HETIRDRAFT_458668           67.0    2e-09    Heterobasidion irregulare TC 32-1
dbj|GAD92421.1|  DNA mismatch repair protein (Pms1), putative         67.4    2e-09    Byssochlamys spectabilis No. 5
ref|XP_698642.3|  PREDICTED: serine incorporator 4 isoform X1         66.6    2e-09    Danio rerio [leopard danio]
ref|XP_008081744.1|  hypothetical protein GLAREA_12772                66.6    2e-09    Glarea lozoyensis ATCC 20868
ref|XP_005166547.1|  PREDICTED: serine incorporator 4 isoform X2      66.6    2e-09    Danio rerio [leopard danio]
gb|KIK10300.1|  hypothetical protein K443DRAFT_670924                 66.6    3e-09    Laccaria amethystina LaAM-08-1
gb|KDR76388.1|  hypothetical protein GALMADRAFT_247842                66.6    3e-09    Galerina marginata CBS 339.88
ref|XP_007597507.1|  serine incorporator                              66.6    3e-09    
ref|XP_009381145.1|  PREDICTED: probable serine incorporator          66.2    3e-09    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003842629.1|  similar to membrane protein TMS1                 66.2    3e-09    Leptosphaeria maculans JN3
dbj|BAK01836.1|  predicted protein                                    66.2    3e-09    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO43051.1|  hypothetical protein CISIN_1g037485mg                 65.9    4e-09    Citrus sinensis [apfelsine]
ref|XP_003660386.1|  hypothetical protein MYCTH_2298645               66.2    4e-09    Thermothelomyces thermophila ATCC 42464
ref|XP_001910362.1|  hypothetical protein                             64.7    4e-09    Podospora anserina S mat+
ref|XP_009619984.1|  PREDICTED: probable serine incorporator          65.9    4e-09    
ref|XP_009336915.1|  PREDICTED: probable serine incorporator          65.9    4e-09    
ref|XP_002747623.2|  PREDICTED: serine incorporator 3                 65.9    4e-09    Callithrix jacchus [common marmoset]
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          65.9    4e-09    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010469504.1|  PREDICTED: probable serine incorporator isof...  65.9    4e-09    Camelina sativa [gold-of-pleasure]
ref|XP_006420513.1|  hypothetical protein CICLE_v10006912mg           65.9    4e-09    
emb|CDM81834.1|  unnamed protein product                              65.9    4e-09    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010469508.1|  PREDICTED: probable serine incorporator isof...  65.9    4e-09    
ref|XP_010915041.1|  PREDICTED: probable serine incorporator          65.9    4e-09    
dbj|GAC71301.1|  endosomal membrane proteins, EMP70                   66.2    5e-09    
ref|XP_006842248.1|  hypothetical protein AMTR_s00078p00195500        65.9    5e-09    
gb|ETS61667.1|  hypothetical protein PaG_04165                        66.2    5e-09    
ref|XP_006492163.1|  PREDICTED: probable serine incorporator-like     65.5    5e-09    
emb|CCX14994.1|  Similar to Membrane protein TMS1; acc. no. Q12116    65.9    5e-09    
dbj|BAJ93223.1|  predicted protein                                    65.5    5e-09    
gb|EJT47328.1|  vacuolar transmembrane protein, Tms1p                 65.5    5e-09    
ref|XP_008058013.1|  PREDICTED: serine incorporator 3                 65.5    6e-09    
gb|KDE07206.1|  hypothetical protein MVLG_02606                       65.5    6e-09    
ref|XP_008471585.1|  PREDICTED: serine incorporator 1                 65.9    6e-09    
gb|EPS58143.1|  hypothetical protein M569_16673                       62.8    6e-09    
ref|XP_006628900.1|  PREDICTED: serine incorporator 4-like            65.5    6e-09    
gb|ETE70063.1|  Serine incorporator 3                                 65.5    6e-09    
ref|NP_850202.4|  Serinc-domain containing serine and sphingolipi...  65.1    6e-09    
gb|KGY15026.1|  hypothetical protein PABG_12140                       65.9    6e-09    
gb|KDQ24609.1|  hypothetical protein PLEOSDRAFT_1078682               65.5    7e-09    
dbj|GAK63162.1|  TMS membrane protein/tumor differentially expres...  65.5    7e-09    
ref|NP_001131274.1|  uncharacterized protein LOC100192587             64.7    7e-09    
ref|XP_001190705.2|  PREDICTED: probable serine incorporator-like     65.1    8e-09    
ref|XP_006734548.1|  PREDICTED: serine incorporator 3                 65.1    8e-09    
ref|XP_007420896.1|  PREDICTED: serine incorporator 3                 65.1    8e-09    
emb|CCF49629.1|  related to TMS1 protein                              65.1    8e-09    
ref|XP_010656351.1|  PREDICTED: serine incorporator 3 isoform X3      64.3    9e-09    
ref|XP_010656344.1|  PREDICTED: probable serine incorporator isof...  64.7    9e-09    
ref|XP_001245605.1|  hypothetical protein CIMG_05046                  65.1    9e-09    
gb|EHH65321.1|  Tumor differentially expressed protein 1              64.7    9e-09    
emb|CAN70494.1|  hypothetical protein VITISV_041932                   64.7    9e-09    
ref|XP_008438416.1|  PREDICTED: probable serine incorporator isof...  64.7    9e-09    
emb|CCF39398.1|  serine incorporator                                  64.7    9e-09    
ref|XP_005569140.1|  PREDICTED: serine incorporator 3 isoform X1      64.7    9e-09    
gb|EFQ27559.1|  serine incorporator                                   64.7    1e-08    
ref|XP_008438411.1|  PREDICTED: probable serine incorporator isof...  64.7    1e-08    
ref|XP_003303516.1|  hypothetical protein PTT_15753                   64.7    1e-08    
ref|XP_004976160.1|  PREDICTED: probable serine incorporator-like     64.7    1e-08    
ref|NP_001247901.1|  serine incorporator 3 precursor                  64.7    1e-08    
ref|XP_008438414.1|  PREDICTED: probable serine incorporator isof...  64.7    1e-08    
ref|XP_008438413.1|  PREDICTED: probable serine incorporator isof...  64.7    1e-08    
ref|XP_010875845.1|  PREDICTED: serine incorporator 4 isoform X1      64.7    1e-08    
ref|XP_010875852.1|  PREDICTED: serine incorporator 4 isoform X2      64.7    1e-08    
ref|XP_001935501.1|  membrane protein TMS1                            64.7    1e-08    
ref|XP_001803629.1|  hypothetical protein SNOG_13417                  64.7    1e-08    
gb|ACG28988.1|  TMS membrane protein/tumor differentially express...  64.3    1e-08    
emb|CDY39551.1|  BnaC07g07190D                                        64.3    1e-08    
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           64.3    1e-08    
ref|XP_008298831.1|  PREDICTED: serine incorporator 1-like            63.5    1e-08    
ref|XP_534427.3|  PREDICTED: serine incorporator 3                    64.3    1e-08    
gb|EMT13739.1|  Putative serine incorporator                          64.3    1e-08    
ref|XP_004134388.1|  PREDICTED: serine incorporator 3-like            64.3    1e-08    
gb|KGN56781.1|  hypothetical protein Csa_3G133320                     64.3    2e-08    
ref|XP_007152808.1|  hypothetical protein PHAVU_004G161400g           63.9    2e-08    
ref|XP_009775303.1|  PREDICTED: probable serine incorporator          64.3    2e-08    
gb|EYE97808.1|  TMS membrane protein/tumor differentially express...  64.3    2e-08    
emb|CDP30893.1|  Putative Protein similar to Membrane protein PB1...  64.3    2e-08    
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          63.9    2e-08    
dbj|GAC92975.1|  hypothetical protein PHSY_000535                     63.9    2e-08    
gb|ESZ95719.1|  putative membrane protein TMS1                        63.9    2e-08    
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          63.9    2e-08    
ref|XP_003199457.1|  PREDICTED: serine incorporator 1-like            63.9    2e-08    
ref|XP_003620496.1|  Serine incorporator                              63.9    2e-08    
gb|EXX55775.1|  Tms1p                                                 63.9    2e-08    
ref|XP_003071312.1|  TMS membrane protein, putative                   63.9    2e-08    
ref|XP_007318557.1|  hypothetical protein SERLADRAFT_356127           63.9    2e-08    
ref|XP_007145428.1|  hypothetical protein PHAVU_007G238300g           63.9    2e-08    
ref|XP_007145427.1|  hypothetical protein PHAVU_007G238300g           63.9    2e-08    
ref|XP_009267712.1|  Membrane protein TMS1                            63.9    2e-08    
ref|XP_002455066.1|  hypothetical protein SORBIDRAFT_03g003750        63.5    2e-08    
ref|XP_001836185.1|  membrane protein                                 63.5    2e-08    
ref|XP_009801692.1|  PREDICTED: serine incorporator 3-like            62.8    2e-08    
ref|XP_007878899.1|  hypothetical protein PFL1_03193                  63.9    2e-08    
ref|XP_007013228.1|  Serinc-domain containing serine and sphingol...  63.5    2e-08    
ref|XP_009171257.1|  hypothetical protein T265_07464                  63.9    3e-08    
ref|NP_001128733.1|  serine incorporator 3 precursor                  63.5    3e-08    
gb|KDQ14830.1|  hypothetical protein BOTBODRAFT_109376                63.5    3e-08    
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  63.5    3e-08    
ref|XP_006451100.1|  hypothetical protein CICLE_v10008536mg           63.5    3e-08    
ref|XP_010488550.1|  PREDICTED: probable serine incorporator          63.5    3e-08    
gb|KIN08538.1|  hypothetical protein OIDMADRAFT_108243                63.5    3e-08    
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  63.2    3e-08    
emb|CDY43689.1|  BnaC08g46960D                                        63.2    3e-08    
ref|XP_010264010.1|  PREDICTED: serine incorporator 3 isoform X2      63.2    3e-08    
ref|XP_010435285.1|  PREDICTED: probable serine incorporator          63.2    3e-08    
gb|KDO54165.1|  hypothetical protein CISIN_1g0159802mg                62.8    3e-08    
ref|XP_010382576.1|  PREDICTED: serine incorporator 3                 63.2    3e-08    
ref|XP_004994555.1|  hypothetical protein PTSG_04461                  63.2    3e-08    
ref|XP_002885648.1|  TMS membrane family protein                      63.2    3e-08    
ref|XP_010264006.1|  PREDICTED: probable serine incorporator isof...  63.2    3e-08    
ref|XP_004414156.1|  PREDICTED: serine incorporator 3                 63.2    3e-08    
ref|XP_010469507.1|  PREDICTED: probable serine incorporator isof...  63.2    4e-08    
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          63.2    4e-08    
gb|EHJ66123.1|  membrane protein TMS1                                 63.2    4e-08    
gb|KID61935.1|  TMS membrane protein/tumor differentially express...  63.2    4e-08    
ref|XP_008793444.1|  PREDICTED: probable serine incorporator          62.8    4e-08    
ref|XP_010542976.1|  PREDICTED: probable serine incorporator          62.8    4e-08    
ref|XP_007160349.1|  hypothetical protein PHAVU_002G314300g           62.8    4e-08    
ref|XP_003253653.1|  PREDICTED: serine incorporator 3 isoform 1       62.8    4e-08    
emb|CDI52959.1|  related to TMS1 protein                              62.8    4e-08    
gb|KEP52328.1|  TMS membrane protein/tumor differentially protein     62.8    4e-08    
gb|KDN50456.1|  hypothetical protein RSAG8_00954                      62.8    4e-08    
ref|XP_004968422.1|  PREDICTED: probable serine incorporator-like...  62.8    4e-08    
ref|XP_001880973.1|  predicted protein                                62.8    4e-08    
ref|XP_002394743.1|  hypothetical protein MPER_05316                  62.0    5e-08    
ref|XP_007779022.1|  hypothetical protein W97_02933                   62.8    5e-08    
tpe|CBF69928.1|  TPA: membrane protein TMS1, putative (AFU_orthol...  62.8    5e-08    
gb|KIJ52532.1|  hypothetical protein M422DRAFT_223091                 62.8    5e-08    
emb|CCD47151.1|  similar to membrane protein TMS1                     62.8    5e-08    
emb|CBQ72377.1|  related to TMS1 protein                              62.8    5e-08    
ref|XP_010879048.1|  PREDICTED: serine incorporator 3-like            62.4    6e-08    
ref|XP_009214345.1|  PREDICTED: serine incorporator 3 isoform X2      62.4    6e-08    
gb|AGG38116.1|  maternal effect embryo arrest 55-3 protein            59.7    6e-08    
ref|XP_007847644.1|  membrane protein                                 62.4    6e-08    
ref|XP_010073800.1|  PREDICTED: serine incorporator 3-like            62.4    6e-08    
emb|CDX94813.1|  BnaC03g43750D                                        62.4    6e-08    
ref|XP_009135894.1|  PREDICTED: probable serine incorporator isof...  62.4    6e-08    
gb|KEQ97837.1|  hypothetical protein AUEXF2481DRAFT_95498             62.4    6e-08    
gb|KFU98253.1|  Serine incorporator 3                                 62.4    6e-08    
gb|KFH68448.1|  hypothetical protein MVEG_05263                       62.4    6e-08    
ref|XP_010749554.1|  PREDICTED: serine incorporator 4                 62.4    6e-08    
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           62.0    7e-08    
gb|KDN68812.1|  putative serine incorporator                          62.4    7e-08    
gb|KEQ63452.1|  TMS membrane protein/tumor differentially express...  62.4    7e-08    
ref|XP_001275614.1|  membrane protein TMS1, putative                  62.0    7e-08    
gb|KII84434.1|  hypothetical protein PLICRDRAFT_701975                62.4    7e-08    
emb|CAF91335.1|  unnamed protein product                              62.0    7e-08    
gb|EMF14941.1|  TMS membrane protein/tumor differentially express...  62.0    8e-08    
ref|XP_010509918.1|  PREDICTED: probable serine incorporator          62.0    8e-08    
gb|KFG83214.1|  putative membrane protein TMS1                        62.0    8e-08    
gb|KGO42902.1|  TMS membrane protein/tumor differentially express...  62.0    8e-08    
ref|XP_003969796.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  62.0    8e-08    
gb|KIM84383.1|  hypothetical protein PILCRDRAFT_818745                62.0    8e-08    
ref|XP_007368631.1|  TMS membrane protein/tumor differentially ex...  62.0    8e-08    
ref|XP_008210231.1|  PREDICTED: serine incorporator 1 isoform X5      62.0    9e-08    
ref|XP_008210234.1|  PREDICTED: serine incorporator 1 isoform X6      62.0    9e-08    
emb|CDX93013.1|  BnaA03g37350D                                        61.6    9e-08    
ref|XP_008210220.1|  PREDICTED: serine incorporator 1 isoform X4      62.0    9e-08    
ref|XP_006653583.1|  PREDICTED: probable serine incorporator-like     61.6    9e-08    
gb|KJB54127.1|  hypothetical protein B456_009G023600                  61.6    9e-08    
ref|XP_008210203.1|  PREDICTED: probable serine incorporator isof...  62.0    9e-08    
gb|KHG16194.1|  Serine incorporator 3                                 61.6    1e-07    
gb|KJB54130.1|  hypothetical protein B456_009G023600                  61.6    1e-07    
gb|KJB54128.1|  hypothetical protein B456_009G023600                  61.2    1e-07    
ref|XP_001603720.2|  PREDICTED: probable serine incorporator isof...  61.6    1e-07    
ref|XP_004336528.1|  serine incorporator 3, putative                  61.6    1e-07    
ref|XP_010925321.1|  PREDICTED: probable serine incorporator          61.6    1e-07    
gb|AET05293.2|  serinc-domain serine and sphingolipid biosynthesi...  61.6    1e-07    
ref|XP_010139603.1|  PREDICTED: serine incorporator 3                 61.6    1e-07    
ref|XP_008210211.1|  PREDICTED: probable serine incorporator isof...  61.6    1e-07    
ref|XP_001745243.1|  hypothetical protein                             61.6    1e-07    
gb|ELT97171.1|  hypothetical protein CAPTEDRAFT_153908                61.6    1e-07    
ref|XP_003630817.1|  Serine incorporator                              61.6    1e-07    
ref|XP_007817272.1|  serine incorporator                              61.6    1e-07    
gb|KFO83903.1|  Serine incorporator 3                                 61.6    1e-07    
ref|XP_002583546.1|  conserved hypothetical protein                   61.6    1e-07    
ref|XP_010656350.1|  PREDICTED: probable serine incorporator isof...  61.2    1e-07    
ref|XP_010466851.1|  PREDICTED: probable serine incorporator          61.6    1e-07    
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          61.6    1e-07    
ref|XP_001947564.2|  PREDICTED: probable serine incorporator isof...  61.6    1e-07    
gb|KEQ81147.1|  TMS membrane protein/tumor differentially express...  61.6    1e-07    
ref|XP_007530938.1|  PREDICTED: serine incorporator 3                 61.6    1e-07    
ref|XP_008187951.1|  PREDICTED: probable serine incorporator isof...  61.6    1e-07    
ref|XP_004301051.1|  PREDICTED: probable serine incorporator          61.2    1e-07    
ref|XP_008667561.1|  PREDICTED: hypothetical protein isoform X1       61.2    1e-07    
ref|XP_003253654.1|  PREDICTED: serine incorporator 3 isoform 2       61.2    1e-07    
gb|EMD34020.1|  hypothetical protein CERSUDRAFT_86781                 61.6    1e-07    
ref|XP_755673.1|  membrane protein TMS1                               61.2    1e-07    
gb|ACG46077.1|  TMS membrane protein/tumor differentially express...  61.2    1e-07    
gb|EDP54845.1|  membrane protein TMS1, putative                       61.2    1e-07    
gb|KEY81584.1|  hypothetical protein membrane TMS1                    61.2    1e-07    
emb|CCG81041.1|  Putative uncharacterized protein                     61.2    2e-07    
emb|CDX77425.1|  BnaA07g05630D                                        61.2    2e-07    
ref|XP_008193931.1|  PREDICTED: probable serine incorporator isof...  61.2    2e-07    
ref|XP_009102507.1|  PREDICTED: probable serine incorporator isof...  61.2    2e-07    
ref|XP_008302146.1|  PREDICTED: serine incorporator 4                 60.8    2e-07    
ref|XP_009102508.1|  PREDICTED: probable serine incorporator isof...  60.8    2e-07    
ref|XP_008193930.1|  PREDICTED: probable serine incorporator isof...  61.2    2e-07    
ref|XP_010450223.1|  PREDICTED: probable serine incorporator          60.8    2e-07    
ref|XP_008193928.1|  PREDICTED: probable serine incorporator isof...  61.2    2e-07    
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          60.8    2e-07    
ref|XP_004139427.1|  PREDICTED: serine incorporator 1-like            60.8    2e-07    
ref|XP_008193929.1|  PREDICTED: probable serine incorporator isof...  61.2    2e-07    
ref|XP_001590962.1|  hypothetical protein SS1G_07586                  61.2    2e-07    
ref|XP_009565857.1|  PREDICTED: serine incorporator 3                 60.8    2e-07    
ref|XP_007814237.1|  membrane protein TMS1, putative                  60.8    2e-07    
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           60.8    2e-07    
ref|XP_009865640.1|  PREDICTED: serine incorporator 3                 60.8    2e-07    
ref|XP_962656.1|  membrane protein TMS1                               60.8    2e-07    
gb|KFO81079.1|  Serine incorporator 3                                 60.8    2e-07    
ref|XP_001399368.2|  membrane protein TMS1                            60.8    2e-07    
emb|CBI33332.3|  unnamed protein product                              60.8    2e-07    
emb|CEG74956.1|  hypothetical protein RMATCC62417_10078               60.8    2e-07    
ref|XP_002602420.1|  hypothetical protein BRAFLDRAFT_117027           60.8    2e-07    
gb|KFH41418.1|  Membrane protein-like protein                         60.8    2e-07    
ref|XP_001260800.1|  membrane protein TMS1, putative                  60.8    2e-07    
emb|CEG74955.1|  hypothetical protein RMATCC62417_10078               60.5    2e-07    
ref|XP_004512855.1|  PREDICTED: probable serine incorporator-like     60.5    2e-07    
ref|XP_008335323.1|  PREDICTED: serine incorporator 4                 60.8    2e-07    
ref|XP_006804507.1|  PREDICTED: serine incorporator 4-like            60.8    2e-07    
ref|XP_004366977.1|  TMS membrane protein                             60.5    2e-07    
gb|KIJ66713.1|  hypothetical protein HYDPIDRAFT_174100                60.5    2e-07    
ref|XP_002917413.1|  PREDICTED: serine incorporator 3                 60.5    2e-07    
gb|KIK47452.1|  hypothetical protein CY34DRAFT_799414                 60.5    2e-07    
gb|KFP75273.1|  Serine incorporator 3                                 60.5    3e-07    
ref|XP_006285723.1|  hypothetical protein CARUB_v10007195mg           60.5    3e-07    
dbj|GAA56306.1|  serine incorporator 1                                60.8    3e-07    
ref|XP_009887441.1|  PREDICTED: serine incorporator 3                 60.5    3e-07    
ref|XP_003220654.1|  PREDICTED: serine incorporator 3                 60.5    3e-07    
ref|XP_010650214.1|  PREDICTED: probable serine incorporator          60.5    3e-07    
ref|XP_011473584.1|  PREDICTED: serine incorporator 1-like            60.5    3e-07    
ref|XP_008404277.1|  PREDICTED: serine incorporator 4 isoform X1      60.5    3e-07    
ref|XP_007558909.1|  PREDICTED: serine incorporator 4 isoform X2      60.5    3e-07    
ref|XP_010440600.1|  PREDICTED: probable serine incorporator          60.5    3e-07    
ref|XP_008404278.1|  PREDICTED: serine incorporator 4 isoform X2      60.5    3e-07    
emb|CAK96401.1|  unnamed protein product                              60.5    3e-07    
ref|XP_007558907.1|  PREDICTED: serine incorporator 4 isoform X1      60.5    3e-07    
gb|EFB21149.1|  hypothetical protein PANDA_005628                     60.5    3e-07    
ref|NP_001038647.1|  serine incorporator 2 precursor                  60.5    3e-07    
ref|XP_002448136.1|  hypothetical protein SORBIDRAFT_06g021920        60.1    3e-07    
gb|KGL85892.1|  Serine incorporator 3                                 60.5    3e-07    
emb|CDQ72446.1|  unnamed protein product                              60.5    3e-07    
ref|XP_004746435.1|  PREDICTED: serine incorporator 3 isoform X1      60.5    3e-07    



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFT+L+I+M+G+KNQKDPRD+LHHGGWMMKVICW +LVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTVLAILMVGVKNQKDPRDSLHHGGWMMKVICWCILVIFMFFLPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYVATF  +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYVATFVFSG  199

Query  693  VLFHFFAPSGQ  725
             LFH+F PSGQ
Sbjct  200  FLFHWFTPSGQ  210



>gb|KJB68286.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+GLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCY+ATF  +G
Sbjct  140  FYESASKFGAGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYLATFGFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>gb|KJB68285.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68288.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68289.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=413

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+GLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCY+ATF  +G
Sbjct  140  FYESASKFGAGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYLATFGFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISR+SARIAYCGLF LSLIVSWILREVAAPLME +PWIN FHKTPDREWFETDA
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINQFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+IMMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSG FLL+QVVLLLDFVHGWNDKW GYDEQFWY+AL VVSLVCYVA FA +G
Sbjct  140  FYESISKFGSGFFLLIQVVLLLDFVHGWNDKWAGYDEQFWYIALFVVSLVCYVAAFAFSG  199

Query  693  VLFHFFAPSGQ  725
            VLFHFF PSG 
Sbjct  200  VLFHFFTPSGH  210



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISR+SARIAYCGLF LSLIVSWILREVAAPLME +PWIN FHKTPDREWFETDA
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINQFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+IMMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSG FLL+QVVLLLDFVHGWNDKW GYDEQFWY+AL VVSLVCYVA FA +G
Sbjct  140  FYESISKFGSGFFLLIQVVLLLDFVHGWNDKWAGYDEQFWYIALFVVSLVCYVAAFAFSG  199

Query  693  VLFHFFAPSGQ  725
            VLFHFF PSG 
Sbjct  200  VLFHFFTPSGH  210



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+  M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILAFSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+GLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCY+ATF  +G
Sbjct  140  FYESASKFGAGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYLATFGFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH F PSGQ
Sbjct  200  LLFHLFTPSGQ  210



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFT+LS+MM+G+KNQKDPRD +HHGGWMMKVICW +LVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFIFFTVLSVMMVGVKNQKDPRDGIHHGGWMMKVICWCILVIFMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+GLFLLVQVVLLLDFVHGWND WVGYDEQFWYVALLVVSLVCY+ATF  +G
Sbjct  140  FYESISKFGAGLFLLVQVVLLLDFVHGWNDTWVGYDEQFWYVALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>gb|KJB67012.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=374

 Score =   324 bits (830),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL VSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLFVSWILREVAAPLMEQLPWINHFHKTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHG WMMK++CWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGRWMMKIVCWFILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLL+QVVLLLDFVHGWNDKWVGYDEQFWYVAL +VSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGLFLLIQVVLLLDFVHGWNDKWVGYDEQFWYVALFIVSLVCYLATFGFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>gb|EPS57849.1| hypothetical protein M569_16968, partial [Genlisea aurea]
Length=239

 Score =   318 bits (815),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  162  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  341
            +SGISRRSARIAYCGLFGLSLIVSWILREVAAPLME IPWINHFH+TPD+EWFETDAVLR
Sbjct  23   ISGISRRSARIAYCGLFGLSLIVSWILREVAAPLMEKIPWINHFHQTPDKEWFETDAVLR  82

Query  342  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  521
            VSLGNF FFTIL+I+M+GIKNQ+DPRD +HHGGWMMK+ CWF+LVI MFF+PN ++SFYE
Sbjct  83   VSLGNFLFFTILAILMVGIKNQRDPRDTVHHGGWMMKIFCWFVLVILMFFIPNGIVSFYE  142

Query  522  STSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLF  701
            S SKFGSGLFLLVQVVLLLDF+HGWNDKWVGYDEQFWYVALLVVSLVCYVATF  +G+LF
Sbjct  143  SISKFGSGLFLLVQVVLLLDFIHGWNDKWVGYDEQFWYVALLVVSLVCYVATFCFSGLLF  202

Query  702  HFFAPSGQ  725
            H FAPSG 
Sbjct  203  HLFAPSGH  210



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = +3

Query  159  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL  338
            VVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDAVL
Sbjct  22   VVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDAVL  81

Query  339  RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  518
            RVSLGNF FFTIL+ MM+G+KNQKDPRD+LHHGGWM KV+CW +LVI MFF+PNE++SFY
Sbjct  82   RVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLPNEIVSFY  141

Query  519  ESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVL  698
            ES SKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDE+FWYVAL VVSLVCYV TFA +G+L
Sbjct  142  ESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYVGTFAFSGLL  201

Query  699  FHFFAPSGQ  725
            FH+F PSGQ
Sbjct  202  FHWFTPSGQ  210



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF  SL+V+WILREVAAPLME++PWINHF  TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLVVAWILREVAAPLMESLPWINHFKHTPSREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M+G+K Q+DPRD++HHGGWMMK+ICW LLVIFMFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILAVLMVGVKTQRDPRDSMHHGGWMMKIICWCLLVIFMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG+FLLVQV+LLLDFVHGWNDKWVGYDEQFWY+AL VVSLVCYVATFA +G
Sbjct  140  FYETISKFGSGMFLLVQVMLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYVATFAFSG  199

Query  693  VLFHFFAPSGQ  725
            VLFHFF PSGQ
Sbjct  200  VLFHFFTPSGQ  210



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   324 bits (830),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGGWMMKVICWFILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVAL VVSLVCY+ T   +G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALFVVSLVCYLGTLGFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHTTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALLVVSLVCYVATFA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVATFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSGQ
Sbjct  200  LLFHFFTPSGQ  210



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVPN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+TSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWY+ALLVVSLVCYVATF+ +G
Sbjct  140  FYEATSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYMALLVVSLVCYVATFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LF+ F PSG 
Sbjct  200  LLFYLFTPSGH  210



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVPN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+TSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWY+ALLVVSLVCYVATF+ +G
Sbjct  140  FYEATSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYMALLVVSLVCYVATFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LF+ F PSG 
Sbjct  200  LLFYLFTPSGH  210



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMKVICW +LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKVICWCILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>gb|KJB67006.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67007.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67008.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67009.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67010.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67011.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67013.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=412

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL VSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLFVSWILREVAAPLMEQLPWINHFHKTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHG WMMK++CWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGRWMMKIVCWFILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLL+QVVLLLDFVHGWNDKWVGYDEQFWYVAL +VSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGLFLLIQVVLLLDFVHGWNDKWVGYDEQFWYVALFIVSLVCYLATFGFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+ICW +LVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVIFMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
             LFH+F PSG 
Sbjct  200  FLFHWFTPSGH  210



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILRE+AAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREIAAPLMEKIPWINSFHTTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALL VSLVCYVATFA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLAVSLVCYVATFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSGQ
Sbjct  200  LLFHFFTPSGQ  210



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHSTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALLVVSLVCYVATFA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVATFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSG 
Sbjct  200  LLFHFFTPSGH  210



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHSTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALLVVSLVCYVATFA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVATFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSG 
Sbjct  200  LLFHFFTPSGH  210



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILRE+AAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREIAAPLMEKIPWINSFHTTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALL VSLVCYVATFA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLAVSLVCYVATFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSGQ
Sbjct  200  LLFHFFTPSGQ  210



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   322 bits (824),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL+V+WILREVAAPLME+IPWINHF +TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVAWILREVAAPLMESIPWINHFKQTPSREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+ +MIG+K QKDPRD LHHGGWMMK+ICW L+VIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILATLMIGVKTQKDPRDGLHHGGWMMKIICWCLMVIFMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG+FLLVQVVLLLDFVHGWNDKWVG+DEQFWYVAL VVSLVCYVATF  +G
Sbjct  140  FYETISKFGSGMFLLVQVVLLLDFVHGWNDKWVGFDEQFWYVALFVVSLVCYVATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            VLFHFF PSGQ
Sbjct  200  VLFHFFTPSGQ  210



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+ICW +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVILMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   322 bits (824),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL+V+W+LREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVAWMLREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVPN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDPRDSIHHGGWMMKIICWCILVILMFFVPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+TSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWY+ALLVVSLVCYVATF+ +G
Sbjct  140  FYEATSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYMALLVVSLVCYVATFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LF+ F PSG 
Sbjct  200  LLFYLFTPSGH  210



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   321 bits (823),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+ +M+G+K+QKDPRD LHHGGWMMK+ICW +LVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTILATLMVGVKSQKDPRDGLHHGGWMMKIICWCVLVIFMFFLPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWNDKWVGY+EQFWY+AL VVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGSGLFLLVQVVLLLDFVHGWNDKWVGYNEQFWYIALFVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
             LFH+F PSGQ
Sbjct  200  FLFHWFTPSGQ  210



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDREWFETDAV
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDREWFETDAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+PNE++SF
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YES SKFGSGLFLLVQVV LLDFVHGWNDKWVGYDEQFWY AL  VS VCYV TFA +G+
Sbjct  141  YESISKFGSGLFLLVQVVFLLDFVHGWNDKWVGYDEQFWYAALFAVSFVCYVGTFAFSGL  200

Query  696  LFHFFAPSGQ  725
            LFH+F  SGQ
Sbjct  201  LFHWFTASGQ  210



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDREWFETDAV
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDREWFETDAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+PNE++SF
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YES SKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWY AL  VS VCYV TFA +G+
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYAALFAVSFVCYVGTFAFSGL  200

Query  696  LFHFFAPSGQ  725
            LFH+F  SGQ
Sbjct  201  LFHWFTASGQ  210



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDREWFETDAV
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDREWFETDAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+PNE++SF
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YES SKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWY AL  VS VCYV TFA +G+
Sbjct  141  YESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYAALFAVSFVCYVGTFAFSGL  200

Query  696  LFHFFAPSGQ  725
            LFH+F  SGQ
Sbjct  201  LFHWFTASGQ  210



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = +3

Query  159  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL  338
            VVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDAVL
Sbjct  22   VVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDAVL  81

Query  339  RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  518
            RVSLGNF FFTIL+ MM+G+KNQKDPRD+LHHGGWM KV+CW +LVI MFF+PNE++SFY
Sbjct  82   RVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLPNEIVSFY  141

Query  519  ESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVL  698
            ES SKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDE+FWYVAL VVSLVCYV TFA +G+L
Sbjct  142  ESISKFGSGLFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYVGTFAFSGLL  201

Query  699  FHFFAPSGQ  725
            FH+F PSGQ
Sbjct  202  FHWFTPSGQ  210



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF  SLIV+WILREVAAPLME++PWINHF  TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLIVAWILREVAAPLMESLPWINHFSHTPSREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M G+K Q+DPRD +HHGGWMMK+ICWFLLVIFMFFVPNE+I 
Sbjct  80   VLRVSLGNFLFFTILAVLMTGVKTQRDPRDGMHHGGWMMKIICWFLLVIFMFFVPNEIIG  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG+FLLVQV+LLLDFVHGWNDKWVG+DEQFWYVAL VVSLVCY+ATFA +G
Sbjct  140  FYETISKFGSGMFLLVQVMLLLDFVHGWNDKWVGFDEQFWYVALFVVSLVCYLATFAFSG  199

Query  693  VLFHFFAPSGQ  725
            VL+HFF PSGQ
Sbjct  200  VLYHFFTPSGQ  210



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I MIG+KNQKD RD+LHHGGWMMK+ICW +LVI MFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDSRDSLHHGGWMMKIICWCILVILMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+TSKFGSGLFLLVQVVLLLDF+HGWN+KWVGYDEQFWY+ALLVVSL+CYVATF+ +G
Sbjct  140  FYEATSKFGSGLFLLVQVVLLLDFIHGWNEKWVGYDEQFWYIALLVVSLICYVATFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LF+ FAPSG 
Sbjct  200  LLFYLFAPSGH  210



>gb|KJB68287.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 179/191 (94%), Gaps = 2/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FY   SKFG+GLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCY+ATF  +G
Sbjct  140  FY--ASKFGAGLFLLVQVVLLLDFVHGWNDKWVGYDEQFWYVALLVVSLVCYLATFGFSG  197

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  198  LLFHWFTPSGQ  208



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALLVVSLVCYVA FA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVAAFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSG 
Sbjct  200  LLFHFFTPSGH  210



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALLVVSLVCYVA FA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVAAFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSG 
Sbjct  200  LLFHFFTPSGH  210



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WNDKWVGYDEQFWYVALLVVSLVCYVA FA  G
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHSWNDKWVGYDEQFWYVALLVVSLVCYVAAFAFNG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSG 
Sbjct  200  LLFHFFTPSGH  210



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALL VSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLGVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVS GNF FFTIL+I+MIG+KNQKDPRD +HHGGWMMK+ICW +LVIF FF+PNELIS
Sbjct  80   VLRVSFGNFLFFTILAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLPNELIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+TSKFGSGLFLLVQVVLLLDFVH WND WVGY EQFWY+AL VVSLVCYVATF+ +G
Sbjct  140  FYETTSKFGSGLFLLVQVVLLLDFVHRWNDTWVGYGEQFWYIALFVVSLVCYVATFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFHFF PSG 
Sbjct  200  LLFHFFTPSGH  210



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  162  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  341
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP REWFETDAVLR
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFETDAVLR  82

Query  342  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  521
            VSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+PNE++SFYE
Sbjct  83   VSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSFYE  142

Query  522  STSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLF  701
            S SKFGSGLFLLVQVVLLLDFVH WND WVGYDEQFWYVALLVVSLVCYV TF  +G+LF
Sbjct  143  SISKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYVALLVVSLVCYVLTFGFSGLLF  202

Query  702  HFFAPSGQ  725
            H+F PSGQ
Sbjct  203  HWFTPSGQ  210



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISR+SARIAYCGLF  SLIVSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRKSARIAYCGLFAFSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL++ M+GIKNQKDPRD++HHGGWM+K+ICW LLVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILAVFMMGIKNQKDPRDSVHHGGWMIKIICWCLLVILMFFVPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+TSKFG+G FLLVQVVLLLDFVHGWNDKWVGYDE+FWY+ALLV+SLVCYVATFA +G
Sbjct  140  FYETTSKFGAGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYMALLVISLVCYVATFAFSG  199

Query  693  VLFHFFAPSGQ  725
            +LF+ F  SG 
Sbjct  200  LLFYLFTASGH  210



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   317 bits (812),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  162  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  341
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP REWFETDAVLR
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFETDAVLR  82

Query  342  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  521
            VSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+PNE++SFYE
Sbjct  83   VSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSFYE  142

Query  522  STSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLF  701
            S SKFGSGLFLLVQVVLLLDFVH WN+ WVGYDEQFWYVALLVVSLVCYV TF  +G+LF
Sbjct  143  SISKFGSGLFLLVQVVLLLDFVHRWNETWVGYDEQFWYVALLVVSLVCYVLTFGFSGLLF  202

Query  702  HFFAPSGQ  725
            H+F PSGQ
Sbjct  203  HWFTPSGQ  210



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   317 bits (811),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF  SL+V+WILREVAAPLME++PWINHF  TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLVVAWILREVAAPLMESLPWINHFKHTPSREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+M+G+K Q+DPRD++HHGGWMMK+ICW LLVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAILMVGVKTQRDPRDSMHHGGWMMKIICWCLLVISMFFIPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG+FLLVQV+LLLDFVHGWNDKWVG+DEQFWY+AL VVSLVCYVATFA +G
Sbjct  140  FYETISKFGSGMFLLVQVMLLLDFVHGWNDKWVGFDEQFWYIALFVVSLVCYVATFAFSG  199

Query  693  VLFHFFAPSGQ  725
            VLFHFF PSG 
Sbjct  200  VLFHFFTPSGH  210



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINQFNETHNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG FLLVQVVLLLDFVHGWNDKWVGYDE+FWYVAL VVSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISR+SARIAYCGLF LSLIV+WILREVAAPLME IPWIN+F +TPD+EWF+TDA
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVAWILREVAAPLMEKIPWINYFQQTPDKEWFQTDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++MIG+KNQKDPRDNLHHGGWMMK+ICW LLVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAVLMIGVKNQKDPRDNLHHGGWMMKIICWCLLVILMFFLPNEMIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             YE+TSKFG+GLFL VQVVLLLDFVHGWNDKWVGY+EQFWYVAL VVSL+CYVAT + + 
Sbjct  140  LYEATSKFGAGLFLFVQVVLLLDFVHGWNDKWVGYNEQFWYVALFVVSLICYVATLSFSA  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINQFNETHNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG FLLVQVVLLLDFVHGWNDKWVGYDE+FWYVAL VVSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   314 bits (805),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI+ F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWISQFNETHNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG FLLVQVVLLLDFVHGWNDKWVGYDE+FWYVAL VVSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYVALFVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+VV GISRRS+RIAYCGLF  SLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSSRIAYCGLFAFSLIVSWILREVAAPLMEKLPWINHFHRTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL++MM+GIK+QKDPRD LHHGGWM K++CWF+LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILALMMVGIKDQKDPRDRLHHGGWMAKIVCWFVLVILMFFVPNGLVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVHGWND WV  DEQFWYVAL +VSLVCYVATF+ TG
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYVALFIVSLVCYVATFSFTG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   320 bits (821),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFG+G FLLVQVVLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFLFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVS ILREVAAPL+E IPWI+ F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSXILREVAAPLLEKIPWISQFNETHNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG FLLVQVVLLLDFVHGWNDKWVGYDE+FWY AL VVSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEKFWYXALFVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWIN+FH TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINNFHHTPSREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+M+G+KNQ+DPRD LHHGGWMMK+ICW LLVIFMFF+PNE+I+
Sbjct  80   VLRVSLGNFLFFTILAILMVGVKNQRDPRDGLHHGGWMMKIICWCLLVIFMFFLPNEIIN  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE++SKFGSGLFLLVQVVLLLDFVH WND WVGYDEQFWY+AL VVSL CY ATF  +G
Sbjct  140  FYETSSKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLFCYGATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+WF+TDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQTDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+MM+G+K+Q+DPRDN+HHGGWM+KVICWFLLV+ MFFVPNE+I+
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVPNEIIT  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVH WND WVGYDEQFWY+AL VVSL CYVATF  +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLFCYVATFVSSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F P+G 
Sbjct  200  LLFHWFTPAGH  210



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++CW +LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCVLVILMFFVPNGLVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVHGWND WV  DEQFWY+AL +VSLVCYV TF+ TG
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYMALFIVSLVCYVTTFSFTG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++CW +LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCVLVILMFFVPNGLVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVHGWND WV  DEQFWY+AL +VSLVCYV TF+ TG
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYMALFIVSLVCYVTTFSFTG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI  F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWITQFNQTHNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG FLLVQVVLLLDFVHGWNDKWVGYDEQFWY+AL VVSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI  F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWITQFNQTHNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG FLLVQVVLLLDFVHGWNDKWVGYDEQFWY+AL VVSLVCY+ATF  +G
Sbjct  140  FYETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYLATFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHRTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M GIK+QKDPRD LHHGGWM KV+CW +LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILALLMAGIKDQKDPRDRLHHGGWMAKVVCWCVLVILMFFVPNGLVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVHGWND WV  DEQFWY+AL +VSLVCYVA F+ TG
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSNDEQFWYMALFIVSLVCYVAAFSFTG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+WF+TDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQTDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+MM+G+K Q+DPRDN+HHGGWM+KVICWFLLV+ MFF+PNE+I+
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKTQRDPRDNIHHGGWMVKVICWFLLVVLMFFIPNEIIT  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVH WND WVGYDEQFWY+AL VVSL CYV TF  +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLFCYVTTFVSSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F P+G 
Sbjct  200  LLFHWFTPAGH  210



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+V   ISRRSARIAYCGLF LSL+VSW LREVAAPLME++PWINHFHKTPDREWFETDA
Sbjct  20   RSVAGSISRRSARIAYCGLFALSLVVSWGLREVAAPLMESLPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++MIGIK+QKDPRD LHHGGWM K++CWF++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFVFFTILAVVMIGIKDQKDPRDQLHHGGWMAKIVCWFIVVFLMFFVPNGIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WN+ WV  DEQFWY+ALL+VSLVCY+ATF+ TG
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHAWNENWVSKDEQFWYMALLIVSLVCYLATFSFTG  199

Query  693  VLFHFFAPSGQ  725
            VLFH+F PSG 
Sbjct  200  VLFHWFTPSGH  210



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+VV GISRRSARIAYCGLF LSL+VSW+LREVAAPLME++PWINHF KTPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLVVSWVLREVAAPLMESLPWINHFRKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFT+L+++MIGIK+QKDPRD LHHGGWM K++CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFFFFTLLAVLMIGIKDQKDPRDRLHHGGWMAKIVCWCIVVFLMFFVPNGIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WN+ WV  DEQFWY+ALL+VSLVCYVATF+ TG
Sbjct  140  FYETISKFGSGLFLLVQVVLLLDFVHAWNENWVSKDEQFWYMALLIVSLVCYVATFSFTG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>emb|CAN80335.1| hypothetical protein VITISV_009414 [Vitis vinifera]
Length=382

 Score =   295 bits (756),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 177/237 (75%), Gaps = 46/237 (19%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPW-----------------  281
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +P+                 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPYFGCSFIFLRNLLRFLLS  79

Query  282  -----------------------------INHFHKTPDREWFETDAVLRVSLGNFTFFTI  374
                                         INHFHKTP+REWFETDAVLRVS GNF FFTI
Sbjct  80   LLGLKLSLKIKPARVAQLVRANTRKCGPRINHFHKTPNREWFETDAVLRVSFGNFLFFTI  139

Query  375  LSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfl  554
            L+I+MIG+KNQKDPRD +HHGGWMMK+ICW +LVIF FF+PNELISFYE+TSKFGSGLFL
Sbjct  140  LAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLPNELISFYETTSKFGSGLFL  199

Query  555  lvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            LVQVVLLLDFVH WND WVGY EQFWY+AL VVSLVCYVATF+ +G+LFHFF PSG 
Sbjct  200  LVQVVLLLDFVHRWNDTWVGYGEQFWYIALFVVSLVCYVATFSFSGLLFHFFTPSGH  256



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            ARIAYCGLF LSL+V+W+LREVAAPLME+IPWINHF +TP REWFETDAVLRVS GNF F
Sbjct  31   ARIAYCGLFALSLVVAWMLREVAAPLMESIPWINHFKQTPSREWFETDAVLRVSFGNFLF  90

Query  366  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG  545
            FTIL+ MM+G+K QKDPRD LHHGGWMMK+ICW LLVIFMFF+PNE+ISFYE+ SKFGSG
Sbjct  91   FTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCLLVIFMFFLPNEIISFYETISKFGSG  150

Query  546  lfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            +FLLVQVVLLLDFVH WND WVGYDEQFWY+AL VVSLVCYVATF  +GVLFHFF PSGQ
Sbjct  151  MFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLVCYVATFVFSGVLFHFFTPSGQ  210



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+VV GISRRS+RIAYCGLF  SLIVSWILREVAAP ME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSSRIAYCGLFAFSLIVSWILREVAAPFMEKLPWINHFHQTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++ WF+LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILALVMVGIKDQKDPRDRLHHGGWMAKIVGWFVLVILMFFVPNGLVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             YE+ SKFGSGLFLLVQVVLLLDFVHGWND WV  DEQFWY+AL +VSL+CYV TF+ TG
Sbjct  140  SYETISKFGSGLFLLVQVVLLLDFVHGWNDSWVSKDEQFWYMALFLVSLLCYVVTFSFTG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG+
Sbjct  200  LLFHWFTPSGR  210



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+V S ISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TP+REWFETDA
Sbjct  20   RSVASSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPNREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+MIG+K+QKDPRD LHHGGWM K++CW +LV  MFF+PN ++S
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKDQKDPRDRLHHGGWMTKIVCWCILVFIMFFLPNAIVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             YE+ SKFGSGLFLLVQVVLLLDFVH WNDKWV  DEQFWY+AL VVSLVCY+ TF+ +G
Sbjct  140  SYETVSKFGSGLFLLVQVVLLLDFVHEWNDKWVRKDEQFWYIALFVVSLVCYLLTFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F P+G 
Sbjct  200  LLFHWFTPAGH  210



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RT V  I RRSARIAYCGLF LSL+ SW+LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLTSWVLREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+ +M GIK+QKDPRD +HHGGWM K+ CW ++V  MF VPN ++S
Sbjct  80   VLRVSLGNFLFFTILAGIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFLVPNGVVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ATF+ +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSGQ
Sbjct  200  LLFHWFTPSGQ  210



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RT V  I RRSARIAYCGLF LSL+ SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ TF+ +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIVTFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ TF+ +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIVTFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   288 bits (738),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAIIVFLMFFVPNGVVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ATF+ +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFSFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIVFLMFFVPNGVVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ATF  +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFCFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++   MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIAFLMFFVPNGVVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ATF  +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATFCFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   286 bits (731),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFFVPNGVVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+AT + +G
Sbjct  140  FYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIATASFSG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 159/191 (83%), Gaps = 13/191 (7%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHK+PDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKSPDREWFETDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MF  P +  +
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFSFPMKSSA  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            F    S+F          VLLLDFVHGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct  140  F---MSRF----------VLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG  186

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  187  LLFHWFTPSGH  197



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 164/197 (83%), Gaps = 17/197 (9%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIP-----------------WINHFHKTPDRE  314
            ARIAYCGLF LSL+V+W+LREVAAPLME+IP                 WINHF +TP RE
Sbjct  31   ARIAYCGLFALSLVVAWMLREVAAPLMESIPCIGAVWIELLELIGVSSWINHFKQTPSRE  90

Query  315  WFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFV  494
            WFETDAVLRVS GNF FFTIL+ MM+G+K QKDPRD LHHGGWMMK+ICW LLVIFMFF+
Sbjct  91   WFETDAVLRVSFGNFLFFTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCLLVIFMFFL  150

Query  495  PNELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVA  674
            PNE+ISFYE+ SKFGSG+FLLVQVVLLLDFVH WND WVGYDEQFWY+AL VVSLVCYVA
Sbjct  151  PNEIISFYETISKFGSGMFLLVQVVLLLDFVHRWNDTWVGYDEQFWYIALFVVSLVCYVA  210

Query  675  TFAITGVLFHFFAPSGQ  725
            TF  +GVLFHFF PSGQ
Sbjct  211  TFVFSGVLFHFFTPSGQ  227



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHF  TPDREWF+TDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFAHTPDREWFQTDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFT+L+++MIG+KNQKDPRD+LHHGGWM+K++ W ++VI MFF+ N ++ 
Sbjct  80   VLRVSLGNFLFFTLLAVIMIGVKNQKDPRDSLHHGGWMVKIVTWCIVVILMFFLSNGIVE  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSGLFLLVQVVLLLDFVH WN+ WV  DEQFWY+AL VVSLVCY+ TF+  G
Sbjct  140  FYEAISKFGSGLFLLVQVVLLLDFVHAWNENWVEKDEQFWYIALFVVSLVCYIGTFSFGG  199

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  200  LLFHWFTPSGH  210



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPW-INHFHKTPDREWFETD  329
            RT V  I RRSARIAYCGLF LSL+ SW+LREVAAPL+++ P  INHFHKTPDREWFETD
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLASWVLREVAAPLLQSHPHRINHFHKTPDREWFETD  79

Query  330  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  509
            AVLRVSLGNF FFTIL+ +M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++
Sbjct  80   AVLRVSLGNFLFFTILAAIMAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVPNGVV  139

Query  510  SFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAIT  689
            SFYES SKFGSGLFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ +FA +
Sbjct  140  SFYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIGSFAFS  199

Query  690  GVLFHFFAPSGQ  725
            G+LFH+F PSGQ
Sbjct  200  GLLFHWFTPSGQ  211



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 167/196 (85%), Gaps = 5/196 (3%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+WF+TDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQTDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTILS+MM+G+K+Q+DPRDN+HHGGWM+KVICWFLLV+ MFFVPNE+I+
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVPNEIIT  139

Query  513  FY-----ESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVAT  677
            FY      S SKFGSGLFLLVQVVLLLDFVH WND  +      WY+AL VVSL CYVAT
Sbjct  140  FYVWLRIVSISKFGSGLFLLVQVVLLLDFVHRWNDTRILSSSLLWYIALFVVSLFCYVAT  199

Query  678  FAITGVLFHFFAPSGQ  725
            F  +G+LFH+F P+G 
Sbjct  200  FVSSGLLFHWFTPAGH  215



>ref|XP_011466994.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466995.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466996.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466997.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
Length=414

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 185/211 (88%), Gaps = 1/211 (0%)
 Frame = +3

Query  96   MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  275
            MWAASCLASCCA CAC+ C++ VS ISRRSARIAYC LF  SLI SWILR+VA PL+E I
Sbjct  1    MWAASCLASCCAGCACNLCQSAVSSISRRSARIAYCFLFAFSLIASWILRDVAPPLLEKI  60

Query  276  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  455
            PWINHFH+ PDREWFET+AVLRVSLGNF FFTILS++MIG+K+QKDPRD++HHGGWMMKV
Sbjct  61   PWINHFHQIPDREWFETEAVLRVSLGNFLFFTILSVVMIGVKSQKDPRDSIHHGGWMMKV  120

Query  456  ICW-FLLVIFMFFVPNELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFW  632
            ICW  L++  +FFVPN +ISFYE+ +KFGSG FLLVQVVLLLDFVHGWNDKWV YDEQFW
Sbjct  121  ICWFLLVLFSLFFVPNGVISFYETIAKFGSGFFLLVQVVLLLDFVHGWNDKWVSYDEQFW  180

Query  633  YVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            YVAL VVSLVCY+ATF  +G+LFH F PSG 
Sbjct  181  YVALFVVSLVCYLATFVFSGLLFHLFTPSGH  211



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            ARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDAVLRVSLGNF F
Sbjct  1    ARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDAVLRVSLGNFVF  60

Query  366  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG  545
            FTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++SFYES SKFGSG
Sbjct  61   FTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVSFYESISKFGSG  120

Query  546  lfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            LFLLVQVVLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+  F+ +G+LFH+F PSG 
Sbjct  121  LFLLVQVVLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIGAFSFSGLLFHWFTPSGH  180



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 162/191 (85%), Gaps = 16/191 (8%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IP+                A
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPY----------------A  63

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+PNE++S
Sbjct  64   VLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVS  123

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            FYE+ SKFGSG FLLVQVVLLLDFVHGWNDKWVGYDEQFWY+AL VVSLVCY+ATF  +G
Sbjct  124  FYETISKFGSGFFLLVQVVLLLDFVHGWNDKWVGYDEQFWYIALFVVSLVCYLATFVFSG  183

Query  693  VLFHFFAPSGQ  725
            +LFH+F PSG 
Sbjct  184  LLFHWFTPSGH  194



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            ++   ++RRSAR+AYCGLFG SLI++WILREVAAPLME IPWIN F  TP +EWF+T AV
Sbjct  12   SLAGTVTRRSARLAYCGLFGFSLIIAWILREVAAPLMEKIPWINDFVHTPTKEWFQTSAV  71

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FFTI ++ MIGIK QKD RD  HHGGW++K+ICW LLV+ MFF+PN +IS 
Sbjct  72   LRVSLGNFLFFTIFAVTMIGIKTQKDIRDGWHHGGWIVKIICWALLVVLMFFLPNSVISV  131

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE+ SKFGSGLFLLVQV++LLDF H WND WV  DEQFWY+ALLVVS+VCY+ TFA +G+
Sbjct  132  YETLSKFGSGLFLLVQVIILLDFTHTWNDAWVAKDEQFWYIALLVVSIVCYLVTFAFSGL  191

Query  696  LFHFFAPSGQ  725
            LF++F PSG 
Sbjct  192  LFYWFNPSGH  201



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            ++V  GISRRSARIAYCGLF LSL V+WI RE+A PLME IPWIN+F +TP REWF+TDA
Sbjct  20   KSVAGGISRRSARIAYCGLFALSLFVAWIFREIAPPLMEKIPWINYFAETPSREWFQTDA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLG+F FF + +++MIG+K+Q+D RD+ HHGGWM K++ W  LV+ MFFVPN LI 
Sbjct  80   VLRVSLGSFLFFAVFALIMIGVKDQRDARDSWHHGGWMAKIMTWCTLVVLMFFVPNGLIG  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             YE+ SKFGSGLFLL+QVVLLLDF H WN+ WV  DEQFWY+ALLVVSLVCY+ TFA +G
Sbjct  140  IYETLSKFGSGLFLLIQVVLLLDFTHTWNNAWVSKDEQFWYIALLVVSLVCYIGTFAFSG  199

Query  693  VLFHFFAPSG  722
            +LFH+F PSG
Sbjct  200  LLFHWFNPSG  209



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V SGISRRSAR+AYCGLFG SLIVSWILREVAAPLME IPWIN +  TP +EWF+T+A
Sbjct  17   SSVASGISRRSARLAYCGLFGASLIVSWILREVAAPLMEKIPWINTYAHTPSKEWFQTNA  76

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF + +++MIG+K+Q D RD+ HHGGW++K++ W LL+I MFFVPN +I+
Sbjct  77   VLRVSLGNFLFFVVFALVMIGVKDQNDKRDSWHHGGWILKIVVWVLLIILMFFVPNAIIT  136

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             YE+ SKFGSGLFLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+A F  +G
Sbjct  137  IYETLSKFGSGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLAAFTFSG  196

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  197  ILFIWFNPSGH  207



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  264  MENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGW  443
            ME+IPWINHF  TP REWFETDAVLRVSLGNF FFTIL+++M+G+KNQKDPRD LHHGGW
Sbjct  1    MESIPWINHFKHTPSREWFETDAVLRVSLGNFLFFTILAVLMVGVKNQKDPRDGLHHGGW  60

Query  444  MMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDE  623
            MMK+ICWFLLVIFMFF+PNE+ISFYE+ SKFGSG   L+  V+LLDFVHGWNDKWVG+DE
Sbjct  61   MMKIICWFLLVIFMFFLPNEIISFYETISKFGSG-MFLLVQVVLLDFVHGWNDKWVGFDE  119

Query  624  QFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            QFWYVAL VVSLVCY+ATF  +GVLFH F PSGQ
Sbjct  120  QFWYVALFVVSLVCYLATFVFSGVLFHLFTPSGQ  153



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = +3

Query  96   MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  275
            MWAASCLASCCA C C  C +V +GISRRSAR+ YCGLF LSL++SWILREVAAPL+E I
Sbjct  1    MWAASCLASCCATCTCGLCTSVAAGISRRSARLGYCGLFALSLVISWILREVAAPLLEKI  60

Query  276  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  455
            PWIN F   P +EWF+T+AVLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW++K+
Sbjct  61   PWINTFTHAPPKEWFQTNAVLRVSLGNFLFFAIFALLMIGVKDQNDKRDSWHHGGWIVKI  120

Query  456  ICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWY  635
            I W LL++ MFF+PN +I+ YE+ SKFGSG FLLVQVV+LLDF H WND WV  DEQ WY
Sbjct  121  IIWALLIVLMFFLPNIVITIYETLSKFGSGFFLLVQVVILLDFTHTWNDAWVEKDEQKWY  180

Query  636  VALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            VALL +++VCY+AT+A +GVLF +F PSG 
Sbjct  181  VALLSITVVCYLATYAFSGVLFMWFNPSGH  210



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 158/184 (86%), Gaps = 2/184 (1%)
 Frame = +3

Query  177  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINH-FHKTPDREWFETDAVLRVSLG  353
            R SARIAYCGLF LSLIVSWIL EVAAP MEN PWI+H F +TP++EWFETDAVLRV+LG
Sbjct  23   RLSARIAYCGLFALSLIVSWILGEVAAPPMENHPWIDHNFQQTPNKEWFETDAVLRVNLG  82

Query  354  NFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSK  533
            NF FFTIL+++MIGIK++ D RD LHHGG M K++ W L+VIFMFF+PN + SFYE+ SK
Sbjct  83   NFLFFTILAVLMIGIKDE-DSRDRLHHGGXMTKIVSWCLVVIFMFFLPNGIASFYETVSK  141

Query  534  FGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFA  713
            FGSGLFLLVQVV+LLDFVHGWND+WV  DEQFWY+AL VVSL  YVATF+ +G+LFH+F 
Sbjct  142  FGSGLFLLVQVVMLLDFVHGWNDRWVRKDEQFWYIALSVVSLAGYVATFSFSGLLFHWFT  201

Query  714  PSGQ  725
            PSG 
Sbjct  202  PSGH  205



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = +3

Query  96   MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  275
            MWAASCLASCCA+C C  C +V S +SRRSAR+AYCGLF LSLI+SWILREVAAPL+E I
Sbjct  1    MWAASCLASCCASCTCGLCTSVASSMSRRSARLAYCGLFALSLILSWILREVAAPLLEKI  60

Query  276  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  455
            PWIN F  TP +EWF+TDAVLRVSLGNF FF I ++MMIG+K+Q D R + HHGGW+ K+
Sbjct  61   PWINTFSHTPSKEWFQTDAVLRVSLGNFLFFAIFALMMIGVKDQNDKRYSWHHGGWIAKI  120

Query  456  ICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWY  635
            + W +L+I MFF+PN +I+ YE+ SKFGSG FLLVQV+LLLDF + WND WV  DEQ WY
Sbjct  121  VVWAVLIILMFFLPNIVITIYETLSKFGSGFFLLVQVILLLDFTYTWNDAWVEKDEQKWY  180

Query  636  VALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            +ALL VS+VCY+AT++ +GVLF +F PSG 
Sbjct  181  IALLSVSVVCYLATYSFSGVLFMWFNPSGH  210



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            + V SGISRRSARIAYCGLF LSLIVSW+LR+ A PL+  IPWIN F  TP  EWF T A
Sbjct  20   QGVASGISRRSARIAYCGLFALSLIVSWLLRDFAGPLLAKIPWINTFTDTPSPEWFATQA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF   +I+MIG+K+Q++ RD+ HHGGWM+K+I W + +I MFF+PN L+S
Sbjct  80   VLRVSLGNFLFFLAFAILMIGVKDQREQRDSWHHGGWMVKLILWCITIILMFFLPNGLVS  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y S S+FGSGLFLL+QVV+LLDF H WN  WV  DEQFWY+ALL VS+ CY+A+F  +G
Sbjct  140  AYGSVSRFGSGLFLLIQVVILLDFTHNWNAAWVAKDEQFWYIALLAVSIGCYLASFVFSG  199

Query  693  VLFHFFAPSG  722
             LFH+F PSG
Sbjct  200  FLFHWFTPSG  209



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 152/191 (80%), Gaps = 1/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  A
Sbjct  18   SSVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSYSKEWYQQQA  76

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S
Sbjct  77   VLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIAWFLLVVLMFFVPNVIVS  136

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y + SKFG+G FLLVQVVLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+A +G
Sbjct  137  IYGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSG  196

Query  693  VLFHFFAPSGQ  725
            +LF +F PSGQ
Sbjct  197  ILFIWFNPSGQ  207



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E + WIN    +  +EW++  AV
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKLSWINT-SDSYTKEWYQQQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPNE+IS 
Sbjct  77   LRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNEIISI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+G FLLVQVVLLLD  H WND WV  DE+ WYVALLV+S+VCY+AT+A +GV
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDERKWYVALLVISIVCYIATYAFSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFMWFNPSGH  206



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E + WIN    +  +EW++  AV
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKLSWINT-SDSYTKEWYQQQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPNE+IS 
Sbjct  77   LRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNEIISI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+G FLLVQVVLLLD  H WND WV  DE+ WYVALLV+S+VCY+AT+A +GV
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDERKWYVALLVISIVCYIATYAFSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFMWFNPSGH  206



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 151/191 (79%), Gaps = 1/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  A
Sbjct  18   SSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSYTKEWYQQQA  76

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S
Sbjct  77   VLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVS  136

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y + SKFG+G FLLVQVVLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+  +G
Sbjct  137  LYGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYTFSG  196

Query  693  VLFHFFAPSGQ  725
            +LF +F PSGQ
Sbjct  197  ILFIWFNPSGQ  207



>gb|KDO46126.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
 gb|KDO46127.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
Length=143

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +3

Query  162  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  341
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP REWFETDAVLR
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFETDAVLR  82

Query  342  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  518
            VSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+PNE++SFY
Sbjct  83   VSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSFY  141



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS++SARIAYCGLFG+SL+VSWILREV APL+E  PWI+   +T  +EW++  AV
Sbjct  18   SVASGISKKSARIAYCGLFGVSLVVSWILREVGAPLLEKFPWISK-SETHTKEWYQIQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W +LV+ MFF+P+ +ISF
Sbjct  77   LRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLVLVVLMFFIPDAVISF  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y + SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALLVVS+ CY+A FA +G+
Sbjct  137  YGTLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLVVSVGCYLAAFAFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSGQ
Sbjct  197  LFIWFNPSGQ  206



>gb|KJB28194.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=291

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            TV SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E +PWI     T  + W++  AV
Sbjct  18   TVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKLPWIKS--STQTKTWYQEQAV  75

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLVI MFF+PN +I+ 
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDSWHHGGWTAKMVIWILLVILMFFLPNVVITV  135

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFG+G+FLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+  FA +G+
Sbjct  136  YEILSKFGAGMFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLVAFAFSGI  195

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  196  LFIWFNPSGH  205



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E  PWIN    +  +EW++  AV
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKFPWINT-SDSYTKEWYQQQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN +IS 
Sbjct  77   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVIISV  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+G FLLVQVVLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+A +GV
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHSWNDSWVEKDERKWYIALLVISIVCYLATYAFSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFMWFNPSGH  206



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFH-KTPDREWFETD  329
             +V SGIS++SAR+AYCGLFGLSLIVSWILREV  PL+E  PWIN     T  +EW++  
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLIVSWILREVGTPLLEKFPWINTSDGDTRTKEWYQIQ  76

Query  330  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  509
            AVLRVSLGNF FF ILS++MIGIK+Q D RD+ HHGGW  K+I W LLV+ MFF+PN +I
Sbjct  77   AVLRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLPNVVI  136

Query  510  SFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAIT  689
            S YE+ SKFG+GLFLLVQV++LLD VH WND WV  DEQ WYVALL +S+ CY+A F  +
Sbjct  137  SIYETISKFGAGLFLLVQVIILLDGVHTWNDAWVAKDEQKWYVALLAISVGCYLAAFTFS  196

Query  690  GVLFHFFAPSGQ  725
            G+LF +F PSG 
Sbjct  197  GILFIWFNPSGH  208



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  + W++ DAV
Sbjct  18   SVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SQTHTKGWYQIDAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P+ +I+ 
Sbjct  77   LRVSLGNFLFFVTFALLMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVILMFFLPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALLVVS+VCY+A F I+G+
Sbjct  137  YGVLSKFGAGLFLLVQVLILLDFTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFTISGI  196

Query  696  LFHFFAPSGQ  725
            +F +F PSG+
Sbjct  197  MFIWFNPSGE  206



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS RSAR+AYCGLFGLSLIVSWILREVAAPL++ IPWI+   +T  + W++T AV
Sbjct  18   SVASGISNRSARLAYCGLFGLSLIVSWILREVAAPLLKKIPWISS-SETHTKVWYQTQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FFT  +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFTAFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFMPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALLVVS+VCY+A FA++GV
Sbjct  137  YGFLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFALSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG+
Sbjct  197  LFIWFNPSGE  206



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS++SAR+AYCGLFGLSLI+SWILREV APL+E  PWIN       +EWF+  AV
Sbjct  18   SVASGISKKSARLAYCGLFGLSLIISWILREVGAPLLEKFPWINT-SDDQSKEWFQIQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW +K++ W LLVI MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGVLALLMIGVKDQNDRRDSWHHGGWTVKMVIWALLVILMFFIPNVVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLD  H WND WV  DEQ WY+ALLV+S+VCY+  +A++GV
Sbjct  137  YGFISKFGAGLFLLVQVIILLDATHTWNDAWVAKDEQKWYIALLVISVVCYLGAYALSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFIWFNPSGH  206



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 150/191 (79%), Gaps = 1/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +   EW++  A
Sbjct  18   SSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSYTTEWYQQQA  76

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S
Sbjct  77   VLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVS  136

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y + SKFG+G FLLVQVVLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+A +G
Sbjct  137  IYGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSG  196

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  197  ILFIWFNPSGH  207



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V +GISR+SAR+AYCGLFGLSLIVSWILREV APL++ IPWI+   +T  +EW++ +AV
Sbjct  18   SVAAGISRKSARLAYCGLFGLSLIVSWILREVGAPLLKKIPWISS-SQTHTKEWYQIEAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P+ +I+ 
Sbjct  77   LRVSLGNFLFFVTFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVILMFFLPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALLVVS+VCY+A F I+G+
Sbjct  137  YGVLSKFGAGLFLLVQVLILLDFTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFTISGI  196

Query  696  LFHFFAPSGQ  725
            +F +F PSG+
Sbjct  197  MFIWFNPSGE  206



>gb|KJB28193.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=410

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            TV SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E +PWI     T  + W++  AV
Sbjct  18   TVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKLPWIKS--STQTKTWYQEQAV  75

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLVI MFF+PN +I+ 
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDSWHHGGWTAKMVIWILLVILMFFLPNVVITV  135

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFG+G+FLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+  FA +G+
Sbjct  136  YEILSKFGAGMFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLVAFAFSGI  195

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  196  LFIWFNPSGH  205



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 148/191 (77%), Gaps = 1/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V SGIS++SAR+ YCGLFGLSLIVSWILREV APL++ +PWIN    T   EWF+  A
Sbjct  7    SSVASGISKKSARLGYCGLFGLSLIVSWILREVGAPLLKKLPWINS-SDTHSEEWFQIQA  65

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+PN +IS
Sbjct  66   VLRVSLGNFLFFAIFALIMIGVKDQNDKRDSWHHGGWIAKMVIWLLLVVLMFFMPNVIIS  125

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y   SKFG+GLFLL QV++LLDF H WND WV  DEQ WY+ALL VS+VCY+A F  +G
Sbjct  126  IYGIASKFGAGLFLLFQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIVCYLAAFTFSG  185

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  186  ILFLWFNPSGH  196



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  +V
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSFTKEWYQQQSV  77

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S 
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSI  137

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y + SKFG+G FLLVQVVLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+A +G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  198  LFIWFNPSGH  207



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  AV
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSFTKEWYQQQAV  77

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV  MFFVPN ++S 
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVPNVIVSI  137

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y + SKFG+G FLLVQVVLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+A +G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  198  LFIWFNPSGH  207



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  AV
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSFTKEWYQQQAV  77

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV  MFFVPN ++S 
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVPNVIVSI  137

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y + SKFG+G FLLVQVVLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+A +G+
Sbjct  138  YGTLSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGI  197

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  198  LFIWFNPSGH  207



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            + V  GISRRSARIAYCGLF LSL+++WILR+   P++E IPWIN F  TP++EWF T A
Sbjct  20   KGVAGGISRRSARIAYCGLFTLSLLLAWILRDFGYPVLEKIPWINSFAHTPNKEWFGTQA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF   +I+MIG+KNQ D RD+ HHGGWM K+I W  +++ MFF+PN L+ 
Sbjct  80   VLRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWLTVMVLMFFLPNGLVD  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y + S+FGSG+FLLVQV++LLDF H WN  WV  DEQFWY+ALL++S+ CY  +F  +G
Sbjct  140  AYGAISRFGSGVFLLVQVIILLDFTHNWNAAWVAKDEQFWYIALLLISIFCYTISFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  200  LLFRWFNPSGH  210



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score =   230 bits (587),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
            + V  GISRRSARIAYCGLF LSL+++WILR+   P++E IPWIN F  TP++EWF T A
Sbjct  20   KGVAGGISRRSARIAYCGLFTLSLLLAWILRDFGYPVLEKIPWINSFAHTPNKEWFGTQA  79

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF   +I+MIG+KNQ D RD+ HHGGWM K+I W  +++ MFF+PN L+ 
Sbjct  80   VLRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWLTVMVLMFFLPNGLVD  139

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y + S+FGSG+FLLVQV++LLDF H WN  WV  DEQFWY+ALL++S+ CY  +F  +G
Sbjct  140  AYGAISRFGSGVFLLVQVIILLDFTHNWNAAWVAKDEQFWYIALLLISIFCYTISFVFSG  199

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  200  LLFRWFNPSGH  210



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGI+ +SARIAYCGLFG SL+VSWILREVA+PL+E  PWIN+   T  +EW++T  V
Sbjct  18   SVASGITNKSARIAYCGLFGASLVVSWILREVASPLLEKFPWINNADHT--KEWYQTSTV  75

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGWM+K+I W LL++ MFF+PN ++  
Sbjct  76   LRVSLGNFLFFAVLALIMIGVKDQNDKRDSWHHGGWMVKMIIWILLIVLMFFMPNVVVDI  135

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQVVLLLDF + WND WV  DEQ WYVALL VS+ CY+A FA +G+
Sbjct  136  YGILSKFGAGLFLLVQVVLLLDFTYTWNDAWVEKDEQKWYVALLAVSVGCYIAAFAFSGI  195

Query  696  LFHFFAPSGQ  725
            LF +F PSGQ
Sbjct  196  LFIWFNPSGQ  205



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SG++R SAR+AYCGLFG+SLIVSW++REVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCGLFGVSLIVSWVIREVASPLLKNFSWINT-SDNLSKEWFQAQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L+++MIGIK+Q D RD LHHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGVLALIMIGIKDQNDRRDCLHHGGWVAKLVIWVLLVALMFFLPNGVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+G FLL+QV++LLD  H WND WV  DEQ WYVALLVVS+ CY+ATF  +G+
Sbjct  137  YGFLSKFGAGFFLLIQVIILLDATHSWNDSWVAKDEQKWYVALLVVSVACYIATFVFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFMWFNPSGH  206



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E  PWIN    T  +EW++  AV
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKFPWINT-SDTYTKEWYQQQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF I +++M+G+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S 
Sbjct  77   LRVSFGNFLFFAIYALIMVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVVVSI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+G FLLVQVVLLLD  H WND WV  DE+ W+VALLV+S+VCYVAT+A +G+
Sbjct  137  YGILSKFGAGAFLLVQVVLLLDATHNWNDSWVEKDERKWFVALLVISVVCYVATYAFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F P G 
Sbjct  197  LFMWFNPPGH  206



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +3

Query  192  IAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFT  371
            +AYCG F LSLI++WILREVAAPL+E IPWIN F  TP +EWF+TDAVLRVSLG+F FF 
Sbjct  33   LAYCGFFALSLILAWILREVAAPLLEKIPWINTFTHTPSKEWFQTDAVLRVSLGSFLFFA  92

Query  372  ILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlf  551
            I ++MMIG+K+Q D RD+ HHGGW+ K++ W +L++ MFF+PN +I+ YE+ SKFGSG F
Sbjct  93   IFALMMIGVKDQNDKRDSWHHGGWIAKIVIWVVLIVLMFFLPNIVITIYETLSKFGSGFF  152

Query  552  llvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            L  QV+LLLDF + WND WV  DEQ WY+ALL VS VCY+AT++ +GVLF +F PSG 
Sbjct  153  LFAQVILLLDFTYTWNDAWVEKDEQKWYIALLSVSAVCYLATYSFSGVLFMWFNPSGH  210



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V SGIS++SAR+AYCGLFGLSL+VSWILREVAAPL+E +PWIN    T    WF+  A
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLVVSWILREVAAPLLEKLPWINT--STHTEAWFQQQA  74

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGN  FF IL+++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+PN +I+
Sbjct  75   VLRVSLGNCLFFAILALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFLPNVVIT  134

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y + SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+A F  +G
Sbjct  135  VYGTLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSVGCYLAAFVFSG  194

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  195  ILFIWFNPSGH  205



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SG++R SAR+AYCGLFG+SLIVSW+LREVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCGLFGVSLIVSWVLREVASPLLKNFSWINT-SDNLSKEWFQAQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L+++MIGIK+Q D RD+ HHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGVLALIMIGIKDQNDRRDSWHHGGWVAKLVIWVLLVALMFFLPNGVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+G FLL+QV++LLD  H WND WV  DEQ WYVALLVVS+ CY+ATF  +G+
Sbjct  137  YGFLSKFGAGFFLLIQVIILLDATHSWNDSWVAKDEQKWYVALLVVSVACYIATFVFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFMWFNPSGH  206



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +  S I+RRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F +TP  EWF+ + V
Sbjct  21   SAASSITRRSARLAYCGLFAASLILSFLLRQFAAPLLQHIPWINTFDETPPEEWFQMNVV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K+  W +L++ MFFVPN +I+ 
Sbjct  81   LRVSLGNFLFFGIFALMMIGVKDQNDRRDAWHHGGWIAKIAVWVVLIVLMFFVPNIVITV  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFGSGLFLLVQVV+LLDF + WND WV  DEQ W +ALLVV++VCY++TFA +GV
Sbjct  141  YEMLSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWEIALLVVTVVCYLSTFAFSGV  200

Query  696  LFHFFAPSGQ  725
            LF  F PSG 
Sbjct  201  LFMLFNPSGH  210



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 151/191 (79%), Gaps = 1/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V SGIS+RSAR+AYCGLFG SLIVSWILREVAAPL++ IPWI+   +T   EW++ +A
Sbjct  17   SSVASGISKRSARLAYCGLFGGSLIVSWILREVAAPLLKKIPWIST-SQTHSTEWYQQEA  75

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LL+I MFFVPN +IS
Sbjct  76   VLRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVPNVVIS  135

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             Y + SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+  F  +G
Sbjct  136  IYGTLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLLAFTFSG  195

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  196  ILFIWFNPSGN  206



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SG++R SAR+AYC LFG+SLIVSW+LREVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCALFGVSLIVSWVLREVASPLLKNFSWINT-SDNYSKEWFQAQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWVLLVALMFFLPNGVITV  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLL+QV++LLD  H WND WV  DEQ WY+ALLV+S+ CY+ATFA +G+
Sbjct  137  YSFISKFGAGLFLLIQVIILLDATHSWNDSWVAKDEQKWYIALLVISVGCYIATFAFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFMWFNPSGH  206



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SG++R SAR+AYC LFG+SLIVSW+LREVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCALFGVSLIVSWVLREVASPLLKNFSWINT-SDNYSKEWFQAQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWMLLVALMFFLPNGVITV  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLL+QV++LLD  H WND WV  DEQ WY+ALLV+S  CY+ATFA +G+
Sbjct  137  YSFISKFGAGLFLLIQVIILLDATHSWNDSWVAKDEQKWYIALLVISAGCYIATFAFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFMWFNPSGH  206



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS++SAR+AYCGLFGLSLIVSWILRE  APL+E +PWI     T  +EWF+  AV
Sbjct  21   SVASGISKKSARLAYCGLFGLSLIVSWILREFGAPLIEKLPWIKS-SVTHSKEWFQIQAV  79

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LL++ MFF+PN +I+ 
Sbjct  80   LRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLLVLMFFMPNVVIAI  139

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALLVVS+VCY+A FA +GV
Sbjct  140  YGIISKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLVVSVVCYLAAFAFSGV  199

Query  696  LFHFFAPSGQ  725
            LF +F PSGQ
Sbjct  200  LFIWFNPSGQ  209



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +  S +SRRSAR+AYCGLF  SLI+S++LR+ A PL+++IPWIN F  TP  EWF+ +AV
Sbjct  21   SAASAVSRRSARLAYCGLFAASLILSFLLRQFATPLLKHIPWINAFEHTPPDEWFQMNAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I +IMMIGIK+Q D RD  HHGGW+ K+  W +L++ MF VPN + + 
Sbjct  81   LRVSLGNFLFFAIFAIMMIGIKDQNDRRDAWHHGGWVAKIAVWAVLIVLMFCVPNIVTTI  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFGSGLFLLVQVV+LLDF + WND WV  DEQ W +ALLVV++VCY++TFA +GV
Sbjct  141  YEVLSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWEIALLVVTVVCYLSTFAFSGV  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFMWFNPSGH  210



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGISR+SAR+AYCGLFG SL+VSWILRE AAPL++  PWIN       +EW++  AV
Sbjct  18   SVASGISRKSARLAYCGLFGASLVVSWILREFAAPLLKKFPWINT-SDAYTKEWYQQQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF + +++MIG+K+Q D RD+ HHGGW++K+I WFLLV  MFFVPN ++S 
Sbjct  77   LRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVPNVIVSI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y + SKFG+G FLLVQV+LLLD  H WND WV  DE+ WY+ALLV+S+ CY+AT+  + +
Sbjct  137  YGTLSKFGAGAFLLVQVILLLDATHNWNDAWVEKDERKWYIALLVISIACYLATYGFSAI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFIWFNPSGH  206



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGISR+SAR+AYCGLFG SL+VSWILRE AAPL++  PWIN       +EW++  AV
Sbjct  18   SVASGISRKSARLAYCGLFGASLVVSWILREFAAPLLKKFPWINT-SDAYTKEWYQQQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS GNF FF + +++MIG+K+Q D RD+ HHGGW++K+I WFLLV  MFFVPN ++S 
Sbjct  77   LRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVPNVIVSI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y + SKFG+G FLLVQV+LLLD  H WND WV  DE+ WY+ALLV+S+ CY+AT+  + +
Sbjct  137  YGTLSKFGAGAFLLVQVILLLDATHNWNDAWVEKDERKWYIALLVISIACYLATYGFSAI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFIWFNPSGH  206



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGI++RSARIAYCGLFG+SLIVSWILREVAAPL+++  WIN       +EWF+  AV
Sbjct  18   SVASGITKRSARIAYCGLFGVSLIVSWILREVAAPLLKHFSWINT-SDNLSKEWFQIQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HH GW+ K++ W LL+I MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHDGWIAKMLIWALLIILMFFLPNVIITV  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLD  H WND WV  DEQ WY+ALL VS+ CY+  F I+G+
Sbjct  137  YGVLSKFGAGLFLLVQVIILLDATHSWNDSWVAKDEQKWYLALLAVSVACYLGAFTISGL  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFIWFNPSGH  206



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +  S +SRRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F +TP  EWF+ +AV
Sbjct  21   SAASAVSRRSARLAYCGLFAASLILSFLLRQFAAPLLKHIPWINAFDQTPPEEWFQMNAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF   ++MMIG+K+Q D RD  HHGGW+ KV  W +L++ MF VPN +I+ 
Sbjct  81   LRVSLGNFLFFATFALMMIGVKDQNDRRDAWHHGGWIAKVAVWAVLIVLMFCVPNIVITI  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFGSG FLLVQVV+LLDF + WND W+  +E+ W +ALLVV++VCY++TFA +GV
Sbjct  141  YEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWIEKEERKWEIALLVVTVVCYLSTFAFSGV  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFMWFNPSGH  210



>gb|KCW60869.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=383

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V  GIS+RSAR+AYCGLFGLSLIVSW+LREVAAPL+E I WIN    T  + WF+  A
Sbjct  17   SSVAGGISKRSARLAYCGLFGLSLIVSWVLREVAAPLLEKISWINTGSHT--KAWFQMQA  74

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF IL+++MIG+K+Q D RD++ HGGW+ K+I W LLV+ MFF+PNE+I+
Sbjct  75   VLRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLPNEVIT  134

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             YE+ SKFG+GLFLLVQV++LLD  H WND WV  DEQ WYVALLV+S+ CY+A + ++G
Sbjct  135  IYETLSKFGAGLFLLVQVIILLDCTHSWNDAWVAKDEQKWYVALLVISVGCYIAAYTLSG  194

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  195  ILFIWFNPSGH  205



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  332
             +V  GIS+RSAR+AYCGLFGLSLIVSW+LREVAAPL+E I WIN    T  + WF+  A
Sbjct  17   SSVAGGISKRSARLAYCGLFGLSLIVSWVLREVAAPLLEKISWINTGSHT--KAWFQMQA  74

Query  333  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  512
            VLRVSLGNF FF IL+++MIG+K+Q D RD++ HGGW+ K+I W LLV+ MFF+PNE+I+
Sbjct  75   VLRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLPNEVIT  134

Query  513  FYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             YE+ SKFG+GLFLLVQV++LLD  H WND WV  DEQ WYVALLV+S+ CY+A + ++G
Sbjct  135  IYETLSKFGAGLFLLVQVIILLDCTHSWNDAWVAKDEQKWYVALLVISVGCYIAAYTLSG  194

Query  693  VLFHFFAPSGQ  725
            +LF +F PSG 
Sbjct  195  ILFIWFNPSGH  205



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +  S +SRRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F +TP  EWF+ +AV
Sbjct  21   SAASAVSRRSARLAYCGLFAASLILSFLLRQFAAPLLKHIPWINAFDQTPPEEWFQMNAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I S++MIG+K+Q D RD  HHGGW+ K+  W +L++ MF VPN +I+ 
Sbjct  81   LRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWAVLIVLMFCVPNIVITI  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFGSG FLLVQVV+LLDF + WND WV  +E+ W +ALLVV++VCY++T A +GV
Sbjct  141  YEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWVEKEERKWEIALLVVTVVCYLSTLAFSGV  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFMWFNPSGH  210



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLD  H WND WV  DEQ WY+ALLVVS+VCY+A FA +GV
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFAFSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG+
Sbjct  197  LFIWFNPSGE  206



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLD  H WND WV  DEQ WY+ALLVVS+VCY+A FA +GV
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFAFSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG+
Sbjct  197  LFIWFNPSGE  206



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLD  H WND WV  DEQ WY+ALLVVS+VCY+A FA +GV
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLVVSIVCYLAAFAFSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG+
Sbjct  197  LFIWFNPSGE  206



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLD  H WND WV  DEQ WY+ALL+VS+VCY+A FA +GV
Sbjct  137  YGVVSKFGAGLFLLVQVIILLDCTHSWNDAWVEKDEQKWYIALLIVSIVCYLAAFAFSGV  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG+
Sbjct  197  LFIWFNPSGE  206



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 145/190 (76%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGI++RSARI YCGLFG+SLIVSWILRE A P+++++ WIN       +EW++  AV
Sbjct  43   SVASGITKRSARIGYCGLFGVSLIVSWILREFAQPVLKHLSWINT-SDNLSKEWYQMQAV  101

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIGIK Q D RD  HH GW++K++ W  L+I MFF+PN +IS 
Sbjct  102  LRVSLGNFLFFAILAVIMIGIKYQNDKRDFFHHEGWIVKIVIWTTLIILMFFLPNAVISV  161

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLD  H WND WV  D+Q WY+ALLVVS+ CY+  F  +G+
Sbjct  162  YGVVSKFGAGLFLLVQVLMLLDATHSWNDSWVAKDDQKWYIALLVVSISCYIGAFTFSGL  221

Query  696  LFHFFAPSGQ  725
            LF +F PSGQ
Sbjct  222  LFIWFNPSGQ  231



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V +GISR SAR+AYCGLFG+SL+VSWILRE  APLME +PWI    +   +EWF+  AV
Sbjct  18   SVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPLMEKMPWIET--EGQPKEWFQMQAV  75

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W L V+ MFF+PN + S 
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILFVVLMFFLPNVIFSI  135

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   S FG+GLFLLVQVVLLLDF H WND WV  DEQ WY+ALLVVS+ CY+ T+  +G+
Sbjct  136  YGVLSIFGAGLFLLVQVVLLLDFTHSWNDSWVEKDEQKWYIALLVVSIGCYLGTYTFSGL  195

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  196  LFIWFNPSGH  205



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V +GISR SAR+AYCGLFG+SL+VSWILRE  AP+ME +PWI    +    EWF+  AV
Sbjct  18   SVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPIMEKMPWIKT--EGQPEEWFQMQAV  75

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W LLV+ MFF+PN + S 
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFLPNVIFSI  135

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   S FG+GLFLLVQVVLLLDF H WND WV  DEQ WYVALLVVS+ CY+ T+  +G+
Sbjct  136  YGVLSIFGAGLFLLVQVVLLLDFTHSWNDSWVEKDEQKWYVALLVVSIGCYLGTYIFSGL  195

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  196  LFIWFNPSGH  205



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V +GISR SAR+AYCGLFG+SL+VSWILRE  AP+ME +PWI    +    EWF+  AV
Sbjct  18   SVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPIMEKMPWIKT--EGQPEEWFQMQAV  75

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W LLV+ MFF PN + S 
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFXPNVIFSI  135

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   S FG+GLFLLVQVVLLLDF H WND WV  DEQ WYVALLVVS+ CY+ T+  +G+
Sbjct  136  YGVLSIFGAGLFLLVQVVLLLDFTHSWNDSWVEKDEQKWYVALLVVSIGCYLGTYIFSGL  195

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  196  LFIWFNPSGH  205



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +  S ISRRSAR+AYCGLF  SL++S++ R+ A PL++ IPWIN F      EWF+ +AV
Sbjct  21   SAASAISRRSARLAYCGLFAASLVLSFLTRQFATPLLKQIPWINTFDYVQPDEWFQMNAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K++ W +L + MF VPN +I+ 
Sbjct  81   LRVSLGNFLFFAIFALMMIGVKDQNDQRDAWHHGGWIAKIVVWAVLTVLMFCVPNIVITI  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFGSGLFLLVQVV+LLDF + WND WV  DEQ W +ALLVV++VCY++TFA +G+
Sbjct  141  YEILSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWEIALLVVTVVCYLSTFAFSGL  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFMWFNPSGH  210



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS++SARI YC LFG SLI+SWILREV APL+E +PWI+    T  +EW++  AV
Sbjct  18   SVASGISQKSARIGYCFLFGASLIISWILREVGAPLLEKLPWIDS-SDTHTKEWYQVQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW +K + W LL++  FF+P+ +   
Sbjct  77   LRVSLGNFLFFVVLALIMIGVKDQNDRRDSWHHGGWTVKTVIWLLLIVLAFFIPDAVTLA  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLL+QV++LLD  H WND WV  DEQ WY+ALLVVS+ CY+  FA++G+
Sbjct  137  YGFISKFGAGLFLLIQVLILLDCTHSWNDAWVEKDEQKWYIALLVVSIGCYIGAFAVSGI  196

Query  696  LFHFFAPSG  722
            LF +F+P G
Sbjct  197  LFIWFSPGG  205



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 144/190 (76%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGI+ RSARI YCGLFG SLIVSW+LREV  P++ ++ WIN     P +EWF+  AV
Sbjct  18   SVASGITNRSARIGYCGLFGASLIVSWVLREVGEPILRHLSWINTSDHLP-KEWFQVQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF +L++ MIG+K+Q D RD+LH GGW+ K + W LL++ MFFVPN + + 
Sbjct  77   LRVSLGNFLFFAVLALTMIGVKHQNDKRDSLHRGGWIAKFLIWALLIVLMFFVPNAVTNI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+G+FLLVQVVLLLD VH WND WV  DEQ WY+ALLVV++ CY+ T+A +G+
Sbjct  137  YGILSKFGAGVFLLVQVVLLLDAVHTWNDSWVDKDEQKWYIALLVVTVACYIGTYAFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F P G 
Sbjct  197  LFIWFNPPGH  206



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS++SARI YC LFG SLIVSWILREV APL+E IPWI+    T  +EW++  AV
Sbjct  18   SVASGISQKSARIGYCFLFGASLIVSWILREVGAPLLEKIPWIDS-SDTHTKEWYQVQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            L VSLGN  FF +L+++MIG+K+Q D RD+ HHGGW +K++ W LL++  FF+P+ ++  
Sbjct  77   LHVSLGNCLFFVVLALIMIGVKDQNDKRDSWHHGGWTVKIVIWLLLIVLAFFIPDSIMLA  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLL+QV++LLD  H WND WV  DEQ WY+ALLVVS+ CY+A F ++G+
Sbjct  137  YGFISKFGAGLFLLIQVIILLDCTHNWNDSWVEKDEQKWYIALLVVSIGCYIAAFTLSGI  196

Query  696  LFHFFAPSG  722
            LF +F P G
Sbjct  197  LFIWFNPGG  205



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            + +S ISRRSAR+AYCGLF  SLI+S+++R+ A PL++ IPWIN F  T   EWF+ +AV
Sbjct  21   SALSAISRRSARLAYCGLFAASLILSFLMRQFATPLLKQIPWINTFDYTQPDEWFQMNAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K++ W +L++ MF VPN +I+ 
Sbjct  81   LRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKIVVWVVLIVLMFCVPNVVITI  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFGSGLFLLVQVV+LLDF + WND W+  DEQ W +ALLVV++VCY++TFA +G+
Sbjct  141  YEVLSKFGSGLFLLVQVVMLLDFTNNWNDSWIEKDEQKWEIALLVVTVVCYLSTFAFSGL  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFTWFNPSGH  210



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS RSAR+AYCGLFG SLI+SWILREVAAPL+E IPWI      P +EW++  AV
Sbjct  22   SVASGISNRSARLAYCGLFGTSLILSWILREVAAPLLEKIPWIKSSGTHP-KEWYQIQAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +IS 
Sbjct  81   LRVSMGNFLFFAVLALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVVLMFFLPDSVISV  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+A F  +G+
Sbjct  141  YGILSKFGAGLFLLVQVIILLDFTHTWNDAWVEKDEQKWYIALLSVSVGCYLAAFTFSGI  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFMWFNPSGH  210



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            + +S ISRRSAR+AYCGLF  SLI+S+++R+ A PL++ IPWIN F  T   EWF+ +AV
Sbjct  21   SALSAISRRSARLAYCGLFAASLILSFLMRQFATPLLKQIPWINTFDYTQPDEWFQMNAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K++ W +L++ MF VPN +I+ 
Sbjct  81   LRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKIVVWVVLIVLMFCVPNVVITI  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            YE  SKFGSGLFLLVQVV+LLDF + WND W+  DEQ W +ALLVV++VCY++TFA +G+
Sbjct  141  YEVLSKFGSGLFLLVQVVMLLDFTNNWNDSWIEKDEQKWEIALLVVTVVCYLSTFAFSGL  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFTWFNPSGH  210



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS RSAR+AYCGLFG SLI+SWILREVAAPL+E IPWI      P +EW++  AV
Sbjct  22   SVASGISNRSARLAYCGLFGASLILSWILREVAAPLLEKIPWIKSSGTHP-KEWYQIQAV  80

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FF IL+++MIG+K++ D RD+ HHGGW+ K++ W LLV+ MFF+P+ +IS 
Sbjct  81   LRVSMGNFLFFAILALIMIGVKDKNDRRDSWHHGGWIAKMVIWLLLVVLMFFLPDSVISV  140

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+A F  +G+
Sbjct  141  YGILSKFGAGLFLLVQVIILLDFTHTWNDAWVEKDEQKWYIALLSVSVGCYLAAFTFSGI  200

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  201  LFMWFNPSGH  210



>ref|XP_004296950.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=409

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS +SAR+ YCGLFGLSL+V+WILREV APL+E IPWI+   +T  + W++T AV
Sbjct  18   SVASGISSKSARLGYCGLFGLSLVVTWILREVGAPLLEKIPWISS-SETHTKAWYQTQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVS+GNF FF IL+++MIG+K++ D RD  HHGGW+ K++ W LL+I MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAILALIMIGVKDRNDRRDGWHHGGWIAKMVIWLLLIILMFFLPDIVITI  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   SKFG+GLFLLVQV++LLDF H WND WV  DEQ WY+ALL VS+ CY+A FA +G+
Sbjct  137  YGDLSKFGAGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYIAAFAFSGI  196

Query  696  LFHFFAPSGQ  725
            LF +F PSG 
Sbjct  197  LFIWFNPSGN  206



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  96   MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  275
            MW ASCLAS CA CAC+ C +  + ++RRSAR+AYCGLF  SLI+S++LR+ AAPL+++I
Sbjct  1    MWCASCLASACAGCACNLCSSAAASVTRRSARLAYCGLFAASLILSFLLRQFAAPLLQHI  60

Query  276  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  455
            PWIN F  TP  EWF+ +AVLR+SLGNF FF I ++ MIG+K+Q D RD  HHGGW+ K 
Sbjct  61   PWINTFDHTPPEEWFQMNAVLRLSLGNFLFFAIFALTMIGVKDQNDRRDAWHHGGWIAKF  120

Query  456  ICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWY  635
              W +LV+ MFFVPN ++S YE  SKFGSGLFLLVQVV+LLDF + WND WV  DEQ W 
Sbjct  121  AIWVVLVVLMFFVPNIVVSVYEILSKFGSGLFLLVQVVMLLDFTNNWNDSWVEKDEQKWE  180

Query  636  VALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            +ALLVV+++CY++TFA +GVLF +F PS  
Sbjct  181  IALLVVTVICYLSTFAFSGVLFMWFNPSDH  210



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 136/192 (71%), Gaps = 16/192 (8%)
 Frame = +3

Query  153  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFH-KTPDREWFETD  329
             +V SGIS++SAR+AYCGLFGLSLIVSWILREV  PL+E  PWIN     T  +EW++  
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLIVSWILREVGTPLLEKFPWINTSDGDTRTKEWYQIQ  76

Query  330  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  509
            AVLRVSLGNF FF ILS++MIGIK+Q D RD+ HHGGW  K+I W LLV+ MFF+PN +I
Sbjct  77   AVLRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLPNVVI  136

Query  510  SFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAIT  689
            S YE+ SKFG+GLFLLVQV++LLD VH WND WV  DEQ                    +
Sbjct  137  SIYETISKFGAGLFLLVQVIILLDGVHTWNDAWVAKDEQ---------------KCIYFS  181

Query  690  GVLFHFFAPSGQ  725
            G+LF +F PSG 
Sbjct  182  GILFIWFNPSGH  193



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 143/189 (76%), Gaps = 3/189 (2%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +  S IS++SARI YCGLFG+SL+VSWILREV APL+E  PWI     T   EW++  AV
Sbjct  18   STASCISQKSARIGYCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTNTTEWYQAQAV  77

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLV+  FF+P+ +I  
Sbjct  78   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLPDAIILV  137

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   +KFG+GLFLL+QV++LLDF H WND WV  DEQ WY+ALL VS+ CY+A F ++G+
Sbjct  138  Y---AKFGAGLFLLIQVIILLDFTHTWNDAWVEKDEQKWYIALLAVSVGCYIAAFTVSGI  194

Query  696  LFHFFAPSG  722
            LF +F PSG
Sbjct  195  LFIWFNPSG  203



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            + VS IS++SARI YCGLFG SLIVSWILREV APL+E  PWI     T  ++W++  AV
Sbjct  18   STVSCISQKSARIGYCGLFGASLIVSWILREVGAPLLEKFPWIGS-SDTHTKDWYQVQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LL++  FF+P+ +I  
Sbjct  77   LRVSLGNFLFFGILALLMIGVKDQNDRRDSWHHGGWPAKLVVWLLLLVLAFFLPDAIILV  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   +KFG+GLFLL+QV++LLDF H WND WV  DEQ WY+ALL VS+ CY+A F ++G+
Sbjct  137  YGFIAKFGAGLFLLIQVIILLDFTHSWNDAWVEKDEQKWYIALLAVSVGCYIAAFTVSGI  196

Query  696  LFHFFAPSG  722
            LF +F PSG
Sbjct  197  LFIWFNPSG  205



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  384  MMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvq  563
            MMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+PNE+ISFYES SKFGSG FLL+Q
Sbjct  1    MMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIISFYESISKFGSGFFLLIQ  60

Query  564  vvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            VVLLLDFVHGWNDKW GYDEQFWY+AL VVSLVCYVA FA +GVLFHFF PSG 
Sbjct  61   VVLLLDFVHGWNDKWAGYDEQFWYIALFVVSLVCYVAAFAFSGVLFHFFTPSGH  114



>gb|AFK34472.1| unknown [Lotus japonicus]
Length=256

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 137/179 (77%), Gaps = 1/179 (1%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +V SGIS++SARI YC LFG SL+VSWI RE+ APL+E IPWI+    T  +EW++  AV
Sbjct  18   SVASGISQKSARIGYCFLFGASLVVSWIFREIGAPLLEKIPWIDS-SDTHTKEWYQVQAV  76

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW +K++ W LL++  FF+P+ +I  
Sbjct  77   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTVKLVIWLLLLVLSFFLPDVIILV  136

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
            Y   SKFG+GLFLLVQV++LLD  H WND WV  DEQ WYVALL VS+ CY+  +A++G
Sbjct  137  YGFISKFGAGLFLLVQVIILLDCTHAWNDAWVEKDEQKWYVALLAVSVGCYIGAYALSG  195



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +  S IS++SARI YCGLFG+SL+VSWILREV APL+E  PWI     T   EW++  AV
Sbjct  18   STASCISQKSARIGYCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTNTTEWYQAQAV  77

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLV+  FF+P+ +I  
Sbjct  78   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLPDAIILV  137

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLV  662
            Y   +K G+GLFLL+QV++LLDF H WND WV  DEQ WY+AL    LV
Sbjct  138  YGFIAKIGAGLFLLIQVIILLDFTHTWNDAWVEKDEQKWYIALTSSVLV  186



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  387  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIF-MFFVPNELISFYESTSKFGSGlfllvq  563
            MIG+K QKDPRD++HHGGWMMKV CWFLLV+F ++FVPN  ISFYE+ +KFGSG FLLVQ
Sbjct  1    MIGVKRQKDPRDSIHHGGWMMKVTCWFLLVLFSLYFVPNGFISFYETIAKFGSGFFLLVQ  60

Query  564  vvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            VVLLLDFVHGWN+KWV YDEQFWYVAL VVSLVCY+ATF   G+LFH F PSG 
Sbjct  61   VVLLLDFVHGWNNKWVSYDEQFWYVALFVVSLVCYLATFVFCGLLFHLFTPSGH  114



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = +3

Query  264  MENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGW  443
            M  I  IN F +TP  EWF+ +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW
Sbjct  1    MYCIAGINAFDQTPPEEWFQMNAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGW  60

Query  444  MMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDE  623
            + K+  W +L++ MF VPN +I+ YE  SKFGSG FLLVQVV+LLDF + WND WV  +E
Sbjct  61   IAKIAVWAVLIVLMFCVPNIVITIYEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWVEKEE  120

Query  624  QFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            + W +ALLVV++VCY++T A +GVLF +F PSG 
Sbjct  121  RKWEIALLVVTVVCYLSTLAFSGVLFMWFNPSGH  154



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  330  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  509
            AVLRVSLGNF FFTI +++MIG+K+Q D RD+ HHGGW+ K+I W LLVI MFF+PN + 
Sbjct  3    AVLRVSLGNFLFFTIFALIMIGVKDQNDRRDSWHHGGWITKIIVWSLLVILMFFLPNAVF  62

Query  510  SFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAIT  689
            + Y   SKFGSGLFLLVQV++LLDF H WND WV  DEQ WY+ALL VS+VCY+ATFA +
Sbjct  63   NMYAMLSKFGSGLFLLVQVIILLDFTHSWNDAWVEKDEQKWYIALLSVSVVCYLATFAFS  122

Query  690  GVLFHFFAPSGQ  725
            G+LF +F PSG 
Sbjct  123  GLLFFWFNPSGN  134



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  387  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqv  566
            M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++SFYES SKFGSGLFLLVQV
Sbjct  1    MAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVPNGVVSFYESISKFGSGLFLLVQV  60

Query  567  vllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            VLLLDFVHGWN+ WV  DEQFWY+ALLVVS+VCY+ +FA +G+LFH+F PSGQ
Sbjct  61   VLLLDFVHGWNENWVAKDEQFWYMALLVVSVVCYIGSFAFSGLLFHWFTPSGQ  113



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 123/185 (66%), Gaps = 3/185 (2%)
 Frame = +3

Query  177  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHF--HKTPDREWFETDAVLRVSL  350
            R+SAR+AYC LF L+++++WILR+ A P+++ +PWI H   H  P  +W+   AV RVS+
Sbjct  8    RKSARLAYCILFTLAMVLAWILRDFAKPIIDKLPWIIHAMGHGEPSAKWYGQQAVYRVSM  67

Query  351  GNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNELISFYEST  527
            GNF FF ++S+ M+G+K + D RD  L HGGW +KV  W L  I  FF P   ++ Y   
Sbjct  68   GNFIFFGLMSLAMVGVKYKSDKRDQYLQHGGWFLKVALWLLFNILPFFFPVSFVNGYGWV  127

Query  528  SKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHF  707
            ++ GS  FL VQ+++LLDFV  WND WV  +++ +  ALL V+ V Y+ TF + G+LF+F
Sbjct  128  ARVGSACFLCVQILMLLDFVTKWNDTWVDKEDERYLWALLTVTCVSYLGTFGLAGILFYF  187

Query  708  FAPSG  722
            F P G
Sbjct  188  FTPVG  192



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  DAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNEL  506
            +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW+ K+  W +L++ MF VPN +
Sbjct  2    NAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWAVLIVLMFCVPNIV  61

Query  507  ISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            I+ YE  SKFGSG FLLVQVV+LLDF + WND WV  +E+ W +ALLVV++VCY++T A 
Sbjct  62   ITIYEVLSKFGSGFFLLVQVVMLLDFTNNWNDSWVEKEERKWEIALLVVTVVCYLSTLAF  121

Query  687  TGVLFHFFAPSGQ  725
            +GVLF +F PSG 
Sbjct  122  SGVLFMWFNPSGH  134



>gb|KIZ05916.1| putative serine incorporator [Monoraphidium neglectum]
Length=447

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 118/195 (61%), Gaps = 5/195 (3%)
 Frame = +3

Query  156  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHK--TPDREWFETD  329
            TV     RRSAR+AY  LF L++++SW  R++A PL+E IPWI        P  +WF   
Sbjct  25   TVTRETMRRSARLAYSFLFFLAILISWAGRDLAKPLIEKIPWIMRAATGFEPSDKWFGQQ  84

Query  330  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNEL  506
            AV R+S+G+F FF  +S+ ++G++ + D R   LH G W  K+  W + +   FF PN L
Sbjct  85   AVYRISMGSFLFFGTMSLALLGVRTKGDKRGAYLHQGNWAAKLAAWLVFIALPFFFPNGL  144

Query  507  ISFYESTSKFGSGlfllvqvvllldfvHGWNDKWV--GYDEQFWYVALLVVSLVCYVATF  680
            +  Y   ++FGSGLFL++Q+++L+DF   WN+ WV  G D+  W  ALL +++  Y    
Sbjct  145  VVAYGWAARFGSGLFLIIQMLILVDFTAAWNESWVAAGEDDDRWLYALLGLTVASYAGVL  204

Query  681  AITGVLFHFFAPSGQ  725
            AI G+LF FF P G 
Sbjct  205  AIAGLLFAFFKPGGA  219



>ref|XP_011397622.1| putative serine incorporator [Auxenochlorella protothecoides]
 gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 116/188 (62%), Gaps = 6/188 (3%)
 Frame = +3

Query  180  RSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHFHK--TPDREWFETDAVLRVSL  350
            RSAR+A+  LF LS+I++WILR+ A PL+  IPWI   F+K   P  EWF   AV R+SL
Sbjct  33   RSARLAWSFLFTLSMILAWILRDFAKPLLMKIPWIVKSFNKGSMPSDEWFGAQAVYRISL  92

Query  351  GNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISFYEST  527
            GN   F  L+++M+G+K   D RD  LHHG W++K   W + ++  F +P  +I+ Y   
Sbjct  93   GNLLLFGSLALVMMGVKRTSDRRDTQLHHGSWLIKAALWTVCILLPFLLPPSVINAYSWV  152

Query  528  SKFGSGlfllvqvvllldfvHGWNDKWV--GYDEQFWYVALLVVSLVCYVATFAITGVLF  701
            ++FGS LFLL Q+V+++D    WND WV  G +++ W   LL  +L       A+  + F
Sbjct  153  ARFGSPLFLLTQMVIVVDVTQAWNDAWVEAGDEDETWLYGLLAATLGALGGCVALAALCF  212

Query  702  HFFAPSGQ  725
            HFFAP+ Q
Sbjct  213  HFFAPASQ  220



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  387  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqv  566
            MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S Y + SKFG+G FLLVQV
Sbjct  1    MIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSLYGTLSKFGAGAFLLVQV  60

Query  567  vllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            VLLLD  H WND WV  DE+ WY+ALLV+S+VCY+AT+  +G+LF +F PSGQ
Sbjct  61   VLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYTFSGILFIWFNPSGQ  113



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +3

Query  387  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqv  566
            M+G+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S Y   SKFG+G FLLVQV
Sbjct  1    MVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVVVSIYGILSKFGAGAFLLVQV  60

Query  567  vllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            VLLLD  H WND WV  DE+ W+VALLV+S+VCYVAT+A +G+LF +F P G 
Sbjct  61   VLLLDATHNWNDSWVEKDERKWFVALLVISVVCYVATYAFSGILFMWFNPPGH  113



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 111/186 (60%), Gaps = 2/186 (1%)
 Frame = +3

Query  171  ISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHK-TPDREWFETDAVLRVS  347
            +S  SAR  Y  +FGL + ++ ++R+ A P+M  IPWI       P  EWF   AV RVS
Sbjct  28   VSSISARAVYTVIFGLGMGIAVVMRDYAKPMMMEIPWIGVVPGMQPSDEWFGQSAVYRVS  87

Query  348  LGNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  524
            LGNF FF  LS M++  K + DPRD ++HHG W +K+  W L VI  F +P+  I  Y  
Sbjct  88   LGNFMFFGGLSAMLVDCKTRSDPRDRHIHHGSWTLKLAAWALCVIVPFLLPDGFIDAYAW  147

Query  525  TSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
             ++ GSG+FL+VQ+V+LLDF   WN+ WV  +   W V LLV ++  Y  +  +   ++ 
Sbjct  148  LARLGSGVFLVVQMVILLDFAFLWNETWVAREHVGWVVGLLVSTIALYAGSITLVVFMYQ  207

Query  705  FFAPSG  722
            ++AP G
Sbjct  208  WYAPKG  213



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +3

Query  387  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGlfllvqv  566
            MIG+K+Q D RD+ HHGGW+ K++ W LL+I MFFVPN +IS Y + SKFG+GLFLLVQV
Sbjct  1    MIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVPNVVISIYGTLSKFGAGLFLLVQV  60

Query  567  vllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ  725
            ++LLDF H WND WV  DEQ WY+ALL VS+ CY+  F  +G+LF +F PSG 
Sbjct  61   IILLDFTHSWNDAWVEKDEQKWYIALLAVSIGCYLLAFTFSGILFIWFNPSGN  113



>ref|XP_006366267.1| PREDICTED: cell wall integrity and stress response component 
4-like isoform X2 [Solanum tuberosum]
Length=122

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 65/88 (74%), Gaps = 8/88 (9%)
 Frame = +3

Query  246  EVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN  425
            EVAA LME I  IN FH T  REWFETDAVL+VSLGNF FFTIL+I+MIG+K+QKDPRD 
Sbjct  2    EVAAFLMEKIRGINSFHTTLSREWFETDAVLQVSLGNFLFFTILAILMIGVKSQKDPRDG  61

Query  426  LHHGGWMMKV--------ICWFLLVIFM  485
            +HHGGWMMK          CW L ++ M
Sbjct  62   VHHGGWMMKSFVGASWLYCCWILCIVGM  89



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 118/186 (63%), Gaps = 4/186 (2%)
 Frame = +3

Query  177  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLRVSLG  353
            R SAR+A+  LF L++IV+WILR+ A P+++ IPWI       D + WF   AV RVS+G
Sbjct  32   RHSARVAWSVLFFLAMIVAWILRDFATPILQKIPWIVKDVTAVDMDKWFGQQAVYRVSMG  91

Query  354  NFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
            NF FF  +S+  IG+K + D RD  LHH   ++K+  W L     F  PN +++ Y   +
Sbjct  92   NFLFFACMSLATIGVKFRGDKRDRYLHHAHPLLKLALWLLFTALPFLFPNGVLNAYSWMA  151

Query  531  KFGSGlfllvqvvllldfvHGWNDKWV--GYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            + GSG+FL++Q+++LLDFV GWND WV  G D+  W   L+ ++ V Y +T  + G +++
Sbjct  152  RVGSGVFLVIQMIILLDFVQGWNDSWVANGEDDDRWLYGLMGLTCVGYGSTLTLAGFMYY  211

Query  705  FFAPSG  722
            +F P+G
Sbjct  212  WFKPAG  217



>ref|XP_005850950.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
 gb|EFN58848.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
Length=367

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 115/190 (61%), Gaps = 9/190 (5%)
 Frame = +3

Query  177  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHF--HKTPDREWFETDAVLRVS  347
            R SAR A+  LF  SL+ +WI R+  + L++ +PWI  HF   + P   WF   AV R+S
Sbjct  29   RSSARAAWSILFTFSLVGAWIARDFGSALLKKLPWILRHFGGGEMPSDAWFGQQAVYRIS  88

Query  348  LGNF---TFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LGNF     F  L+++M G++++ D RD +LHHG W++K   W L     FF+P  ++  
Sbjct  89   LGNFVSGVLFGALAVVMAGVQHKSDRRDRSLHHGHWLLKAGLWALCNALPFFLPVGVVGA  148

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWV--GYDEQFWYVALLVVSLVCYVATFAIT  689
            Y   ++FGS LFLL+Q+++LLD    WND WV  G  +  ++ ALL V+   Y    AI 
Sbjct  149  YSWLARFGSPLFLLIQMIILLDVTQSWNDAWVEAGEGDVRYFHALLAVTAAAYAGCAAIA  208

Query  690  GVLFHFFAPS  719
            G+L+HFFAP+
Sbjct  209  GLLYHFFAPA  218



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 109/189 (58%), Gaps = 8/189 (4%)
 Frame = +3

Query  159  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL  338
            V   +++ SAR  Y  +F +S  +++++R+ A PL++ IPWI               AV 
Sbjct  21   VGDAVAKTSARALYVVMFAISTALAFVMRDCAQPLLKRIPWIARLATM-------NYAVY  73

Query  339  RVSLGNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            R+SLGNF FF  ++  ++G+K + D RD +LHHG W++K   W L  +  FF  N ++  
Sbjct  74   RISLGNFIFFGAMACALVGVKRRSDARDVHLHHGSWVLKFTAWALCNVLPFFASNGVVGA  133

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            Y   ++  SG+FL+VQ+++LLDF   WN+ WV      W V LLV ++V Y  + A+  +
Sbjct  134  YTWVARVASGVFLVVQMIILLDFAFFWNESWVARQHAGWLVGLLVSTIVLYAESVAVVVM  193

Query  696  LFHFFAPSG  722
             F +F+P G
Sbjct  194  AFRWFSPRG  202



>ref|XP_001696805.1| hypothetical protein CHLREDRAFT_192111 [Chlamydomonas reinhardtii]
 gb|EDP00913.1| predicted protein [Chlamydomonas reinhardtii]
Length=211

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 79/127 (62%), Gaps = 2/127 (2%)
 Frame = +3

Query  171  ISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHFHKTPDREWFETDAVLRVS  347
            + R SAR+A+  LF L++I++W+LR+ A P++E IPWI     +    +WF   AV RVS
Sbjct  30   VLRHSARVAWSVLFFLAMILAWVLRDFATPILEKIPWIVKDVTQVDMDKWFGQQAVYRVS  89

Query  348  LGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNELISFYES  524
            +GNF FF  +S+ ++G+K + D RD  LHHG  + K+  W L     F  PNE+++ Y  
Sbjct  90   MGNFLFFGCMSLALLGVKQRGDKRDAYLHHGHPLAKLGLWLLFTCLPFLFPNEVLNVYSW  149

Query  525  TSKFGSG  545
             ++ GSG
Sbjct  150  AARVGSG  156



>ref|XP_001753882.1| predicted protein [Physcomitrella patens]
 gb|EDQ81204.1| predicted protein [Physcomitrella patens]
Length=361

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 105/180 (58%), Gaps = 3/180 (2%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  362
            +AR  Y  LF LS I++WI+R+ +        ++     + D     +D VLR+S G F 
Sbjct  2    AARYMYGLLFLLSNILAWIVRDYSLKKYHLFHYLKGCRSSLDC--VGSDGVLRLSFGCFM  59

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF+ + +  +G  + KDPRD+ H G W +K + W  L++  F +P   I+ Y   ++FG+
Sbjct  60   FFSFMFLTTVGTSSTKDPRDSWHSGWWPIKTLGWAALMVMPFLIPPHYIAIYGEIARFGA  119

Query  543  GlfllvqvvllldfvHGWNDKWVGYD-EQFWYVALLVVSLVCYVATFAITGVLFHFFAPS  719
            G+FL++Q+V  ++F++ WN++W+    E  W V +++VS VC++A+    GV+  +F  S
Sbjct  120  GIFLVIQLVSFINFIYFWNEEWLNEKYEHIWRVPMILVSAVCFMASLFTIGVMIAWFVTS  179



>ref|XP_001416509.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 99/183 (54%), Gaps = 4/183 (2%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPL-MENIPWINHFHKTPDREWFETDAVLRVSLGNFT  362
            AR  +  +F  ++ + W LR+  +   +E + WI   +      WF+T AV R S    T
Sbjct  7    ARATHAAMFACAVALKWALRDYGSETALERLSWIGA-NGRASAAWFKTQAVYRASCATST  65

Query  363  FFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFF-VPNELISFYESTSKF  536
            FF  +S  +IG K++ D RD  LH G WM+KV+ +  L  F F    +E +  Y + ++ 
Sbjct  66   FFFAMSAALIGTKDRSDFRDKALHRGNWMLKVLAFVALHAFFFLWATDEGMEAYAAAARL  125

Query  537  GSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAP  716
            GSGLFL++Q++++LDF   WN+ W   +   W   LLV +L  Y  + A+   ++  +AP
Sbjct  126  GSGLFLVIQMIIVLDFAFAWNESWASGEHWGWVAGLLVSTLAMYATSVALFVEMYESYAP  185

Query  717  SGQ  725
            + +
Sbjct  186  NRE  188



>ref|XP_002965853.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
 ref|XP_002983103.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ15912.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ33273.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
Length=365

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 108/182 (59%), Gaps = 3/182 (2%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  362
            +AR  Y  +F L+ +V+W++R+ +   + ++ ++       D     ++ VLRVSLG F 
Sbjct  2    NARYIYAIIFLLTTVVAWMIRDYSHDALASLHYLKGCQGGHDC--LGSEGVLRVSLGCFV  59

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF  + +  +G     DPRD  H G W +K + W ++++  FF+P+  I  Y   ++FG+
Sbjct  60   FFFTMYLTTVGTSKPDDPRDAWHSGWWPIKSLFWIIVMVLPFFIPSAFIQMYGEMARFGA  119

Query  543  GlfllvqvvllldfvHGWNDKWVG-YDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPS  719
            G+FL++Q++ +++F++ WN++W+  ++ +   + L+V+++  Y+ +F    +++ +F+P 
Sbjct  120  GIFLVIQLLSVINFIYWWNEEWLSEHNVRRCQIPLVVIAVGSYILSFIGIILMYVWFSPR  179

Query  720  GQ  725
              
Sbjct  180  AS  181



>ref|XP_001770496.1| predicted protein [Physcomitrella patens]
 gb|EDQ64665.1| predicted protein [Physcomitrella patens]
Length=387

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 105/179 (59%), Gaps = 5/179 (3%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDR-EWFETDAVLRVSLGNFT  362
            AR  Y  LF L+ I++W  R+ +   + ++   +H  +  D      +++VLR+S G F 
Sbjct  24   ARYIYGILFLLTNILAWTTRDYSQRALTDL---HHLKRCEDDANCLGSESVLRLSFGCFM  80

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF ++ +  +G   + DPRD  H G W +K I W    I  FF+P+ +I  Y   ++FG+
Sbjct  81   FFFVMFMTTVGTSRKDDPRDRWHSGWWPVKSILWITFTIVPFFLPSVVIQLYGEIARFGA  140

Query  543  GlfllvqvvllldfvHGWNDKWVGYD-EQFWYVALLVVSLVCYVATFAITGVLFHFFAP  716
            G+FLLVQ++ +++FV+ WN+ W+  + E+  Y+ L+VV + CY+ TF    +++ +F P
Sbjct  141  GIFLLVQLLSIINFVYLWNESWMSPEHERQCYIPLVVVPMTCYILTFIGLVLMYVWFTP  199



>ref|XP_002982341.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
 gb|EFJ16586.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
Length=382

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 101/187 (54%), Gaps = 5/187 (3%)
 Frame = +3

Query  165  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD-REWFETDAVLR  341
            +G ++   R  Y  +F  + +++W++R+ +    E    + HF           ++ VLR
Sbjct  10   AGANQMPTRYIYAIIFLFTNLIAWVVRDYSR---EAFRTLRHFQGCYGVHTCLASEGVLR  66

Query  342  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  521
            +S G F FF I+ +  +G       RD  H G W +K + W LL+I  FFVP  +I  Y 
Sbjct  67   LSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPPAIIKVYG  126

Query  522  STSKFGSGlfllvqvvllldfvHGWNDKWVG-YDEQFWYVALLVVSLVCYVATFAITGVL  698
              ++FG+G+FL++Q+  +++F + WN+KW+   + +  ++ +L+V+ + YV       ++
Sbjct  127  EIARFGAGVFLVIQLFSIVNFAYWWNEKWLAPENSRRCFLPMLIVTTLSYVFCLIGLVIM  186

Query  699  FHFFAPS  719
            + +FAP 
Sbjct  187  YVWFAPK  193



>ref|XP_002966499.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
 gb|EFJ32526.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
Length=414

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 101/187 (54%), Gaps = 5/187 (3%)
 Frame = +3

Query  165  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD-REWFETDAVLR  341
            +G ++   R  Y  +F  + +++W++R+ +    E    + HF           ++ VLR
Sbjct  10   AGANQMPTRYIYAIIFLFTNLIAWVVRDYSR---EAFSTLRHFQGCYGVHTCLASEGVLR  66

Query  342  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  521
            +S G F FF I+ +  +G       RD  H G W +K + W LL+I  FFVP  +I  Y 
Sbjct  67   LSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPPAIIKVYG  126

Query  522  STSKFGSGlfllvqvvllldfvHGWNDKWVG-YDEQFWYVALLVVSLVCYVATFAITGVL  698
              ++FG+G+FL++Q+  +++F + WN+KW+   + +  ++ +L+V+ + YV       ++
Sbjct  127  EIARFGAGVFLVIQLFSIVNFAYWWNEKWLAPENSRRCFLPMLIVTTLSYVFCLIGLVIM  186

Query  699  FHFFAPS  719
            + +FAP 
Sbjct  187  YVWFAPK  193



>ref|XP_003075128.1| OJ1249_F12.26 gene product (ISS), partial [Ostreococcus tauri]
Length=423

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 92/182 (51%), Gaps = 2/182 (1%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            AR  +   F  +  ++W +R+V A  +E   W           WF T AV R S   F  
Sbjct  36   ARATHALFFSFATALAWFVRDVGAHALERYAWAIPNDHGYTNAWFRTQAVYRASCATFVL  95

Query  366  FTILSIMMIGIKNQKDPRDNL-HHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKFG  539
            F  LS  ++G +++ D RD + H G W +K++ + +L    F + ++  +  Y   ++ G
Sbjct  96   FATLSASLVGTRDKGDARDRMIHRGSWGVKMLAYVILNALTFCLASDGFMDVYAGAARLG  155

Query  540  SGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPS  719
            SGLFL++Q++++LDF   WN+ W   +   W   L+  +L  + A+  +   ++  +APS
Sbjct  156  SGLFLVIQMIIVLDFSFAWNESWASGEHWGWIAGLIASTLAMFGASIGLFVEMYRAYAPS  215

Query  720  GQ  725
             +
Sbjct  216  RE  217



>emb|CEG01070.1| TMS membrane protein/tumour differentially expressed protein 
[Ostreococcus tauri]
Length=422

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 92/182 (51%), Gaps = 2/182 (1%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            AR  +   F  +  ++W +R+V A  +E   W           WF T AV R S   F  
Sbjct  35   ARATHALFFSFATALAWFVRDVGAHALERYAWAIPNDHGYTNAWFRTQAVYRASCATFVL  94

Query  366  FTILSIMMIGIKNQKDPRDNL-HHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKFG  539
            F  LS  ++G +++ D RD + H G W +K++ + +L    F + ++  +  Y   ++ G
Sbjct  95   FATLSASLVGTRDKGDARDRMIHRGSWGVKMLAYVILNALTFCLASDGFMDVYAGAARLG  154

Query  540  SGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPS  719
            SGLFL++Q++++LDF   WN+ W   +   W   L+  +L  + A+  +   ++  +APS
Sbjct  155  SGLFLVIQMIIVLDFSFAWNESWASGEHWGWIAGLIASTLAMFGASIGLFVEMYRAYAPS  214

Query  720  GQ  725
             +
Sbjct  215  RE  216



>ref|XP_011091387.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=419

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 99/177 (56%), Gaps = 2/177 (1%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            AR AY  +F L+ I++W+ R+    ++  +P+ +      +RE + T  VLRVSLG F F
Sbjct  48   ARYAYGVIFLLTNIIAWLFRDYGERILPVLPY-SRACGAEERECYHTMGVLRVSLGCFIF  106

Query  366  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG  545
            F ++ +M    +   + R+  H G W +K I   +  +  FF+P + I  Y   ++ G+G
Sbjct  107  FFLMFVMTCNTRKLHEVRNAWHSGWWALKFILLLISFVIPFFIPTDYIQLYGELARVGAG  166

Query  546  lfllvqvvllldfvHGWNDKWVGYDEQFWYVAL-LVVSLVCYVATFAITGVLFHFFA  713
            +FL++Q++ +++F+  WN+ W+  ++     ++ L +S V Y+A+     V++  +A
Sbjct  167  VFLILQLISVIEFITWWNNYWMSDEKNKSSCSIGLFMSTVFYIASVCGIAVMYALYA  223



>gb|EJU04752.1| TMS membrane protein [Dacryopinax sp. DJM-731 SS1]
Length=493

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 103/191 (54%), Gaps = 10/191 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILR-EVAAPLMENIPWINHFHKTPDRE--WFETDAVLRV  344
            S  + R+ +  +F L+ I++WI++ +    L+E   W   + K   +E   +   AV R+
Sbjct  45   SSIATRVGFALIFCLNSILAWIMKTDFMIRLIEK--WSYDYIKMECKEGKCYGVLAVHRI  102

Query  345  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  524
                  F  IL  ++IG+ N +D R  + +G W  KV+ W LL++  FF+PNE   F+ +
Sbjct  103  CFALSLFHFILGALLIGVNNTRDKRSAIQNGFWGPKVLLWILLIVASFFIPNEFFMFWGN  162

Query  525  -TSKFGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAIT  689
              +  G+ +F+++ +VLL+DF H W+    +KW   D   W   L+  +   Y A  A+T
Sbjct  163  WVAMIGASIFIIIGLVLLVDFAHSWSEMCLEKWEASDSNLWQFVLVGSTAGLYSAAIALT  222

Query  690  GVLFHFFAPSG  722
            G+++ +FA SG
Sbjct  223  GIMYAWFASSG  233



>gb|KIJ14234.1| hypothetical protein PAXINDRAFT_163421 [Paxillus involutus ATCC 
200175]
Length=491

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 102/191 (53%), Gaps = 10/191 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILREVAAPLMENIP-WINHFHKTPDRE--WFETDAVLRV  344
            S  + R+ +  +F L+ +++W+++   A  M  I  W   + K    E   +   AV RV
Sbjct  44   SSIATRVGFAIIFILNSLLAWLMKTSFA--MRKIEQWSYDYIKMDCEEGKCYGVLAVHRV  101

Query  345  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY-E  521
                  F  ILS+ +IG+K   D R  + +G W  KV+ WFLLV+  FF+PN    F+ +
Sbjct  102  CFALSLFHAILSVSLIGVKESMDKRAAIQNGWWGPKVLLWFLLVVITFFIPNGFFIFWGD  161

Query  522  STSKFGSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAIT  689
              +  G+ +F+L+ +VLL+DF H W++     W  Y+   W   L+  +   Y+AT  +T
Sbjct  162  YVALIGATIFILLGLVLLVDFAHSWSETCLQNWEKYESSLWQWILIGSTSAMYIATITLT  221

Query  690  GVLFHFFAPSG  722
            G+L+ +FA SG
Sbjct  222  GILYGYFAGSG  232



>gb|EEH05886.1| DNA mismatch repair protein pms1 [Histoplasma capsulatum G186AR]
Length=1515

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 62/189 (33%), Positives = 101/189 (53%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P      + S  
Sbjct  103  ALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVWGSYI  162

Query  531  KF-GSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
             F G+ LFLL+ ++LL+D  H W +    K    D Q W V L+  +L  Y+A+ A+T +
Sbjct  163  SFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIAMTVI  222

Query  696  LFHFFAPSG  722
            ++ FFA SG
Sbjct  223  MYIFFANSG  231



>gb|EGC49614.1| DNA mismatch repair protein [Histoplasma capsulatum H88]
Length=1515

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 62/189 (33%), Positives = 101/189 (53%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P      + S  
Sbjct  103  ALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVWGSYI  162

Query  531  KF-GSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
             F G+ LFLL+ ++LL+D  H W +    K    D Q W V L+  +L  Y+A+ A+T +
Sbjct  163  SFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIAMTVI  222

Query  696  LFHFFAPSG  722
            ++ FFA SG
Sbjct  223  MYIFFAHSG  231



>gb|EER41787.1| DNA mismatch repair protein [Histoplasma capsulatum H143]
Length=1515

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 62/189 (33%), Positives = 101/189 (53%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P      + S  
Sbjct  103  ALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVWGSYI  162

Query  531  KF-GSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
             F G+ LFLL+ ++LL+D  H W +    K    D Q W V L+  +L  Y+A+ A+T +
Sbjct  163  SFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIAMTVI  222

Query  696  LFHFFAPSG  722
            ++ FFA SG
Sbjct  223  MYIFFAHSG  231



>ref|XP_002994401.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
 gb|EFJ04535.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
Length=386

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 98/178 (55%), Gaps = 4/178 (2%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  362
            +AR  Y  +F L+ +++W++R+ +   +  + ++             ++ VLR+S G F 
Sbjct  27   AARYIYGIIFMLTTLIAWVVRDYSHRALSELHYLEG--CLGGHNCLGSEGVLRISFGCFV  84

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF ++ +  +G       RD  H+G W  K + W +L++  F VP   I  Y   +++G+
Sbjct  85   FFLVMFVTTVGTTRLYGARDAWHNGWWPAKGVMWVILMVLPFLVPPSFIHIYGEVARYGA  144

Query  543  GlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAP  716
            G+FLL+Q++ +++F++ WN++W+   E+     +LVV+ V + A+   T  +  +FAP
Sbjct  145  GIFLLIQLLSVINFIYWWNEEWL--SEEKCKAPMLVVAFVSFGASIVATTYMSLWFAP  200



>ref|XP_008039450.1| hypothetical protein TRAVEDRAFT_168740 [Trametes versicolor FP-101664 
SS1]
 gb|EIW57145.1| hypothetical protein TRAVEDRAFT_168740 [Trametes versicolor FP-101664 
SS1]
Length=491

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 105/192 (55%), Gaps = 12/192 (6%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILREVAAPLM-ENIPWINHFHKTPDRE---WFETDAVLR  341
            S  + R+ +  +F L+ +++W+++   +PL+ + I  ++H +   D E    +   AV R
Sbjct  44   SSIATRVGFAMIFCLNSMLAWLMK---SPLIIDQIEKMSHGYLKMDCEGDKCYGVLAVHR  100

Query  342  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  521
            +      F   LS  +IG+K+ KD R  + +G W  K + W +LV+  FF+PN    F+ 
Sbjct  101  ICFALALFHLFLSASLIGVKDTKDKRAAIQNGWWGPKALFWLVLVVVSFFIPNGFFMFWG  160

Query  522  S-TSKFGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  S  G+ +F+L+ +VLL+DF H W+    + W   +   W   L+  +   YVAT A+
Sbjct  161  NYVSMIGATIFILLGLVLLVDFAHSWSETCLENWEQSNSNLWQWILIGSTAGMYVATIAL  220

Query  687  TGVLFHFFAPSG  722
            TGVL+ FFA SG
Sbjct  221  TGVLYAFFASSG  232



>gb|KDQ57032.1| hypothetical protein JAAARDRAFT_35631 [Jaapia argillacea MUCL 
33604]
Length=493

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 103/189 (54%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILR-EVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RI +  +F L+ +++W+++ ++A  L+E   +        + + +   AV R+  
Sbjct  44   SSIATRIGFAIIFCLNSMLAWLMKTKMAIHLIEKWSYDYIKMDCENDKCYGVLAVHRICF  103

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  IL+  +IG+K+ +D R  + +G W  KV+ W +LV+  FF+PN    F+ +  
Sbjct  104  ALALFHAILATSLIGVKDTRDKRAAIQNGWWGPKVLFWIILVVVSFFIPNGFFMFWGNYV  163

Query  528  SKFGSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            S  G+ +F+L+ +VLL+DF H W++     W   D   W   L+  +   Y AT A+TGV
Sbjct  164  SLIGATIFILLGLVLLVDFAHSWSETCLQNWESSDSNLWQWILIGSTAGMYGATIALTGV  223

Query  696  LFHFFAPSG  722
            L+ FF+ SG
Sbjct  224  LYGFFSASG  232



>ref|XP_009161557.1| hypothetical protein HMPREF1120_09034 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY61096.1| hypothetical protein HMPREF1120_09034 [Exophiala dermatitidis 
NIH/UT8656]
Length=482

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 101/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    + +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIRKLEHLTLDYMTFKCGSSKCYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  IL++++IG+K+ KD R  L +G W  K++ W   V+  FF+P     F+ +  
Sbjct  105  ALALFHLILAVLLIGVKSTKDTRAGLQNGFWGPKILAWLAFVVLSFFIPEGFFLFWGNYV  164

Query  528  SKFGSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  G+ LF+L+ ++LL+D  H W        D+  G   + W V L+  SL  YVA FA+
Sbjct  165  AYLGAMLFVLLGLILLVDLAHSWAELCQDKIDEGEGPHYRMWQVLLMGSSLGMYVAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYLFFASSG  236



>gb|KGQ04935.1| Membrane protein TMS1 [Beauveria bassiana D1-5]
Length=470

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 105/202 (52%), Gaps = 16/202 (8%)
 Frame = +3

Query  153  RTVVSGISRRS--ARIAYCGLFGLSLIVSWILR-----EVAAPLMENIPWINHFHKTPDR  311
            +T  + +S RS   RIAY  +  ++ IV+WI+      E    LM +   IN     P+ 
Sbjct  27   KTNTANLSTRSVATRIAYALILLVNSIVAWIMLTPWAIEKLQHLMLDYVKIN----CPNG  82

Query  312  EWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFF  491
            E +   AV R++     F  IL+ ++ G+ + KDPR  + +G W  KVI W   V+  F 
Sbjct  83   ECYGWLAVHRINFALGVFHLILAGLLFGVASSKDPRAAIQNGYWGPKVIAWVAFVVMSFL  142

Query  492  VPNELISFYES-TSKFGSGlfllvqvvllldfvHGWNDKWVGY----DEQFWYVALLVVS  656
            +P+E   F+ +  +  G+ LFLL+ ++LL+D  HGW +  +      D + W   L+  +
Sbjct  143  IPDEFFMFWGNYIALIGAMLFLLLGLILLVDLAHGWAEYCLAQIEDTDSRLWRTVLIGST  202

Query  657  LVCYVATFAITGVLFHFFAPSG  722
            L  Y A+ A+T V + FFA SG
Sbjct  203  LGMYAASLAMTIVQYIFFAGSG  224



>gb|KIV97946.1| hypothetical protein PV10_01642 [Exophiala mesophila]
Length=484

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 102/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  L   + I++WI L   A   +E++       K    + +   AV R++ 
Sbjct  45   SSIATRIAYAVLLVFNSILAWISLTPWAVRKLEHLTLDYMTFKCGSSDCYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  ILS+++IG+++ KD R  L +G W  K++ W +LV+  FF+P     F+ +  
Sbjct  105  ALGLFHLILSVLLIGVRSTKDTRAGLQNGFWGPKILFWIVLVVLSFFIPEGFFLFWGNYV  164

Query  531  KF-GSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
             + G+ LF+L+ ++LL+D  H W        D+  G + + W   L+  SL  Y+A FA+
Sbjct  165  AYVGAVLFVLLGLILLVDLAHTWAELCQDKIDQGDGPNYRLWQFLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFAASG  236



>ref|XP_005646031.1| Serinc-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21487.1| Serinc-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=375

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 95/186 (51%), Gaps = 4/186 (2%)
 Frame = +3

Query  180  RSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFET----DAVLRVS  347
             SA+  Y     L+ +++W+LR+ A+P + +I  +       D     T      VLR+S
Sbjct  9    NSAKYFYFAGLALTAVLTWVLRDYASPALGHIGPLRDCLVITDSVLKATCVGKGVVLRIS  68

Query  348  LGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYEST  527
             GNF FF    ++++ +  + D R   H G   ++ I W  ++I  F +PN + S Y   
Sbjct  69   FGNFIFFAAHLLLLLCVSKEADLRRFFHTGLLPLQGIAWVGIIIACFAMPNHVFSVYGQI  128

Query  528  SKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHF  707
            ++  SG FL++Q++LLL F++  N+  +  D     VAL+  ++  Y     I G ++HF
Sbjct  129  ARVLSGFFLIIQIILLLGFIYAINEYLIDKDHASHKVALVGATVSMYACGLVIIGFMYHF  188

Query  708  FAPSGQ  725
            +AP+  
Sbjct  189  YAPTAS  194



>ref|XP_008731904.1| hypothetical protein G647_09379 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI19545.1| hypothetical protein G647_09379 [Cladophialophora carrionii CBS 
160.54]
Length=481

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 102/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    + +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSIIAWIMLTPWAIKKLEHLTLDYMTFKCGSSKCYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  IL+I++IG+++ KD R  L +G W  K++ W   V+  FF+P     F+ +  
Sbjct  105  ALAIFHLILAILLIGVRSTKDTRAGLQNGFWGPKLLAWIAFVVLSFFIPEGFFLFWGNYV  164

Query  528  SKFGSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYLGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRIWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>gb|KIK77929.1| hypothetical protein PAXRUDRAFT_834805 [Paxillus rubicundulus 
Ve08.2h10]
Length=490

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 101/191 (53%), Gaps = 10/191 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL---RV  344
            S  + R+ +  +F L+ +++W+++   A  +  I   ++ +   D E  +   VL   RV
Sbjct  44   SSIATRVGFAIIFILNSLLAWLMKTSFA--IRKIEQWSYDYIKMDCEGGKCYGVLAVHRV  101

Query  345  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY-E  521
                  F  ILS+ +IG+K   D R  + +G W  KV+ WFLLV   FF+PN    F+ +
Sbjct  102  CFALSLFHAILSVSLIGVKESGDKRAAIQNGWWGPKVLLWFLLVAITFFIPNGFFIFWGD  161

Query  522  STSKFGSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAIT  689
              +  G+ +F+L+ +VLL+DF H W++     W      FW   L+  +   Y+AT  +T
Sbjct  162  YVALIGATIFILLGLVLLVDFAHSWSETCLQNWEKDGSTFWQWILIGSTCAMYIATITLT  221

Query  690  GVLFHFFAPSG  722
            G+L+ +FA SG
Sbjct  222  GILYGYFAGSG  232



>ref|XP_002968524.1| hypothetical protein SELMODRAFT_89240 [Selaginella moellendorffii]
 ref|XP_002975960.1| hypothetical protein SELMODRAFT_104684 [Selaginella moellendorffii]
 gb|EFJ22865.1| hypothetical protein SELMODRAFT_104684 [Selaginella moellendorffii]
 gb|EFJ30778.1| hypothetical protein SELMODRAFT_89240 [Selaginella moellendorffii]
Length=394

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 96/178 (54%), Gaps = 4/178 (2%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  362
            +AR  Y  +F L+ +++W++R+ +   +  + ++             ++ VLR+S G F 
Sbjct  27   AARYIYGIIFMLTTLIAWVVRDYSHRALSELHYLEG--CLGGHNCLGSEGVLRISFGCFV  84

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF  + +  +G       RD  H+  W  K + W +L++  F VP   I  Y   +++G+
Sbjct  85   FFLAMFVTTVGTTRLYGARDVWHNRWWPAKGVMWVILMVLPFLVPPSFIHIYGEVARYGA  144

Query  543  GlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAP  716
            G+FLL+Q++ +++F++ WN++W  + E+     +LVV+ V + A+   T  +  +FAP
Sbjct  145  GIFLLIQLLSVINFIYWWNEQW--FSEERCKAPMLVVAFVSFGASIVATTYMSLWFAP  200



>gb|KFH68151.1| hypothetical protein MVEG_06880 [Mortierella verticillata NRRL 
6337]
Length=474

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 97/186 (52%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILREV-AAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + R+ Y  +  ++ ++ WILR   A+  +E+I       +  D   +    V RV     
Sbjct  39   ATRVGYALIMLVNSLLGWILRSDWASKQLESISHGYLKLQCQDNSCYGAFGVQRVGFALA  98

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-TSKF  536
             F  IL  +++G+++ +  R  + +G W  K++ W  LV+  FF+P +   FY +  +  
Sbjct  99   VFHFILGALLVGVQDSRSKRAAIQNGWWGPKILAWMALVMGSFFIPAQFFIFYGNYVALV  158

Query  537  GSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            G+G+F+L  ++LL+DF H W+    +KW   D   W   L+  +++ Y+    +TGV++ 
Sbjct  159  GAGIFILFGLILLVDFAHTWSESCMEKWENSDSNKWQYILVGSTMIMYLGAIVLTGVMYG  218

Query  705  FFAPSG  722
            +FA SG
Sbjct  219  YFASSG  224



>ref|XP_007744780.1| hypothetical protein A1O5_05994 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ71001.1| hypothetical protein A1O5_05994 [Cladophialophora psammophila 
CBS 110553]
Length=481

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 102/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIKKLEHLTLDYMTFKCGSSECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  ILSI++IG+++ KD R  L +G W  K++ W   ++  FF+P     F+ +  
Sbjct  105  ALGMFHLILSILLIGVRSTKDTRAALQNGFWGPKLLVWIAFIVISFFIPEGFFLFWGNYV  164

Query  531  KF-GSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
             + G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYTGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRLWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>gb|KIW58600.1| hypothetical protein PV05_03105 [Exophiala xenobiotica]
Length=481

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 101/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + R+AY  +  ++ I++WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRLAYAVILLVNSILAWIMLTPWAIRKLEHLTLDYMNFKCGSSECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  ILSI++IG+++ KD R  L +G W  K++ W   V+  F +P     F+ +  
Sbjct  105  ALALFHLILSILLIGVRSTKDTRSGLQNGFWGPKILTWLAFVVISFLIPEGFFLFWGNYV  164

Query  528  SKFGSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  G+ LF+L+ +VLL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYIGAMLFVLLGLVLLVDLAHTWAELCQDKIDEGDGPNYRLWQVLLMGSSLSMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>ref|NP_001053258.1| Os04g0506300 [Oryza sativa Japonica Group]
 dbj|BAF15172.1| Os04g0506300 [Oryza sativa Japonica Group]
 dbj|BAG88784.1| unnamed protein product [Oryza sativa Japonica Group]
Length=404

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 96/183 (52%), Gaps = 14/183 (8%)
 Frame = +3

Query  198  YCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTP-----DREWFETDAVLRVSLGNFT  362
            Y  +F  + +++W +R+  A L+  +      H  P     D + F++  VLRVSLG F 
Sbjct  31   YGLIFFATNLLAWFVRDYGAKLLRGL------HHVPVCGAGDSKCFQSGGVLRVSLGCFI  84

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF ++     G +   + R++ H G W++K + + + +I  F VPN  I  Y   ++ G+
Sbjct  85   FFWVMFATTFGTRKLHEVRNSWHSGCWILKFLVYAVSIIIPFIVPNIFIQLYGEIARMGA  144

Query  543  GlfllvqvvllldfvHGWNDKWVGYDEQFWYVAL--LVVSLVCYVATFAITGVLFHFFAP  716
            G+FL++Q++ +  F+   N +W+  D Q     L  L +S + ++A+FA   VL+  + P
Sbjct  145  GIFLILQLISMSHFISWCNKRWMP-DSQSNQCGLFGLFLSTISFIASFAGIAVLYVLYVP  203

Query  717  SGQ  725
            +  
Sbjct  204  NSS  206



>ref|XP_006668148.1| membrane protein TMS1, putative [Cordyceps militaris CM01]
 gb|EGX94662.1| membrane protein TMS1, putative [Cordyceps militaris CM01]
Length=473

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 101/194 (52%), Gaps = 14/194 (7%)
 Frame = +3

Query  171  ISRRSARIAYCGLFGLSLIVSWILR-----EVAAPLMENIPWINHFHKTPDREWFETDAV  335
            +S  + RIAY  +  ++ IV+WI+      E    LM +   IN     P+ E +   AV
Sbjct  37   LSSVATRIAYALILLVNSIVAWIMLTPWAIEKLQHLMLDYVKIN----CPNGECYGWLAV  92

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
             R++     F  +L+ ++ G+ + K+PR  L +G W  KVI W   V+  F +P+E   F
Sbjct  93   HRINFALGVFHLVLAGLLFGVASSKEPRAALQNGYWGPKVIAWVAFVVMSFLIPDEFFMF  152

Query  516  YES-TSKFGSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATF  680
            + +  +  G+ LFLL+ ++LL+D  HGW +    K    D + W   L+  +L  Y A+ 
Sbjct  153  WGNYVALIGAMLFLLLGLILLVDLAHGWAEYCLAKIEDTDSRLWRTVLIGSTLGMYAASL  212

Query  681  AITGVLFHFFAPSG  722
            A+T V + FFA SG
Sbjct  213  AMTIVQYIFFAGSG  226



>gb|KIW94765.1| hypothetical protein Z519_04742 [Cladophialophora bantiana CBS 
173.52]
Length=481

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 102/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIKKLEHLTLDYMTFKCGSSECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  ILSI++IG+++ KD R  L +G W  K++ W   ++  FF+P     F+ +  
Sbjct  105  ALGMFHLILSILLIGVRSTKDTRAALQNGFWGPKLLVWIAFIVVSFFIPEGFFLFWGNYV  164

Query  531  KF-GSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
             + G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYAGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRLWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>ref|XP_002426175.1| serine incorporator, putative [Pediculus humanus corporis]
 gb|EEB13437.1| serine incorporator, putative [Pediculus humanus corporis]
Length=439

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (61%), Gaps = 9/137 (7%)
 Frame = +3

Query  330  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-EL  506
            AV R+      FFT++ I+MIG+K+ KDPR  + +G W MK +    + +  FF+P  E 
Sbjct  95   AVYRLCFALTCFFTLMCIIMIGVKSSKDPRAAIQNGFWGMKYLVLIGICVGAFFIPEGEF  154

Query  507  ISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVG-YDE---QFWYVALLVVSLVCYVA  674
             S +      G  LF+L+Q++L++DF H W ++WVG Y+E   +FWY+ALL V+ + +  
Sbjct  155  ASVWMVFGMIGGFLFILIQLILIVDFAHSWAERWVGKYEETESKFWYIALLTVTFLLF--  212

Query  675  TFAITGV--LFHFFAPS  719
            T +I GV  LF +F  S
Sbjct  213  TISIIGVVLLFIYFTKS  229



>ref|XP_007709253.1| hypothetical protein COCCADRAFT_88158 [Bipolaris zeicola 26-R-13]
 gb|EUC36480.1| hypothetical protein COCCADRAFT_88158 [Bipolaris zeicola 26-R-13]
Length=488

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKF  536
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FFVPN   I +    +  
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFVPNSFFIVWGNYFAMV  166

Query  537  GSGlfllvqvvllldfvHGW----NDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            G+ LFLL+ ++LL+D  H W     +K    D + W   L+  +L  Y+A+FA+T V++ 
Sbjct  167  GACLFLLIGLILLVDLAHNWAEYCQEKIETTDSRVWTGMLVGSALFMYLASFAMTIVMYI  226

Query  705  FFAPSG  722
            +FA SG
Sbjct  227  YFAKSG  232



>gb|KIV83375.1| hypothetical protein PV11_05406 [Exophiala sideris]
Length=480

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 100/192 (52%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIRKLEHLTLDYMNFKCGSNECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  ILS+++ G+++ KD R  L +G W  K++ W   ++  F +P     F+ +  
Sbjct  105  ALGLFHFILSVLLAGVRSTKDTRAGLQNGFWGPKILVWLAFIVISFLIPEGFFMFWGNYV  164

Query  528  SKFGSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  G+ LF+L+ +VLL+D  HGW        D   G + + W V L+  SL  Y+A FA+
Sbjct  165  AYIGAMLFVLLGLVLLVDLAHGWAELCQDKIDDGDGQNYRLWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>gb|EMD93772.1| hypothetical protein COCHEDRAFT_1132482 [Bipolaris maydis C5]
 gb|ENH99934.1| hypothetical protein COCC4DRAFT_207119 [Bipolaris maydis ATCC 
48331]
Length=488

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKF  536
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN   I +    +  
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNSFFIVWGNYFAMV  166

Query  537  GSGlfllvqvvllldfvHGW----NDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            G+ LFLL+ ++LL+D  H W     +K    D + W   L+  +L  Y+A+FA+T V++ 
Sbjct  167  GACLFLLIGLILLVDLAHNWAEYCQEKIETTDSRIWTGMLVGSALFMYLASFAMTIVMYI  226

Query  705  FFAPSG  722
            +FA SG
Sbjct  227  YFAKSG  232



>gb|KIM58348.1| hypothetical protein SCLCIDRAFT_1218695 [Scleroderma citrinum 
Foug A]
Length=489

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 98/189 (52%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILRE-VAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + R+ +  +F L+ +++W+++   A   +E+  +        + + +   AV R+  
Sbjct  44   SSIATRVGFAIIFILNSLLAWLMKTPFAIRKIEDWSYDYIKMDCAEGKCYGVLAVHRICF  103

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  ILS  +IG+ + +D R  + +G W  K + W LLV+  FF+PN    F+ +  
Sbjct  104  ALSLFHVILSFSLIGVNDSRDKRAAIQNGWWGPKALLWLLLVVISFFIPNGFFMFWGNYV  163

Query  528  SKFGSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
            S  G+ +F+L+ +VLL+DF H W +     W   D   W   L+  + + YVAT ++TGV
Sbjct  164  SLIGATIFILLGLVLLVDFAHTWCETCLQNWEATDSTLWQCILIGSTAITYVATISLTGV  223

Query  696  LFHFFAPSG  722
            L+ +F   G
Sbjct  224  LYGYFTGPG  232



>ref|XP_007687418.1| hypothetical protein COCMIDRAFT_93798 [Bipolaris oryzae ATCC 
44560]
 gb|EUC46052.1| hypothetical protein COCMIDRAFT_93798 [Bipolaris oryzae ATCC 
44560]
Length=488

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLINSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKF  536
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN   I +    +  
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNSFFIVWGNYFAMV  166

Query  537  GSGlfllvqvvllldfvHGW----NDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            G+ LFLL+ ++LL+D  H W     +K    D + W   L+  +L  Y+A+FA+T V++ 
Sbjct  167  GACLFLLIGLILLVDLAHNWAEYCQEKIETTDSRVWTGMLVGSALFMYLASFAMTIVMYI  226

Query  705  FFAPSG  722
            +FA SG
Sbjct  227  YFAKSG  232



>ref|XP_007701878.1| hypothetical protein COCSADRAFT_121304 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD62533.1| hypothetical protein COCSADRAFT_121304 [Bipolaris sorokiniana 
ND90Pr]
Length=488

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLINSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKF  536
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN   I +    +  
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWVGMIVLTFFIPNSFFIVWGNYFAMV  166

Query  537  GSGlfllvqvvllldfvHGW----NDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            G+ LFLL+ ++LL+D  H W     +K    D + W   L+  +L  Y+A+FA+T V++ 
Sbjct  167  GACLFLLIGLILLVDLAHNWAEYCQEKIETTDSRVWTGMLVGSALFMYLASFAMTIVMYI  226

Query  705  FFAPSG  722
            +FA SG
Sbjct  227  YFAKSG  232



>gb|EMS18351.1| TMS membrane protein family [Rhodosporidium toruloides NP11]
 emb|CDR49624.1| RHTO0S29e00144g1_1 [Rhodosporidium toruloides]
Length=516

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 100/190 (53%), Gaps = 7/190 (4%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + R+ +  +F L+ + +W+ L + A  L+    W     +  +   +   AV R+  
Sbjct  48   SSVATRVGFSLIFLLNSLFAWMMLTDFAIKLVAKWSWEWIKMECKEGRCYGVLAVHRICF  107

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYEST-  527
                F ++LS+++IG+K+ +  R  + +G W  KV+ W + V   F +PN   + + ST 
Sbjct  108  ALAMFHSVLSLLLIGVKDTRTKRAAIQNGWWGPKVLAWLVFVYLSFLIPNGFFTSFWSTY  167

Query  528  -SKFGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             S  GSG+F+L+ +VLL+DF H W+    ++W   D  FW   L+  +L  Y  TFA+T 
Sbjct  168  ISLPGSGIFILIGLVLLVDFAHSWSETCLERWEATDSPFWKWVLISSTLGLYALTFALTV  227

Query  693  VLFHFFAPSG  722
            V + FFA  G
Sbjct  228  VQYVFFAGKG  237



>gb|EUN26863.1| hypothetical protein COCVIDRAFT_99736 [Bipolaris victoriae FI3]
Length=488

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKF  536
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN   I +    +  
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNSFFIVWGNYFAMV  166

Query  537  GSGlfllvqvvllldfvHGW----NDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            G+ LFLL+ ++LL+D  H W     +K    D + W   L+  +L  Y+A+FA+T V++ 
Sbjct  167  GACLFLLIGLILLVDLAHNWAEYCQEKIETTDSRVWTGMLVGSALFMYLASFAMTIVMYI  226

Query  705  FFAPSG  722
            +FA SG
Sbjct  227  YFAKSG  232



>ref|XP_002515588.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47037.1| conserved hypothetical protein [Ricinus communis]
Length=398

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            AR AY  +F  + +++W  R+     +  +  +       D      + VLRVSLG F F
Sbjct  34   ARFAYALIFLSANLLAWAARDYGHGALSEMERLRVCAGKSDC--LGAEGVLRVSLGCFVF  91

Query  366  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG  545
            F I+ +  +G     DPRD+ H G W  K++ W  L I  F VP+  I  Y   + FG+G
Sbjct  92   FMIMFLSTVGTSKFHDPRDSWHSGWWGPKIVLWIALTIMTFLVPSAFIRLYGEIAHFGAG  151



>gb|KIX04087.1| hypothetical protein Z518_07640 [Rhinocladiella mackenziei CBS 
650.93]
Length=481

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 100/189 (53%), Gaps = 9/189 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ IV+WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSIVAWIMLTPWAIRKLEHLTLDYMTFKCGSSECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  ILSI+++G+K+ KD R  L +G W  K++ W   ++  FF+P     F+ +  
Sbjct  105  ALALFHFILSILLVGVKSTKDGRSGLQNGFWGPKILVWLAFIVLSFFIPEGFFLFWGNYI  164

Query  531  KF-GSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
             + G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYPGAMLFVLLGLILLVDLAHSWAELCQDKIDEGDGPNYRLWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFA  713
            T V+ ++FA
Sbjct  225  TIVMCYYFA  233



>ref|XP_006340916.1| PREDICTED: probable serine incorporator-like [Solanum tuberosum]
Length=415

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 103/188 (55%), Gaps = 10/188 (5%)
 Frame = +3

Query  171  ISRRS--ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDR---EWFETDAV  335
            IS+RS  AR +Y  +F ++ +++W +R+      E +  + H+ K       E   T  V
Sbjct  32   ISKRSSRARFSYGIIFLITNLIAWFVRDYG----ERVLPLLHYSKACGNGGSECSHTMGV  87

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
            LRVSLG F+FF ++ +         D R+  H G W++K +   +  +  FFVP++ I  
Sbjct  88   LRVSLGCFSFFLVMFLTTCFTSKLYDVRNVWHSGWWILKFLMLIIFTVIPFFVPSDYIQL  147

Query  516  YESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVAL-LVVSLVCYVATFAITG  692
            Y   ++ G+G+FL++Q++ +++F+  WN+ W+  + +    +L L +S VCY+A+     
Sbjct  148  YGEFARVGAGVFLILQLISVIEFITWWNNYWMPDERKKQSCSLGLFMSTVCYIASICGIF  207

Query  693  VLFHFFAP  716
            +++  +A 
Sbjct  208  MMYMLYAS  215



>gb|KIW63213.1| hypothetical protein PV04_10077 [Capronia semiimmersa]
Length=481

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 101/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    + +   AV R++ 
Sbjct  45   SSIATRIAYAVILVVNSIIAWIMLTPWAIKKLEHLTLDYMTFKCGSSKCYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  IL++++IG+++ KD R  L +G W  K++ W   V+  FF+P     F+ +  
Sbjct  105  ALAIFHLILAVLLIGVRSTKDTRAGLQNGFWGPKLLAWIAFVVVSFFIPEGFFLFWGNYV  164

Query  528  SKFGSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  G+ LF+L+ ++LL+D  H W        D+  G + + W   L+  SL  Y+A FA+
Sbjct  165  AYLGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRLWQALLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>gb|KDN52824.1| TMS membrane protein/tumor differentially expressed protein [Tilletiaria 
anomala UBC 951]
Length=505

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 98/191 (51%), Gaps = 9/191 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI--LREVAAPLME-NIPWINHFHKTPDREWFETDAVLRV  344
            S  + R+ +  +F L  +++W+   R V   + E +  W+       DR  +   AV R+
Sbjct  45   SSIATRVGFALIFCLDALLAWLSLTRFVMDKIEEWSYSWVKMDCADRDR-CYGVLAVHRI  103

Query  345  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  524
            +     F  IL + +IG+K+ +D R  + +G W  KV+ W LLV+  FF+PN    F+ +
Sbjct  104  TFALALFHCILGLSLIGVKDTRDKRAAIQNGWWGPKVLLWLLLVMATFFIPNGFFVFWAN  163

Query  525  -TSKFGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAIT  689
              +   + +F++V +VLL+DF H W+    D W   D  FW   L+  +L  Y     +T
Sbjct  164  YMALILASVFIVVGLVLLVDFAHTWSETCLDNWERTDSNFWKYTLIGSTLGMYAIAITVT  223

Query  690  GVLFHFFAPSG  722
            G+L+ FFA  G
Sbjct  224  GLLYGFFAGRG  234



>ref|XP_007761600.1| hypothetical protein A1O7_09422 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ54085.1| hypothetical protein A1O7_09422 [Cladophialophora yegresii CBS 
114405]
Length=481

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 101/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K      +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSIIAWIMLTPWAIKKLEHLTLDYMTFKCGSSNCYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  IL+I++IG+++ KD R  L +G W  K++ W   V+  FF+P     F+ +  
Sbjct  105  ALALFHLILAILLIGVRSTKDTRAGLQNGFWGPKLLAWVAFVVVSFFIPEGFFLFWGNYV  164

Query  528  SKFGSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYLGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRVWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>ref|XP_010249828.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=397

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 2/120 (2%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            AR  Y  +F L+ +++W +R+     +  +  +        R    T+ VLRVSLG F F
Sbjct  33   ARYVYGLIFLLTNLLAWAVRDYGQSALTEMERLKGCKG--GRYCLGTEGVLRVSLGCFIF  90

Query  366  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG  545
            +  + +   G +   +  D+ H G W  K++ W  L++  FFVPN LI FY   + FG+G
Sbjct  91   YFTMFLSTAGTRKLNERSDSWHSGWWSAKILVWIALLVLPFFVPNALIQFYGEIAHFGAG  150



>gb|KHN33071.1| hypothetical protein glysoja_010062 [Glycine soja]
Length=119

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +3

Query  195  AYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTI  374
            + CGLFG+SL+VSWILREV APL+E  PWI     T   EW++  AVL  SLG    F  
Sbjct  18   STCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTYTTEWYQAQAVL--SLGVAACFVP  75

Query  375  LSIMMIGIKNQ  407
                +  + NQ
Sbjct  76   HQCEIHALPNQ  86



>ref|NP_001279601.1| serine incorporator 3 precursor [Callorhinchus milii]
 ref|XP_007909752.1| PREDICTED: serine incorporator 3 [Callorhinchus milii]
 gb|AFK10790.1| serine incorporator 1-like protein [Callorhinchus milii]
Length=475

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 78/133 (59%), Gaps = 6/133 (5%)
 Frame = +3

Query  327  DAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-E  503
             +V R+  G   FF I S++ + +K+ +DPR  +H+G W  K+     L++  F++P   
Sbjct  96   KSVYRICFGMAVFFFIFSLLFVNVKSSRDPRAAIHNGFWFFKIAAIIGLIVGAFYIPEGP  155

Query  504  LISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVGYDE----QFWYVALLVVSLVCYV  671
                  +    G+ LF+L+Q+VLL+DF H WN+ WVG  E    +FWY AL+ ++ +CY 
Sbjct  156  FTRALFAIGAAGAFLFILIQLVLLVDFAHSWNESWVGKMEDGNSRFWYAALIFITSLCYT  215

Query  672  ATFAITGVLFHFF  710
             +F IT VLF+ F
Sbjct  216  LSF-ITVVLFYVF  227



>ref|XP_004346817.1| hypothetical protein CAOG_05132 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94498.1| hypothetical protein CAOG_005132 [Capsaspora owczarzaki ATCC 
30864]
Length=438

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 103/196 (53%), Gaps = 9/196 (5%)
 Frame = +3

Query  156  TVVSGISRRS--ARIAYCGLFGLSLIVSWILREV-AAPLMENIP--WINHFHKTPDREWF  320
            T   G+  RS   R+ Y  +F  + I +WIL    A   M++    +++      D   +
Sbjct  21   TSCCGLVSRSVGTRVTYAIMFLTASIAAWILSSSWAEDKMQSTAPSYLDFGCNDNDPSCY  80

Query  321  ETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN  500
             T AV RV LG   F T ++++M G+ +  DPR ++ +  W +K+  W   +I  FF+P 
Sbjct  81   GTVAVYRVCLGLVLFHTFMALIMYGVSSSSDPRASIQNSWWPLKLALWLGSIIGCFFIPG  140

Query  501  ELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVG--YDEQ--FWYVALLVVSLVCY  668
              I  ++  S  G+ +F+L+Q+VLL+DF H  NDK V    D Q   W+V L+ ++ +  
Sbjct  141  SNIEQFQYPSMAGAIVFILIQLVLLVDFAHSLNDKLVAKFQDTQARIWFVLLIGLTFLFN  200

Query  669  VATFAITGVLFHFFAP  716
               FA+T +++ +F P
Sbjct  201  GTAFALTVIMWTYFLP  216



>ref|XP_008024685.1| hypothetical protein SETTUDRAFT_168930 [Setosphaeria turcica 
Et28A]
 gb|EOA87823.1| hypothetical protein SETTUDRAFT_168930 [Setosphaeria turcica 
Et28A]
Length=488

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RIAY  +  ++ IVSWI L + A   + ++       K    E +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLSHLTLDYVDIKCLGEECYGYVAVQRINFALG  106

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTSKF  536
             F  ++++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN   I +    +  
Sbjct  107  FFHVLMALMLIGVQTSKDPRATIQNGFWLPKIFGWIAMIVLTFFIPNSFFIVWGNYFAMV  166

Query  537  GSGlfllvqvvllldfvHGW----NDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFH  704
            G+ LFLL+ ++LL+D  H W     +K    + + W   L+  ++  Y+A+FA+T V++ 
Sbjct  167  GACLFLLIGLILLVDLAHNWAEYCQEKIETTESRVWTGMLVGSAMFMYLASFAMTVVMYI  226

Query  705  FFAPSG  722
            +FA SG
Sbjct  227  YFAKSG  232



>gb|KIW83119.1| hypothetical protein Z517_02363 [Fonsecaea pedrosoi CBS 271.37]
Length=481

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 101/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIKKLEHLTLDYMTFKCGSSECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  ILS+++IG+++ KD R  L +G W  K++ W   ++  FF+P     F+ +  
Sbjct  105  ALGMFHLILSVLLIGVRSTKDTRAGLQNGFWGPKLLVWIGFIVISFFIPEGFFMFWGNYV  164

Query  531  KF-GSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
             + G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A  A+
Sbjct  165  AYVGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRLWQVLLMGSSLGMYLAALAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>gb|KIX97644.1| hypothetical protein Z520_06422 [Fonsecaea multimorphosa CBS 
102226]
Length=481

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 101/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIKKLEHLTLDYMTFKCGSSECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  ILSI++IG+++ KD R  L +G W  K++ W   ++  F +P     F+ +  
Sbjct  105  ALGMFHLILSILLIGVRSTKDTRAGLQNGFWGPKLLVWIGFIVISFLIPEGFFLFWGNYV  164

Query  531  KF-GSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
             + G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYAGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRLWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>emb|CEJ00743.1| hypothetical protein RMCBS344292_14792 [Rhizopus microsporus]
Length=453

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 103/185 (56%), Gaps = 6/185 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RI Y  +F L+ I++W+ L   A   ++ +P         +   +   AV R+     
Sbjct  43   ATRIGYAIIFLLNSIIAWLMLSNWAIKQIQKLPLDYLKLNCTEGSCYGIIAVHRICFALV  102

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYEST-SKF  536
             F  +L ++++G++N + PR ++ +G W  KV+CW LL++  FF+PNE    + +  S  
Sbjct  103  LFHALLGLLLLGVRNSRQPRSSIQNGWWGPKVLCWMLLLVASFFIPNEFFRVWGNYFSLT  162

Query  537  GSGlfllvqvvllldfvHGWNDKWV---GYDEQFWYVALLVVSLVCYVATFAITGVLFHF  707
            G+ +F+L  +VLL+DF H W ++ +    Y +++ Y+ L+  +L  Y A   +TG+++ F
Sbjct  163  GAAIFILFGLVLLVDFAHSWTERCLENMEYSDKWKYI-LIGGTLFLYAAAITLTGIMYGF  221

Query  708  FAPSG  722
            F P+G
Sbjct  222  FTPNG  226



>gb|EST08485.1| endosomal membrane protein, EMP70 [Pseudozyma brasiliensis GHG001]
Length=510

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 98/193 (51%), Gaps = 13/193 (7%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILREVAAPLMENIP-----WINHFHKTPDREWFETDAVL  338
            S  + R+ +  +F L  + +W+   +   +M  I      +I    K  DR  +   AV 
Sbjct  45   SSIATRVGFAIIFCLDALFAWL--SLTGFMMHKIEEWSYNYIKMDCKDKDR-CYGVLAVH  101

Query  339  RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  518
            R++     F  +L + +IG+K+ +  R  + +G W  KV+ W  L   MFF+PN    F+
Sbjct  102  RITFALSLFHFLLGLSLIGVKDTRTKRAAIQNGWWGPKVLLWLTLTGLMFFIPNGFFVFW  161

Query  519  EST-SKFGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFA  683
             +  S   + +F++V +VLL+DF H W+    D+W   +  FW   L+  +L  Y A  A
Sbjct  162  ANYFSLIFASIFIVVGLVLLVDFAHSWSETCLDRWEATESDFWKFTLIGSTLGMYAAAIA  221

Query  684  ITGVLFHFFAPSG  722
            +TGVL+ FFA SG
Sbjct  222  LTGVLYGFFASSG  234



>gb|EYU43805.1| hypothetical protein MIMGU_mgv1a018435mg [Erythranthe guttata]
Length=415

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 97/178 (54%), Gaps = 2/178 (1%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  362
             AR AY  +F L+ +++W+ R+    ++  +P+ +      +RE + T  VLRVSLG F 
Sbjct  43   QARFAYGVIFLLTNVIAWLFRDYGERILPMLPY-SKACGAEERECYHTMGVLRVSLGCFI  101

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF ++ I         + R+  H G W +K +   +  +  FF+P++ I  Y   ++ G+
Sbjct  102  FFFLMFITTCHTGKLYNVRNAWHSGWWALKFVLLLVSFVIPFFIPSDYIQLYGELARVGA  161

Query  543  GlfllvqvvllldfvHGWNDKWVGYDEQFWYVAL-LVVSLVCYVATFAITGVLFHFFA  713
            G+FL++Q++ +++F+  WN+ W+  + +    ++ L +S   Y+A+     V++  +A
Sbjct  162  GVFLILQLISVIEFITWWNNYWMSDERKKSSCSIGLFMSTAFYIASVCGIVVMYVLYA  219



>ref|XP_007338591.1| TMS membrane protein/tumor differentially expressed protein [Auricularia 
delicata TFB-10046 SS5]
 gb|EJD53006.1| TMS membrane protein/tumor differentially expressed protein [Auricularia 
delicata TFB-10046 SS5]
Length=496

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 98/188 (52%), Gaps = 10/188 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILRE-VAAPLMENIPWINHFHK--TPDREWFETDAVLRV  344
            S  + R+ +  +F L+ +++WI++   A  L++   W   + +        +   AV RV
Sbjct  44   SSIATRVGFAIIFSLNSMLAWIMKTPFAIGLLQK--WSPEYTRMDCAKGSCYGVLAVHRV  101

Query  345  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  524
                     ILS ++IG+K+ +D R ++ +G W  KV+ W +L +  FF+PN    F+ +
Sbjct  102  CFALVLLHGILSALLIGVKDTRDKRASIQNGWWGPKVLLWLILTVVSFFIPNGFFIFWGN  161

Query  525  -TSKFGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAIT  689
              S  G+ +F+L+ +VLL+DF H W+    +KW   D   W   L+  +   Y A   +T
Sbjct  162  YISVIGATVFILLGLVLLVDFAHSWSETCTEKWEASDSSLWKWILIGSTAGLYAAVITLT  221

Query  690  GVLFHFFA  713
            GV++ FFA
Sbjct  222  GVMYGFFA  229



>gb|ESA19644.1| hypothetical protein GLOINDRAFT_19362 [Rhizophagus irregularis 
DAOM 181602]
Length=485

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 101/188 (54%), Gaps = 10/188 (5%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILRE--VAAPLMENIPWINHFH-KTPDREWFETDAVLRVSLG  353
            + RI Y  +  L+ I++W++    V   L +     N+ H   P+   F    V RV   
Sbjct  34   ATRIVYAIILLLNSILAWVMMSDWVVKKLEKKTH--NNLHLNCPEGSCFGVLTVHRVCFA  91

Query  354  NFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-LISFYESTS  530
                  IL I++IG+K+ ++PR  + +G W  K++ W   +I  FF+PNE  +++    +
Sbjct  92   LSLLHFILGILVIGVKDIRNPRSTIQNGWWGPKILLWIGFIIGSFFIPNEFFMAWGNYIA  151

Query  531  KFGSGlfllvqvvllldfvHGWNDKWVGYDEQF----WYVALLVVSLVCYVATFAITGVL  698
              G+ LF+LV ++LL+DF H W++K +  D+Q     W V L+  +L+ +    A+T ++
Sbjct  152  LVGAALFILVGLILLVDFAHTWSEKCMDKDDQSKDNKWKVILVGSTLLMFAGAIAMTSIV  211

Query  699  FHFFAPSG  722
            + FFA SG
Sbjct  212  YVFFAKSG  219



>ref|XP_001703677.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96426.1| predicted protein [Chlamydomonas reinhardtii]
Length=392

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 96/183 (52%), Gaps = 5/183 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILREVAAPLM-ENIPWINHFHKTPDREWFETDA----VLRVS  347
            +A+  YC  F  + I  W LR+     M  NI   +      +++  E  A     LRVS
Sbjct  21   AAKWFYCVGFSATAIAVWCLRDYGGGFMANNISSFSDCLSADNQDAVEECAGQQVALRVS  80

Query  348  LGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYEST  527
            L N  FF    +  + +   +D R NLH G W+ +V+ W  L++   ++P+ ++  Y   
Sbjct  81   LANLVFFGAHLLACVALTRVEDVRVNLHAGLWVWQVLSWLGLLVGFMWLPSSILYGYGQF  140

Query  528  SKFGSGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHF  707
            S++ SGLFL++Q++LL++FV+  N+  V  D +  +  L+  ++  +     +TG+ +HF
Sbjct  141  SRYASGLFLVLQLILLVNFVYEINEWLVDTDNKAAWAVLISGAVAAFCLGLVLTGIDYHF  200

Query  708  FAP  716
            +AP
Sbjct  201  YAP  203



>gb|KIZ04409.1| Serine incorporator 3 [Monoraphidium neglectum]
Length=403

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 94/180 (52%), Gaps = 2/180 (1%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFET--DAVLRVSLGNF  359
            A+  YC LF +  +++W+LR+ +         I  + + P  E   +     +R+S  NF
Sbjct  24   AKWTYCALFTVVTVITWVLRDYSDDWFLKHSTIFAYCQLPGYEALCSGKQVAVRISFANF  83

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFG  539
            +FF   ++++     ++D R  +H G W  K++ W   +   FFVP   I+ Y   +++G
Sbjct  84   SFFFTHALVLFWCTWERDFRAGIHTGLWFWKILAWGGAIAGFFFVPANAITVYAQVARYG  143

Query  540  SGlfllvqvvllldfvHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPS  719
            +GLFL+  ++ ++ +V+  N+  +  D +  + AL++ + V  +   A+ G  ++F+A +
Sbjct  144  AGLFLVFVMIEMVSWVYDVNEWLLRRDSKPAWAALVLGAAVSILGGLALIGAAYYFYAAT  203



>ref|XP_006295917.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
 gb|EOA28815.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
Length=423

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 96/180 (53%), Gaps = 4/180 (2%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREW-FETDAVLRVSLGNFT  362
            AR  Y  +F +  + +W +R+ A   +  +P+++     P   + F T  VLRVSLG F 
Sbjct  50   ARYVYGTIFLIINLCAWFIRDYAQKALALLPYVSSC--GPQGSYCFHTLGVLRVSLGCFM  107

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            FF I+ +           +++ H   W+ K +   L+++  FF+P   I  Y   ++ G+
Sbjct  108  FFLIMFLTTWNTMQLHQAQNSWHSDYWIFKFVLLVLVMVATFFIPQLYIQIYGEIARVGA  167

Query  543  GlfllvqvvllldfvHGWNDKWVGYDEQFWYVAL-LVVSLVCYVATFAITGVLFHFFAPS  719
            G+FL +Q+V +++F+  WN+ W+ +D++    +  LV+S V Y+ +     V+++F+  S
Sbjct  168  GIFLGLQLVSVIEFITWWNNYWIPHDQRKQSCSFGLVMSTVFYIGSVCGIAVMYYFYVTS  227



>dbj|BAM19260.1| membrane protein tms1d [Papilio polytes]
Length=441

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 108/205 (53%), Gaps = 24/205 (12%)
 Frame = +3

Query  165  SGISRRSARIAYCGLFGLSLIVSWI---------LREVAAPLMENIPWI--NHFHKTPDR  311
            S  +  S+R+ Y  +  L +IV+ +         L++V  P  EN   I   +F    D+
Sbjct  31   SCTNSTSSRLMYTVMLLLMMIVACVTLAPGLHDQLKKV--PFCENSTGIIPGNFKVDCDQ  88

Query  312  EWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFF  491
                  AV R+      FF +++++MIG+K+ KDPR  + +G W +K +     VI  FF
Sbjct  89   A-VGYLAVYRICFATCLFFVLMALIMIGVKSSKDPRAGIQNGFWGIKYLLVIGGVIGAFF  147

Query  492  VPN-ELISFYESTSKFGSGlfllvqvvllldfvHGWNDKWVG-YDE---QFWYVALLVVS  656
            +P  +  S +      G   F+++Q++L++DF H W ++WV  Y+E   + WYVALL+  
Sbjct  148  IPEGQFASTWMVFGMIGGFFFIIIQLILIIDFAHSWAERWVSNYEESQSRTWYVALLLSM  207

Query  657  LVCYVATFAITGVLF---HFFAPSG  722
            L C+  T A+TG++    ++  PSG
Sbjct  208  LTCF--TLALTGIVLLYVYYTKPSG  230



>ref|XP_010527190.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527191.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527192.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527194.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=405

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 63/127 (50%), Gaps = 2/127 (2%)
 Frame = +3

Query  165  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRV  344
            +G +   AR  Y  +F ++ +++W++R+     M  +    +      R     + VLRV
Sbjct  32   NGCNPWMARYVYGLIFLIANLLAWVVRDYGQGAMTEMRKFKNCKG--GRNCLGAEGVLRV  89

Query  345  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  524
            SLG F F+ I+ +  +G K     RD  H G W  K++ WF L I  F +P+ +I  Y  
Sbjct  90   SLGCFMFYFIMFLSTVGTKKMHSSRDRWHSGWWSAKLVMWFGLTIIPFLMPSSIIQLYGE  149

Query  525  TSKFGSG  545
             + FG+G
Sbjct  150  IAHFGAG  156



>ref|XP_008600130.1| serine incorporator [Beauveria bassiana ARSEF 2860]
 gb|EJP64107.1| serine incorporator [Beauveria bassiana ARSEF 2860]
Length=477

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 99/190 (52%), Gaps = 14/190 (7%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWILR-----EVAAPLMENIPWINHFHKTPDREWFETDAVLRVS  347
            + RIAY  +  ++ IV+WI+      E    LM +   IN     P+ E +   AV R++
Sbjct  46   ATRIAYALILLVNSIVAWIMLTPWAIEKLQHLMLDYVKIN----CPNGECYGWLAVHRIN  101

Query  348  LGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-  524
                 F  IL+ ++ G+ + K+PR  + +G W  KVI W   V+  F +P+E   F+ + 
Sbjct  102  FALGMFHLILAGLLFGVASSKEPRAAIQNGYWGPKVIAWVAFVVMSFLIPDEFFMFWGNY  161

Query  525  TSKFGSGlfllvqvvllldfvHGWNDKWVGY----DEQFWYVALLVVSLVCYVATFAITG  692
             +  G+ LFLL+ ++LL+D  HGW +  +      D + W   L+  +L  Y A+ A+T 
Sbjct  162  IALIGAMLFLLLGLILLVDLAHGWAEYCLAQIEDTDSRLWRTVLIGSTLGMYAASLAMTI  221

Query  693  VLFHFFAPSG  722
            V + FFA SG
Sbjct  222  VQYIFFAGSG  231



>ref|XP_006414928.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
 gb|ESQ56381.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
Length=394

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 4/121 (3%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD-REWFETDAVLRVSLGNFT  362
            AR  Y  +F L+ +++W +R+     +  +     F    D R    T+ VLRVSLG F 
Sbjct  33   ARYVYGLMFLLANLLAWTVRDYGRGALTEM---RKFKNCKDGRNCLGTEGVLRVSLGCFL  89

Query  363  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGS  542
            F+ I+ +  +G       RD  H G W+ K++ W  L IF F +P+ +I  Y   + FG+
Sbjct  90   FYFIMFLSTVGTSKTHSSRDKWHSGWWVAKLLMWPGLTIFPFLLPSSIIELYGEIAHFGA  149

Query  543  G  545
            G
Sbjct  150  G  150



>gb|EGU10891.1| putative Membrane protein [Rhodotorula glutinis ATCC 204091]
Length=514

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 100/190 (53%), Gaps = 7/190 (4%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + R+ +  +F L+ + +W+ L + A  L+    W     +  + + +   AV R+  
Sbjct  48   SSVATRVGFSLIFLLNSLFAWMMLTDFAIKLVAKWSWEWIKMECKEGKCYGVLAVHRICF  107

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYEST-  527
                F ++LS+++IG+K+ +  R  + +G W  KV+ W + V   F +PN   + + ST 
Sbjct  108  ALAMFHSVLSLLLIGVKDTRTKRAAIQNGWWGPKVLAWLVFVYLSFLIPNGFFTSFWSTY  167

Query  528  -SKFGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAITG  692
             S  GSG+F+L+ +VLL+DF H W+    ++W   D  FW   L+  +L  Y  T A+T 
Sbjct  168  ISLPGSGIFILIGLVLLVDFAHSWSETCLERWEATDSPFWKWVLISSTLGLYALTIALTV  227

Query  693  VLFHFFAPSG  722
            V + FFA  G
Sbjct  228  VQYVFFAGKG  237



>gb|KDP32305.1| hypothetical protein JCGZ_13230 [Jatropha curcas]
Length=400

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 2/120 (2%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            AR  Y  +F  + +++W  R+     +  +  +       D      + VLRVSLG F F
Sbjct  36   ARYVYALIFLFANLLAWAARDYGHGALSEMERLRVCAGKSDC--LGAEGVLRVSLGCFIF  93

Query  366  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG  545
            F I+ +  +G     DPRD  H G W  K++ W  L +  F +P+  I  Y   + FG+G
Sbjct  94   FIIMFVSTVGTSKFYDPRDAWHSGWWSAKIVMWIALTVLTFLIPSAFIQLYGEIAHFGAG  153



>ref|XP_001538371.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN10173.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=611

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 101/189 (53%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  173  SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  232

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P      + S  
Sbjct  233  ALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIPEGFFFVWGSYI  292

Query  531  KF-GSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
             F G+ LFLL+ ++LL+D  H W +    K    D Q W V L+  +L  Y+A+ A+T +
Sbjct  293  SFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIAMTVI  352

Query  696  LFHFFAPSG  722
            ++ FFA SG
Sbjct  353  MYIFFAHSG  361



>gb|ABK22983.1| unknown [Picea sitchensis]
Length=343

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 92/181 (51%), Gaps = 3/181 (2%)
 Frame = +3

Query  186  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  365
            AR  Y   F L+ +++W++R+ +   +  + ++       D     T+ VLRVS G F F
Sbjct  22   ARYVYGFTFLLTNLLAWVVRDYSQSALAKLHYLKGCQGGHD--CLGTEGVLRVSFGCFIF  79

Query  366  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG  545
              I+ +  +G     + R + H G W +K   W   ++  F +P+  I  Y   ++FG+G
Sbjct  80   HFIMFLTTVGTTKLHEYRASWHSGLWPLKFFMWISFLLMPFLLPSTFIQLYGEVARFGAG  139

Query  546  lfllvqvvllldfvHGWNDKWVGYDEQ-FWYVALLVVSLVCYVATFAITGVLFHFFAPSG  722
            +FLL+Q++ ++ F+  WND W+  D+     V  ++VS   Y A+     +++  +AP+ 
Sbjct  140  IFLLIQLISVVKFITWWNDHWMSDDDAGHRRVPAIMVSTTAYSASVCGIILMYISYAPTA  199

Query  723  Q  725
             
Sbjct  200  S  200



>gb|KIW26131.1| hypothetical protein PV07_09255 [Cladophialophora immunda]
Length=481

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 101/192 (53%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIKKLEHLTLDYMNFKCGSSECYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  ILS+++IG+++ KD R  L +G W  K++ W   ++  F +P     F+ +  
Sbjct  105  ALGMFHLILSVLLIGVRSTKDTRAGLQNGFWGPKLLVWISFIVVSFLIPEGFFLFWGNYV  164

Query  531  KF-GSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
             + G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A FA+
Sbjct  165  AYAGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRLWQVLLMGSSLGMYLAAFAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>ref|XP_003653050.1| hypothetical protein THITE_2115040 [Thielavia terrestris NRRL 
8126]
 gb|AEO66714.1| hypothetical protein THITE_2115040 [Thielavia terrestris NRRL 
8126]
Length=498

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 103/186 (55%), Gaps = 6/186 (3%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  359
            + RIAY  +  ++ I+SWI L + A   ++++       K  D + +   AV R++    
Sbjct  46   ATRIAYALILLVNSILSWIMLTKWAVEKLQHLMLDYVKIKCGDGDCYGWLAVHRINFSLG  105

Query  360  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-TSKF  536
             F  +L+ +M+G+++ K+PR  + +G W  K+I W  L++  FF+P+    F+ +  +  
Sbjct  106  MFHLVLAALMLGVRSSKNPRAAIQNGFWGPKIIAWLGLIVLTFFIPDTFFQFWGNYVAMI  165

Query  537  GSGlfllvqvvllldfvHGWNDKWVGYDE----QFWYVALLVVSLVCYVATFAITGVLFH  704
            G+ LFL++ ++LL+D  H W +  +   E    + W V L+  +L  Y+A+ A+T V + 
Sbjct  166  GAMLFLILGLILLVDLAHNWAEYCLAQIENSESKTWRVILIGSTLGMYLASLAMTIVQYI  225

Query  705  FFAPSG  722
            FFA SG
Sbjct  226  FFASSG  231



>gb|KIL67495.1| hypothetical protein M378DRAFT_258687 [Amanita muscaria Koide 
BX008]
Length=501

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 102/190 (54%), Gaps = 12/190 (6%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWILR-EVAAPLMENIPWINHFHKTPDRE--WFETDAVLRV  344
            S  + R+ +  +F L+ I++WI++ ++   L++   W   + K   +E   +   AV RV
Sbjct  44   SSIATRVGFAIIFSLNSILAWIMKTDLVIKLVQK--WSLDYIKMDCKEGKCYGVLAVHRV  101

Query  345  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  524
                  F  ILS ++IG+K+ +D R  + +G W  KV+ W +LV   FF+PN    F+ +
Sbjct  102  CFALALFHLILSSLLIGVKDTRDKRSAIQNGWWGPKVLLWIILVAISFFIPNGFFMFWGN  161

Query  525  -TSKFGSGlfllvqvvllldfvHGWN----DKWVGY--DEQFWYVALLVVSLVCYVATFA  683
              S  G+ +F+L+ +VLL+DF H W+    +KW     +   W   L+  +   YV T  
Sbjct  162  YVSLIGATVFILIGLVLLVDFAHTWSETCIEKWENSAGNSNLWQWILIGSTAATYVFTIT  221

Query  684  ITGVLFHFFA  713
            +TG+L+ FFA
Sbjct  222  MTGILYAFFA  231



>ref|XP_002626102.1| serine incorporator [Blastomyces dermatitidis SLH14081]
 gb|EEQ76891.1| serine incorporator [Blastomyces dermatitidis SLH14081]
Length=480

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 100/189 (53%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  IL+++++G+++ KD R  L +G W  K+I W LLV   FF+P      + S  
Sbjct  103  ALGLFHIILALLLLGVRSSKDGRAGLQNGFWGPKIIVWLLLVAMSFFIPEGFFFVWGSYI  162

Query  531  KF-GSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
             F G+ LFLL+ ++LL+D  H W +    K    D Q W V L+  +L  Y+A+ A+T V
Sbjct  163  SFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIAMTVV  222

Query  696  LFHFFAPSG  722
            ++ FFA SG
Sbjct  223  MYIFFAHSG  231



>gb|EEQ92459.1| membrane protein TMS1 [Blastomyces dermatitidis ER-3]
 gb|EGE84008.1| membrane protein TMS1 [Blastomyces dermatitidis ATCC 18188]
 gb|EQL35164.1| hypothetical protein BDFG_03147 [Blastomyces dermatitidis ATCC 
26199]
Length=480

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 100/189 (53%), Gaps = 6/189 (3%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTS  530
                F  IL+++++G+++ KD R  L +G W  K+I W LLV   FF+P      + S  
Sbjct  103  ALGLFHIILALLLLGVRSSKDGRAGLQNGFWGPKIIVWLLLVAMSFFIPEGFFFVWGSYI  162

Query  531  KF-GSGlfllvqvvllldfvHGWND----KWVGYDEQFWYVALLVVSLVCYVATFAITGV  695
             F G+ LFLL+ ++LL+D  H W +    K    D Q W V L+  +L  Y+A+ A+T V
Sbjct  163  SFIGAILFLLLGLILLVDLAHTWAEICLQKIEELDSQMWRVLLIGSTLGMYLASIAMTVV  222

Query  696  LFHFFAPSG  722
            ++ FFA SG
Sbjct  223  MYIFFAHSG  231



>ref|XP_003936453.1| PREDICTED: serine incorporator 3 [Saimiri boliviensis boliviensis]
Length=473

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 100/199 (50%), Gaps = 25/199 (13%)
 Frame = +3

Query  189  RIAYCGLFGLSLIVSWIL-REVAAPLMENIPW-------INHFHKTPDREW---FETDAV  335
            R+ Y  +  LS  VS+I+ R    P ++ IP        I+   +  D++        AV
Sbjct  39   RLIYAFILILSTAVSYIMQRREMEPYLKKIPGFCEGGFKIHEADRNADKDCDVLVGYKAV  98

Query  336  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  515
             R++     FF + S++MI +K  KDPR  +H+G W  K+     +++  F++P      
Sbjct  99   YRINFAMAIFFLVFSLLMIKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGG----  154

Query  516  YESTSKF-----GSGlfllvqvvllldfvHGWNDKWVGYDEQ----FWYVALLVVSLVCY  668
            Y S++ F     G+  F+L+Q+VLL+DF H WN+ WV   E+     WY ALL  +   Y
Sbjct  155  YFSSAWFFVGMGGAAFFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFY  214

Query  669  VATFAITGVLFHFFA-PSG  722
            + +    G+L+ ++  P G
Sbjct  215  ILSIICVGLLYTYYTKPDG  233



>gb|KIW39489.1| hypothetical protein PV06_08096 [Exophiala oligosperma]
Length=481

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 100/192 (52%), Gaps = 9/192 (5%)
 Frame = +3

Query  174  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  350
            S  + RIAY  +  ++ I++WI L   A   +E++       K    + +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSILAWIMLTPWAIRKLEHLTLDYMNFKCGSSDCYGYFAVQRINF  104

Query  351  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-T  527
                F  ILS+++IG+++ KD R  L +G W  K++ W   V+  F +P     F+ +  
Sbjct  105  ALALFHLILSVLLIGVRSTKDTRAGLQNGFWGPKILVWLAFVVISFLIPEGFFLFWGNYV  164

Query  528  SKFGSGlfllvqvvllldfvHGWN-------DKWVGYDEQFWYVALLVVSLVCYVATFAI  686
            +  G+ LF+L+ ++LL+D  H W        D+  G + + W V L+  SL  Y+A  A+
Sbjct  165  AYLGAMLFVLLGLILLVDLAHTWAELCQDKIDEGDGPNYRLWQVLLMGSSLGMYIAAIAM  224

Query  687  TGVLFHFFAPSG  722
            T V++ FFA SG
Sbjct  225  TIVMYIFFASSG  236



>gb|EXX52304.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=435

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 104/187 (56%), Gaps = 8/187 (4%)
 Frame = +3

Query  183  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFH-KTPDREWFETDAVLRVSLGN  356
            + RI +  +  L+ +++WI L + A   +E I + ++ H    +   +   AV R+    
Sbjct  42   ATRIGFAIILLLNSMLAWIMLSDWAIKQLEKITY-DYLHLNCQEGTCYGILAVHRICFAL  100

Query  357  FTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-TSK  533
              F  IL +++IG+K+  D R  + +G W +K+I W + V+  FF+PN+   F+ +  + 
Sbjct  101  SFFHFILGLLVIGVKDTHDNRAAIQNGWWGVKIIGWIIFVVASFFIPNQFFMFWGNYIAL  160

Query  534  FGSGlfllvqvvllldfvHGWN----DKWVGYDEQFWYVALLVVSLVCYVATFAITGVLF  701
             G+ LF+L+ +VLL+DF H W+    +KW   D+  W   L+  +L   + +  +TG+++
Sbjct  161  IGATLFILIGLVLLVDFAHTWSETCIEKWEESDDNKWKYLLIGSTLAMLLTSIILTGIMY  220

Query  702  HFFAPSG  722
            +FFA SG
Sbjct  221  NFFAGSG  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455