BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043P17

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    201   2e-55   Sesamum indicum [beniseed]
emb|CDP14623.1|  unnamed protein product                                201   3e-55   Coffea canephora [robusta coffee]
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    197   4e-54   Nicotiana tomentosiformis
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    197   7e-54   Nicotiana sylvestris
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    196   2e-53   Solanum tuberosum [potatoes]
ref|XP_006840189.1|  hypothetical protein AMTR_s00089p00108500          194   3e-53   
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    194   6e-53   
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    191   1e-51   Solanum lycopersicum
ref|XP_002518223.1|  receptor protein kinase, putative                  191   1e-51   Ricinus communis
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    189   6e-51   Cucumis melo [Oriental melon]
emb|CBI39439.3|  unnamed protein product                                187   6e-51   Vitis vinifera
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    188   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_004156987.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    188   1e-50   
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    188   1e-50   Cucumis sativus [cucumbers]
gb|KJB37929.1|  hypothetical protein B456_006G227000                    187   1e-50   Gossypium raimondii
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    187   1e-50   Vitis vinifera
gb|KHG00472.1|  hypothetical protein F383_20103                         184   1e-49   Gossypium arboreum [tree cotton]
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    183   6e-49   Glycine soja [wild soybean]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    183   6e-49   Glycine max [soybeans]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    182   9e-49   Glycine max [soybeans]
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    182   1e-48   Glycine soja [wild soybean]
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    182   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             182   1e-48   Phaseolus vulgaris [French bean]
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    181   5e-48   Malus domestica [apple tree]
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    180   6e-48   Populus euphratica
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    180   6e-48   
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    180   7e-48   Populus euphratica
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    179   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    179   1e-47   Pyrus x bretschneideri [bai li]
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                178   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    177   7e-47   Citrus sinensis [apfelsine]
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             177   8e-47   Citrus clementina [clementine]
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    177   1e-46   
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    176   2e-46   Arabis alpina [alpine rockcress]
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    176   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    176   2e-46   Eucalyptus grandis [rose gum]
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    173   2e-45   Medicago truncatula
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    173   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    172   7e-45   Fragaria vesca subsp. vesca
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             171   9e-45   Capsella rubella
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             170   2e-44   
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    170   2e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20032.1|  BnaA09g02190D                                          169   7e-44   Brassica napus [oilseed rape]
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    168   1e-43   Brassica rapa
gb|EPS70115.1|  hypothetical protein M569_04636                         168   1e-43   Genlisea aurea
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    168   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    164   3e-42   Brassica rapa
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             163   7e-42   Eutrema salsugineum [saltwater cress]
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    161   3e-41   Cicer arietinum [garbanzo]
gb|KDP37890.1|  hypothetical protein JCGZ_05772                         161   4e-41   Jatropha curcas
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    158   4e-40   Camelina sativa [gold-of-pleasure]
emb|CDY00141.1|  BnaC09g01600D                                          157   6e-40   
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    157   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             154   1e-38   
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    154   1e-38   Prunus mume [ume]
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    153   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    144   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB67930.1|  hypothetical protein B456_010G218400                    139   4e-34   Gossypium raimondii
gb|KJB67929.1|  hypothetical protein B456_010G218400                    139   1e-33   Gossypium raimondii
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    139   2e-33   Citrus sinensis [apfelsine]
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             139   2e-33   
gb|KDO67528.1|  hypothetical protein CISIN_1g002321mg                   138   2e-33   Citrus sinensis [apfelsine]
gb|KJB73018.1|  hypothetical protein B456_011G209800                    137   6e-33   Gossypium raimondii
gb|KHG09451.1|  hypothetical protein F383_09289                         137   6e-33   Gossypium arboreum [tree cotton]
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             137   7e-33   Prunus persica
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    137   7e-33   Prunus mume [ume]
gb|KHG03607.1|  hypothetical protein F383_26757                         137   8e-33   Gossypium arboreum [tree cotton]
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...    137   1e-32   Elaeis guineensis
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    136   1e-32   Elaeis guineensis
ref|XP_002520879.1|  ATP binding protein, putative                      136   1e-32   Ricinus communis
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    136   2e-32   Nicotiana sylvestris
ref|XP_008350571.1|  PREDICTED: probably inactive leucine-rich re...    132   3e-32   
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    135   3e-32   Cucumis sativus [cucumbers]
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    135   3e-32   Nicotiana tomentosiformis
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    135   3e-32   Populus euphratica
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    135   3e-32   Cucumis melo [Oriental melon]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...    135   3e-32   
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    135   4e-32   Cucumis melo [Oriental melon]
gb|ACN33819.1|  unknown                                                 135   4e-32   Zea mays [maize]
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    135   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350          135   5e-32   
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             134   5e-32   
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    134   9e-32   Prunus mume [ume]
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             134   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    134   1e-31   Vitis vinifera
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             133   1e-31   
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             133   1e-31   Capsella rubella
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             133   1e-31   
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    133   2e-31   Populus euphratica
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       133   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    133   2e-31   Populus euphratica
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    133   2e-31   Cucumis sativus [cucumbers]
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    132   3e-31   Nelumbo nucifera [Indian lotus]
gb|EAY77289.1|  hypothetical protein OsI_05265                          132   3e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001170194.1|  uncharacterized protein LOC100384143 precursor     129   3e-31   
dbj|BAB92869.1|  putative receptor-like protein kinase                  132   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    132   3e-31   Glycine max [soybeans]
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    132   3e-31   
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    132   3e-31   Vitis vinifera
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    132   5e-31   Brassica rapa
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             132   5e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    132   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    131   7e-31   Glycine max [soybeans]
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    131   7e-31   
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    131   8e-31   
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              131   9e-31   Selaginella moellendorffii
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       131   1e-30   Arabis alpina [alpine rockcress]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    131   1e-30   Glycine max [soybeans]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    130   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             130   1e-30   Phaseolus vulgaris [French bean]
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    130   1e-30   
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    130   1e-30   
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    130   2e-30   Phoenix dactylifera
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    130   2e-30   Elaeis guineensis
gb|AAL49790.1|  unknown protein                                         130   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...    129   4e-30   Setaria italica
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    129   4e-30   Eucalyptus grandis [rose gum]
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    129   5e-30   Populus euphratica
gb|KDP21644.1|  hypothetical protein JCGZ_03315                         129   5e-30   Jatropha curcas
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    129   6e-30   Eucalyptus grandis [rose gum]
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...    129   7e-30   Zea mays [maize]
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          128   7e-30   Sorghum bicolor [broomcorn]
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    128   8e-30   
ref|XP_008388889.1|  PREDICTED: probably inactive leucine-rich re...    125   1e-29   
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    128   1e-29   Setaria italica
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              127   1e-29   
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    128   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_001771841.1|  predicted protein                                  128   1e-29   
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   Solanum tuberosum [potatoes]
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    127   1e-29   Elaeis guineensis
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    128   2e-29   
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-29   Solanum tuberosum [potatoes]
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    127   2e-29   
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842493.1|  hypothetical protein AMTR_s00077p00091370          127   2e-29   Amborella trichopoda
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   127   2e-29   Citrus sinensis [apfelsine]
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    127   2e-29   Solanum lycopersicum
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    127   2e-29   Ricinus communis
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    127   3e-29   Citrus sinensis [apfelsine]
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             127   3e-29   
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    127   3e-29   Morus notabilis
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             127   3e-29   Eutrema salsugineum [saltwater cress]
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    127   3e-29   Populus euphratica
dbj|BAJ85468.1|  predicted protein                                      127   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    126   3e-29   Populus euphratica
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    126   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    126   3e-29   
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    126   4e-29   Pyrus x bretschneideri [bai li]
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    126   5e-29   Solanum lycopersicum
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    126   5e-29   Sesamum indicum [beniseed]
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                125   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    125   6e-29   Fragaria vesca subsp. vesca
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    125   6e-29   Cicer arietinum [garbanzo]
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    125   7e-29   Solanum lycopersicum
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    125   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    125   1e-28   
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    125   1e-28   Nicotiana tomentosiformis
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    124   2e-28   Tarenaya hassleriana [spider flower]
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    124   2e-28   Glycine soja [wild soybean]
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    124   2e-28   Nicotiana sylvestris
ref|XP_002990527.1|  hypothetical protein SELMODRAFT_131809             117   2e-28   
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    124   2e-28   
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             124   2e-28   Phaseolus vulgaris [French bean]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    124   3e-28   Glycine max [soybeans]
gb|KJB71525.1|  hypothetical protein B456_011G127000                    124   3e-28   Gossypium raimondii
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    123   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    123   5e-28   Solanum tuberosum [potatoes]
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                123   5e-28   Erythranthe guttata [common monkey flower]
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    122   7e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    122   7e-28   Fragaria vesca subsp. vesca
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             122   7e-28   Phaseolus vulgaris [French bean]
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    122   1e-27   
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    122   1e-27   Cicer arietinum [garbanzo]
gb|EPS70735.1|  hypothetical protein M569_04020                         121   2e-27   Genlisea aurea
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    121   2e-27   Glycine max [soybeans]
ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...    121   2e-27   
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    121   3e-27   
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    120   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...    120   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004173348.1|  PREDICTED: probably inactive leucine-rich re...    120   7e-27   
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    120   7e-27   Cucumis sativus [cucumbers]
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    119   9e-27   
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        119   1e-26   Medicago truncatula
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-26   Cucumis melo [Oriental melon]
gb|AES79844.2|  LRR receptor-like kinase family protein                 119   1e-26   Medicago truncatula
ref|XP_003623626.1|  Receptor-like protein kinase                       119   2e-26   
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    118   2e-26   Morus notabilis
emb|CBI25352.3|  unnamed protein product                                117   3e-26   Vitis vinifera
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             118   3e-26   
gb|EEC75203.1|  hypothetical protein OsI_11455                          118   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             118   3e-26   Eutrema salsugineum [saltwater cress]
ref|XP_003605286.1|  Receptor-like protein kinase                       117   3e-26   Medicago truncatula
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    117   7e-26   Sesamum indicum [beniseed]
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...    116   8e-26   Brassica rapa
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             116   1e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF79960.1|  receptor-like kinase                                   116   1e-25   Marchantia polymorpha
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...    116   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    115   2e-25   
emb|CBI18033.3|  unnamed protein product                                114   3e-25   Vitis vinifera
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    114   4e-25   Arabis alpina [alpine rockcress]
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    114   9e-25   Brachypodium distachyon [annual false brome]
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             113   1e-24   Capsella rubella
ref|NP_001050035.1|  Os03g0335500                                       113   1e-24   
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    113   1e-24   
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-24   Oryza brachyantha
dbj|BAK06250.1|  predicted protein                                      112   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    110   1e-23   
emb|CDX85183.1|  BnaC07g24940D                                          110   1e-23   
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          110   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...    109   2e-23   
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...    109   2e-23   
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...    109   3e-23   
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    109   3e-23   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP13903.1|  unnamed protein product                                108   6e-23   Coffea canephora [robusta coffee]
dbj|BAB85306.1|  putative receptor-like protein kinase                  107   9e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76307.1|  hypothetical protein OsI_04242                          107   9e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189             107   1e-22   
emb|CDY04822.1|  BnaAnng00040D                                          106   3e-22   
emb|CDY27220.1|  BnaA09g35820D                                          106   3e-22   Brassica napus [oilseed rape]
ref|XP_001759642.1|  predicted protein                                  106   3e-22   
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    105   5e-22   Nicotiana sylvestris
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480          105   6e-22   Sorghum bicolor [broomcorn]
ref|XP_001769840.1|  predicted protein                                  105   8e-22   
emb|CDX72142.1|  BnaC08g27320D                                          105   8e-22   
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    105   9e-22   Sesamum indicum [beniseed]
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...    100   4e-20   
ref|NP_001055847.2|  Os05g0478300                                     99.8    5e-20   
ref|XP_001763904.1|  predicted protein                                99.0    8e-20   
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...  99.0    1e-19   Zea mays [maize]
ref|XP_001775671.1|  predicted protein                                98.2    1e-19   
emb|CDY14823.1|  BnaC04g48200D                                        97.1    2e-19   Brassica napus [oilseed rape]
emb|CDY47962.1|  BnaA04g24400D                                        96.3    5e-19   Brassica napus [oilseed rape]
ref|XP_009142052.1|  PREDICTED: probable inactive leucine-rich re...  96.3    5e-19   Brassica rapa
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  92.0    6e-19   Zea mays [maize]
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240        96.3    8e-19   Sorghum bicolor [broomcorn]
ref|NP_001055909.1|  Os05g0491400                                     90.5    3e-18   
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...  94.7    3e-18   Setaria italica
gb|AEW49518.1|  putative LRR-RLK protein XIAO                         94.4    3e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66725.1|  H0404F02.1                                           94.4    3e-18   Oryza sativa [red rice]
gb|EEE61543.1|  hypothetical protein OsJ_15867                        94.4    4e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02926.1|  predicted protein                                    94.4    4e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86449.1|  predicted protein                                    94.0    5e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY98521.1|  hypothetical protein OsI_20433                        89.4    6e-18   Oryza sativa Indica Group [Indian rice]
gb|KHG13399.1|  hypothetical protein F383_10003                       93.2    7e-18   Gossypium arboreum [tree cotton]
ref|XP_004491185.1|  PREDICTED: somatic embryogenesis receptor ki...  89.0    1e-17   Cicer arietinum [garbanzo]
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...  92.8    1e-17   
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    1e-17   Pyrus x bretschneideri [bai li]
ref|NP_181758.1|  leucine-rich repeat protein kinase family protein   91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001777608.1|  predicted protein                                91.7    2e-17   
ref|XP_010242337.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004246027.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    2e-17   Solanum lycopersicum
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  91.7    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864814.1|  leucine-rich repeat family protein               91.3    2e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...  91.3    2e-17   Cicer arietinum [garbanzo]
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...  91.3    2e-17   
ref|NP_001241394.1|  somatic embryogenesis receptor kinase 1-like...  87.8    2e-17   Glycine max [soybeans]
gb|ACU19288.1|  unknown                                               87.8    2e-17   Glycine max [soybeans]
gb|ACU22741.1|  unknown                                               87.8    3e-17   Glycine max [soybeans]
gb|KHN38434.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  87.0    3e-17   Glycine soja [wild soybean]
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...  90.5    3e-17   
ref|XP_006293827.1|  hypothetical protein CARUB_v10022811mg           90.9    3e-17   Capsella rubella
ref|NP_001047431.1|  Os02g0615500                                     91.7    3e-17   
ref|XP_010517745.1|  PREDICTED: probable inactive leucine-rich re...  90.9    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg           90.9    3e-17   Eutrema salsugineum [saltwater cress]
ref|XP_003519488.1|  PREDICTED: somatic embryogenesis receptor ki...  87.4    3e-17   Glycine max [soybeans]
ref|XP_006293826.1|  hypothetical protein CARUB_v10022811mg           90.9    3e-17   
ref|XP_007141567.1|  hypothetical protein PHAVU_008G206700g           88.2    3e-17   Phaseolus vulgaris [French bean]
ref|XP_008669002.1|  PREDICTED: probable LRR receptor-like serine...  91.3    3e-17   
gb|EEE57372.1|  hypothetical protein OsJ_07527                        91.3    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010506042.1|  PREDICTED: probable inactive leucine-rich re...  90.5    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002462033.1|  hypothetical protein SORBIDRAFT_02g013100        90.9    4e-17   Sorghum bicolor [broomcorn]
ref|XP_009614181.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    5e-17   Nicotiana tomentosiformis
ref|XP_002991272.1|  hypothetical protein SELMODRAFT_236241           90.5    5e-17   
ref|XP_002991210.1|  hypothetical protein SELMODRAFT_236225           90.5    5e-17   
ref|XP_002318612.2|  hypothetical protein POPTR_0012s07290g           89.4    6e-17   
ref|XP_002301998.2|  leucine-rich repeat family protein               90.5    6e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    7e-17   Fragaria vesca subsp. vesca
ref|XP_011042612.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    8e-17   
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    9e-17   
ref|XP_009416848.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    9e-17   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...  89.7    9e-17   
gb|KJB47371.1|  hypothetical protein B456_008G023200                  89.7    1e-16   
ref|XP_004138149.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    1e-16   
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...  89.4    1e-16   
gb|ABK93925.1|  unknown                                               89.4    1e-16   
ref|XP_010256225.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    1e-16   
ref|XP_010256230.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    1e-16   
gb|AFW85540.1|  putative leucine-rich repeat receptor-like protei...  89.7    1e-16   
ref|XP_011028955.1|  PREDICTED: probable LRR receptor-like serine...  89.7    1e-16   
ref|XP_006428061.1|  hypothetical protein CICLE_v10027485mg           89.0    1e-16   
emb|CDP14870.1|  unnamed protein product                              89.0    1e-16   
ref|NP_001239788.1|  LRR receptor-like serine/threonine-protein k...  89.0    1e-16   
ref|XP_006586717.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    1e-16   
gb|EEE64100.1|  hypothetical protein OsJ_18931                        89.4    1e-16   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...  88.6    2e-16   
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg           88.6    2e-16   
gb|KHN41747.1|  LRR receptor-like serine/threonine-protein kinase...  88.2    2e-16   
gb|KDO59946.1|  hypothetical protein CISIN_1g0130042mg                87.4    2e-16   
gb|KJB16403.1|  hypothetical protein B456_002G229000                  88.6    2e-16   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  89.0    2e-16   
gb|KHG04550.1|  hypothetical protein F383_29256                       88.6    2e-16   
ref|XP_004961662.1|  PREDICTED: somatic embryogenesis receptor ki...  85.1    2e-16   
gb|EPS73511.1|  hypothetical protein M569_01245                       88.2    2e-16   
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    3e-16   
emb|CDX84346.1|  BnaC03g51540D                                        87.8    3e-16   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820        88.2    3e-16   
emb|CDY00321.1|  BnaA06g22220D                                        87.8    3e-16   
ref|XP_003617091.1|  Somatic embryogenesis receptor kinase            84.7    3e-16   
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  88.6    3e-16   
gb|KHG29212.1|  LRR receptor-like serine/threonine-protein kinase...  87.8    3e-16   
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    3e-16   
ref|XP_009151389.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    3e-16   
ref|XP_007028918.1|  Leucine-rich repeat protein kinase family pr...  87.8    4e-16   
ref|XP_009421476.1|  PREDICTED: receptor-like protein kinase HSL1     88.2    4e-16   
gb|ACJ85954.1|  unknown                                               84.3    4e-16   
emb|CDP18612.1|  unnamed protein product                              87.4    4e-16   
ref|XP_002992346.1|  hypothetical protein SELMODRAFT_26650            83.2    4e-16   
ref|XP_004976562.1|  PREDICTED: probable LRR receptor-like serine...  88.2    4e-16   
gb|KCW51007.1|  hypothetical protein EUGRSUZ_J00633                   84.0    4e-16   
ref|XP_009607517.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    4e-16   
ref|XP_007037206.1|  Leucine-rich repeat protein kinase family pr...  87.0    4e-16   
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    4e-16   
ref|XP_007023499.1|  Serine-threonine protein kinase, plant-type,...  84.7    4e-16   
ref|XP_009596436.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    4e-16   
gb|KJB25051.1|  hypothetical protein B456_004G175500                  85.9    4e-16   
ref|XP_009780720.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    5e-16   
ref|XP_006431907.1|  hypothetical protein CICLE_v10002503mg           83.6    5e-16   
ref|XP_009769350.1|  PREDICTED: probable inactive leucine-rich re...  87.4    5e-16   
gb|EYU29140.1|  hypothetical protein MIMGU_mgv1a022602mg              87.0    5e-16   
ref|XP_002533978.1|  lrr receptor protein kinase, putative            86.7    5e-16   
gb|KCW78418.1|  hypothetical protein EUGRSUZ_D02582                   86.7    5e-16   
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872           87.0    5e-16   
ref|XP_011086853.1|  PREDICTED: somatic embryogenesis receptor ki...  84.0    5e-16   
ref|XP_004964647.1|  PREDICTED: putative leucine-rich repeat rece...  87.8    5e-16   
ref|XP_002511511.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  87.0    5e-16   
gb|EPS73860.1|  hypothetical protein M569_00895                       83.6    5e-16   
ref|XP_007158112.1|  hypothetical protein PHAVU_002G125100g           87.0    6e-16   
ref|XP_011025618.1|  PREDICTED: somatic embryogenesis receptor ki...  84.0    6e-16   
ref|XP_002437981.1|  hypothetical protein SORBIDRAFT_10g005850        87.8    6e-16   
ref|XP_010420958.1|  PREDICTED: somatic embryogenesis receptor ki...  83.6    6e-16   
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g           86.7    7e-16   
ref|XP_002519895.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  86.7    7e-16   
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g           86.7    7e-16   
ref|XP_010325645.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    7e-16   
dbj|BAJ91470.1|  predicted protein                                    86.7    7e-16   
ref|XP_010054034.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    7e-16   
ref|XP_004512361.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    7e-16   
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...  86.7    8e-16   
ref|XP_009596435.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    8e-16   
gb|KJB25050.1|  hypothetical protein B456_004G175500                  86.3    8e-16   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    8e-16   
ref|XP_003602344.1|  Kinase-like protein                              87.0    9e-16   
gb|AFK45363.1|  unknown                                               83.2    1e-15   
gb|KDP31199.1|  hypothetical protein JCGZ_11575                       86.3    1e-15   
ref|XP_009793727.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    1e-15   
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg              86.3    1e-15   
ref|XP_006493852.1|  PREDICTED: somatic embryogenesis receptor ki...  86.3    1e-15   
ref|XP_007040925.1|  Leucine-rich repeat protein kinase family pr...  85.5    1e-15   
ref|XP_011071714.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    1e-15   
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g           86.7    1e-15   
ref|XP_010454429.1|  PREDICTED: somatic embryogenesis receptor ki...  82.8    1e-15   
gb|KDP39728.1|  hypothetical protein JCGZ_02748                       85.9    1e-15   
ref|XP_011071715.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    1e-15   
ref|XP_006428060.1|  hypothetical protein CICLE_v10027231mg           85.9    1e-15   
ref|XP_009390422.1|  PREDICTED: probable LRR receptor-like serine...  85.9    1e-15   
ref|XP_002303477.2|  hypothetical protein POPTR_0003s10410g           85.9    1e-15   
ref|XP_001785654.1|  predicted protein                                85.9    1e-15   
gb|KJB25049.1|  hypothetical protein B456_004G175500                  85.9    1e-15   
gb|EPS65172.1|  hypothetical protein M569_09607                       81.3    1e-15   
ref|XP_006365392.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    1e-15   
ref|NP_001169585.1|  uncharacterized protein LOC100383466             86.3    1e-15   
gb|EEC68243.1|  hypothetical protein OsI_36258                        82.8    1e-15   
gb|KHN48658.1|  LRR receptor-like serine/threonine-protein kinase...  85.9    1e-15   
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.9    1e-15   
ref|XP_002451097.1|  hypothetical protein SORBIDRAFT_05g024090        85.9    1e-15   
tpg|DAA39565.1|  TPA: putative leucine-rich repat protein kinase ...  86.3    2e-15   
ref|XP_006411490.1|  hypothetical protein EUTSA_v10017834mg           85.9    2e-15   
ref|XP_011028007.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    2e-15   
ref|XP_007040924.1|  Leucine-rich repeat protein kinase family pr...  85.5    2e-15   
ref|NP_201077.2|  leucine-rich repeat protein kinase-like protein     85.5    2e-15   
dbj|BAG93736.1|  unnamed protein product                              83.2    2e-15   
ref|XP_010493229.1|  PREDICTED: somatic embryogenesis receptor ki...  82.4    2e-15   
emb|CDY16762.1|  BnaA09g06200D                                        85.5    2e-15   
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase            85.5    2e-15   
ref|XP_003527058.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    2e-15   
ref|XP_009343197.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    2e-15   
ref|XP_009624197.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  82.0    2e-15   
ref|XP_006288424.1|  hypothetical protein CARUB_v10001683mg           82.8    2e-15   
ref|XP_006493855.1|  PREDICTED: somatic embryogenesis receptor ki...  85.5    2e-15   
gb|KHN19373.1|  LRR receptor-like serine/threonine-protein kinase...  85.1    2e-15   
gb|KFK26321.1|  hypothetical protein AALP_AA8G232500                  82.0    2e-15   
ref|XP_002881831.1|  leucine-rich repeat family protein               85.1    2e-15   
ref|XP_011028003.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    2e-15   
ref|XP_008373495.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    3e-15   
ref|XP_006581953.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    3e-15   
gb|KDP38737.1|  hypothetical protein JCGZ_04090                       85.1    3e-15   
ref|XP_007016687.1|  Leucine-rich repeat (LRR) family protein iso...  81.6    3e-15   
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...  85.1    3e-15   
ref|XP_009112029.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    3e-15   
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.7    3e-15   
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.1    3e-15   
ref|XP_009120732.1|  PREDICTED: somatic embryogenesis receptor ki...  81.6    3e-15   
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g           85.5    3e-15   
ref|XP_007210869.1|  hypothetical protein PRUPE_ppa003168mg           84.7    3e-15   
ref|XP_008222077.1|  PREDICTED: probable inactive leucine-rich re...  85.1    3e-15   
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.7    3e-15   
ref|XP_002446972.1|  hypothetical protein SORBIDRAFT_06g026090        85.5    3e-15   
ref|XP_010550651.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    3e-15   
ref|XP_007225190.1|  hypothetical protein PRUPE_ppa002123mg           85.1    3e-15   
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211           84.7    3e-15   
gb|EAZ43742.1|  hypothetical protein OsJ_28366                        85.1    4e-15   
gb|EAZ08110.1|  hypothetical protein OsI_30375                        85.1    4e-15   
ref|XP_002975503.1|  hypothetical protein SELMODRAFT_103488           84.3    4e-15   
ref|XP_008647816.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  84.3    4e-15   
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.7    4e-15   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...  84.3    4e-15   
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    4e-15   
ref|XP_002978742.1|  hypothetical protein SELMODRAFT_109609           84.3    4e-15   
ref|XP_001768500.1|  predicted protein                                84.3    4e-15   
ref|XP_011072726.1|  PREDICTED: receptor-like protein kinase isof...  85.1    4e-15   
ref|XP_011072724.1|  PREDICTED: receptor-like protein kinase isof...  85.1    4e-15   
ref|NP_001062569.1|  Os09g0110100                                     84.7    4e-15   
ref|XP_002436858.1|  hypothetical protein SORBIDRAFT_10g010020        80.9    4e-15   
ref|XP_002981408.1|  leucine rich repeat receptor kinase              84.3    4e-15   
ref|XP_010904696.1|  PREDICTED: somatic embryogenesis receptor ki...  81.3    4e-15   
ref|XP_006494805.1|  PREDICTED: somatic embryogenesis receptor ki...  80.9    4e-15   
ref|XP_008377042.1|  PREDICTED: probable inactive leucine-rich re...  82.0    4e-15   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...  84.3    4e-15   
tpg|DAA47958.1|  TPA: putative leucine-rich repat protein kinase ...  83.6    5e-15   
ref|XP_009403261.1|  PREDICTED: probable inactive leucine-rich re...  84.3    5e-15   
gb|ACN30679.1|  unknown                                               84.3    5e-15   
ref|XP_009777835.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  81.3    5e-15   
ref|XP_010244265.1|  PREDICTED: probable LRR receptor-like serine...  84.7    5e-15   
ref|XP_002994468.1|  hypothetical protein SELMODRAFT_432388           81.6    5e-15   
ref|XP_011025617.1|  PREDICTED: somatic embryogenesis receptor ki...  81.3    5e-15   
gb|EYU37463.1|  hypothetical protein MIMGU_mgv1a003320mg              84.0    5e-15   
ref|XP_002969939.1|  hypothetical protein SELMODRAFT_93043            84.0    5e-15   
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  84.0    5e-15   
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    5e-15   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...  84.3    5e-15   
ref|XP_004145576.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    5e-15   
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...  84.7    5e-15   
gb|KJB11031.1|  hypothetical protein B456_001G237400                  84.3    5e-15   
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...  84.0    5e-15   
ref|XP_004964648.1|  PREDICTED: putative leucine-rich repeat rece...  84.7    5e-15   
gb|EMT02279.1|  Putative LRR receptor-like serine/threonine-prote...  84.7    6e-15   
ref|XP_010092461.1|  putative LRR receptor-like serine/threonine-...  84.7    6e-15   
emb|CDX92412.1|  BnaA10g14510D                                        80.9    6e-15   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  84.0    6e-15   
ref|XP_008238033.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    6e-15   
ref|XP_006854236.1|  hypothetical protein AMTR_s00048p00228530        84.0    6e-15   
emb|CDY16593.1|  BnaC09g36800D                                        80.9    6e-15   
gb|ACI95776.1|  PAN1                                                  84.0    6e-15   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  84.0    6e-15   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    6e-15   
gb|EPS72631.1|  hypothetical protein M569_02128                       84.0    6e-15   
emb|CDX87267.1|  BnaC09g05820D                                        84.0    6e-15   
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                      84.0    6e-15   
ref|XP_008646984.1|  PREDICTED: uncharacterized protein LOC100501...  84.0    6e-15   
dbj|BAB10839.1|  receptor-like protein kinase                         83.6    7e-15   
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  84.0    7e-15   
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  84.0    7e-15   
ref|XP_002305701.2|  FLAGELLIN-SENSITIVE 2 family protein             84.3    7e-15   
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010        84.0    7e-15   
ref|XP_011001223.1|  PREDICTED: receptor-like protein kinase HSL1     84.3    7e-15   
ref|XP_010265781.1|  PREDICTED: probable inactive leucine-rich re...  84.0    7e-15   
ref|XP_007023498.1|  Serine-threonine protein kinase, plant-type,...  84.0    7e-15   
ref|XP_010682678.1|  PREDICTED: somatic embryogenesis receptor ki...  80.5    7e-15   
ref|XP_011047703.1|  PREDICTED: receptor-like protein kinase HSL1     84.3    7e-15   
ref|XP_010276978.1|  PREDICTED: probable LRR receptor-like serine...  84.0    8e-15   
ref|XP_010276980.1|  PREDICTED: probable LRR receptor-like serine...  84.0    8e-15   
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      83.6    8e-15   
ref|XP_004173630.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.4    8e-15   
ref|XP_009395486.1|  PREDICTED: putative leucine-rich repeat rece...  84.0    8e-15   
gb|AFO67894.1|  leucine-rich repeat receptor-like kinase              83.6    8e-15   
ref|XP_009337700.1|  PREDICTED: probable LRR receptor-like serine...  84.0    8e-15   
ref|XP_001764577.1|  predicted protein                                83.2    9e-15   
emb|CDX93126.1|  BnaA03g38480D                                        83.6    9e-15   
ref|XP_010276982.1|  PREDICTED: probable LRR receptor-like serine...  83.6    9e-15   
ref|XP_007016686.1|  Leucine-rich repeat family protein isoform 1     80.9    9e-15   
ref|XP_008356494.1|  PREDICTED: probable inactive leucine-rich re...  82.8    9e-15   
emb|CDX70962.1|  BnaC03g10460D                                        80.1    9e-15   
gb|KJB39878.1|  hypothetical protein B456_007G035200                  83.2    9e-15   
ref|XP_007025532.1|  HAESA-like 1 isoform 1                           84.0    9e-15   
ref|XP_007025533.1|  HAESA-like 1 isoform 2                           84.0    9e-15   
ref|XP_007134648.1|  hypothetical protein PHAVU_010G064900g           83.6    9e-15   
ref|XP_009380996.1|  PREDICTED: somatic embryogenesis receptor ki...  83.2    1e-14   
ref|XP_010692604.1|  PREDICTED: somatic embryogenesis receptor ki...  83.2    1e-14   
gb|AIJ28963.1|  somatic embryogenesis receptor-like kinase            83.2    1e-14   
ref|XP_008437655.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    1e-14   
ref|XP_004300401.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    1e-14   
ref|XP_009136223.1|  PREDICTED: somatic embryogenesis receptor ki...  83.2    1e-14   
ref|XP_006339232.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  80.1    1e-14   
ref|XP_002978660.1|  hypothetical protein SELMODRAFT_109190           83.2    1e-14   
ref|XP_002309372.1|  leucine-rich repeat family protein               83.2    1e-14   
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      83.2    1e-14   
ref|XP_006493856.1|  PREDICTED: somatic embryogenesis receptor ki...  83.2    1e-14   
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...  82.8    1e-14   



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +3

Query  228  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  407
            +G  G E+LQLNDDVLGLIV KSG QDP   L +W+EDD+SPCAW F+KC+P N RVSEV
Sbjct  22   TGCFGGETLQLNDDVLGLIVLKSGFQDPFKSLDSWNEDDESPCAWKFIKCNPGNNRVSEV  81

Query  408  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  587
             L GLGLSGKIGRGLEKL+ L VLSL+SNN +G I P+L L+ NL+ LNLSKNS+SG VP
Sbjct  82   SLDGLGLSGKIGRGLEKLQSLKVLSLSSNNLTGSIIPELALIPNLERLNLSKNSLSGNVP  141

Query  588  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
             SL ++SSLQFLDLS NSLSGP+ D M +N  SLR+LS AG+
Sbjct  142  SSLSDVSSLQFLDLSQNSLSGPLPDDMFQNCFSLRYLSFAGN  183


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +S +D     L G + + L++L  L  LSLA+N  +G     +G +++L+ L+ S N ++
Sbjct  273  LSRLDFSNNLLIGPVPQSLQRLNALKFLSLANNFLTGDFPQWIGQMSSLEYLDFSNNGLT  332

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G++P S+G++ SL+FL LS N LSG +  ++ E + SL  + L G++F
Sbjct  333  GSLPTSMGDLKSLKFLSLSNNKLSGSIPTTIAE-ISSLSLVRLRGNTF  379



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +3

Query  240  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  419
              +SL LNDDVLGLIVFKS + DP SHL +WSEDD SPCAW FVKC+P NGRVSEV L G
Sbjct  35   AEDSLPLNDDVLGLIVFKSAIYDPFSHLESWSEDDSSPCAWEFVKCNPRNGRVSEVSLDG  94

Query  420  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  599
            LGLSGK+GRGLEKL+ L VLSL++NN +G ISP+  L+T L+ LNLS+N++ G +P S+ 
Sbjct  95   LGLSGKMGRGLEKLQDLKVLSLSNNNLTGSISPEFALITGLERLNLSQNNLRGNIPSSVA  154

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            NMSS+QFLDLS N LSGP+SD + EN  SLRF+SLAG+
Sbjct  155  NMSSIQFLDLSENLLSGPISDDIFENCQSLRFISLAGN  192



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  231  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  410
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLADETLQLNDDVLGLIVFKSALLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  411  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  590
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N +SG +P 
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQNGLSGNIPA  143

Query  591  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGS  713
            S+  M+SLQFLDLS NSLSGPVSD++ +N G SLR+LSL+G+
Sbjct  144  SISKMTSLQFLDLSENSLSGPVSDTIFDNCGNSLRYLSLSGN  185


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  250  QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  309

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +G  P  + NMSSL++LD SGNSL G + DS + +L  L++LSL+G+  
Sbjct  310  NGDFPQWISNMSSLEYLDFSGNSLEGSLPDS-IGDLKMLKYLSLSGNKL  357



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   197 bits (500),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  231  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  410
            G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLAGETLQLNDDVLGLIVFKSTLLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  411  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  590
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LNLS+N ++G +P 
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELALLTNLENLNLSQNGLTGNIPP  143

Query  591  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGS  713
            S+  ++SLQFLDLS NSLSGPVSD+M +N G SLR+LSL+G+
Sbjct  144  SISKITSLQFLDLSQNSLSGPVSDTMFDNCGNSLRYLSLSGN  185


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 65/109 (60%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            ++ E+ L G   SGK+   +    HLN L L+ N F+G I   +  L  L  L+LS N I
Sbjct  250  QLKELLLQGNQFSGKLPSDIGYCPHLNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMI  309

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +G  P  + NMSSL++LD SGNS+ G + DS + +L  L++LSL+G+  
Sbjct  310  NGDFPQWISNMSSLEYLDFSGNSIEGTLPDS-IGDLKMLKYLSLSGNKL  357


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            ++++DL     +G I   ++KL  L+ LSL++N  +G     +  +++L+ L+ S NSI 
Sbjct  275  LNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMINGDFPQWISNMSSLEYLDFSGNSIE  334

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  671
            GT+PDS+G++  L++L LSGN LSG +  SM+
Sbjct  335  GTLPDSIGDLKMLKYLSLSGNKLSGKIPKSMV  366



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVTELNLNGLSL  86

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S  NM+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSNMT  146

Query  609  SLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGS  713
            SLQFLDLS N+LSGPVSD+M +N G SLR+LSL+G+
Sbjct  147  SLQFLDLSENALSGPVSDTMFDNCGDSLRYLSLSGN  182


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 65/109 (60%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            ++ E  L G   SG +   +    HLN L L++N F+G I   L  +  L  L+LS N I
Sbjct  247  QLKECLLQGNHFSGDLPADIGFCPHLNRLDLSNNQFTGQIPMSLQRVNVLSFLSLSNNMI  306

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +G  P  + NMSSL++LDLSGNSL G + DS + +L  L++LSL+G+  
Sbjct  307  NGDFPQWISNMSSLEYLDLSGNSLEGALPDS-IGDLKMLKYLSLSGNKL  354


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            ++ +DL     +G+I   L+++  L+ LSL++N  +G     +  +++L+ L+LS NS+ 
Sbjct  272  LNRLDLSNNQFTGQIPMSLQRVNVLSFLSLSNNMINGDFPQWISNMSSLEYLDLSGNSLE  331

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  671
            G +PDS+G++  L++L LSGN LSG +  SM+
Sbjct  332  GALPDSIGDLKMLKYLSLSGNKLSGNIPKSMV  363



>ref|XP_006840189.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            SLQLNDDVLGLIVFK+G+QDP S L++WSEDDDSPC WNFV+C   +GRV+EV L GL L
Sbjct  33   SLQLNDDVLGLIVFKAGIQDPTSSLSSWSEDDDSPCHWNFVQCDRNSGRVTEVSLDGLSL  92

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SGKIGRGLEKL++L  LSL++NNFSG I+P+L  + +L+ LNLS+NS+SG++P SLGNMS
Sbjct  93   SGKIGRGLEKLQNLQALSLSNNNFSGTINPELARIESLRRLNLSRNSLSGSIPPSLGNMS  152

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            S+Q LD S NSLSG + D +  N  SLRF++L G+SF
Sbjct  153  SIQVLDFSENSLSGTIPDYVFNNCFSLRFVNLGGNSF  189



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   194 bits (493),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 149/186 (80%), Gaps = 1/186 (1%)
 Frame = +3

Query  165  IYIMGFRsmlllvflsvlsvTSGAGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSED  341
            + +MGFR +++ + LS+  +    G  + S+QLNDDVLGLIVFKS ++DP+S+L +W+ED
Sbjct  4    MVVMGFRQLVVFLLLSMAVLHGCMGNDDASIQLNDDVLGLIVFKSDIKDPSSYLDSWNED  63

Query  342  DDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq  521
            D+SPC+W F++C+P NGRVSEV L+GLGLSGKIG+GL+KL++L VLSL+ NNFSG ISP+
Sbjct  64   DNSPCSWRFIQCNPVNGRVSEVSLNGLGLSGKIGKGLQKLQYLKVLSLSHNNFSGSISPE  123

Query  522  lglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLS  701
            LGL+ +L+ LNLS NS+SG +P S  NM+S++FLDLSGNSLSG V D + +   SLR+LS
Sbjct  124  LGLIGSLERLNLSHNSLSGRIPSSFVNMNSIRFLDLSGNSLSGSVPDDLFQTCSSLRYLS  183

Query  702  LAGSSF  719
            LA +S 
Sbjct  184  LAENSL  189



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVNELNLNGLSL  86

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S   M+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSKMT  146

Query  609  SLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGS  713
            SLQFLDLS N+LSGPVSD+M +N   SLR+LSL+G+
Sbjct  147  SLQFLDLSENALSGPVSDTMFDNCSDSLRYLSLSGN  182


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 65/109 (60%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            ++ E  L G   SG +   +    HLN L L++N F+G I   L  +  L  L+LS N I
Sbjct  247  QLKECLLQGNHFSGDLPADIGYCPHLNRLDLSNNQFTGQIPMSLQKVNALSFLSLSNNMI  306

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +G  P  + NMSSL++LDLSGNSL G + DS + +L  L++LSL+G+  
Sbjct  307  NGDFPQWISNMSSLEYLDLSGNSLEGALPDS-IGDLKMLKYLSLSGNKL  354


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            ++ +DL     +G+I   L+K+  L+ LSL++N  +G     +  +++L+ L+LS NS+ 
Sbjct  272  LNRLDLSNNQFTGQIPMSLQKVNALSFLSLSNNMINGDFPQWISNMSSLEYLDLSGNSLE  331

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  671
            G +PDS+G++  L++L LSGN LSG +  SM+
Sbjct  332  GALPDSIGDLKMLKYLSLSGNKLSGNIPKSMV  363



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            ++QLNDDVLGLIVFKS + DP+S L++WSEDDDSPC+W F++C+ ANGRVS V L GLGL
Sbjct  27   TIQLNDDVLGLIVFKSDLVDPSSTLSSWSEDDDSPCSWKFIECNSANGRVSHVSLDGLGL  86

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SGK+G+GL+KL+HL VLSL+ NNFSG ISP L L+ +L++LNLS NS+SG +P S  NM+
Sbjct  87   SGKLGKGLQKLQHLKVLSLSHNNFSGEISPDLPLIPSLESLNLSHNSLSGLIPSSFVNMT  146

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +++FLDLS NSLSGP+ D++ +N  SLR++SLAG+S 
Sbjct  147  TVRFLDLSENSLSGPLPDNLFQNCLSLRYISLAGNSL  183



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            S QLNDD+LGLIVFKS + DP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGL
Sbjct  29   SPQLNDDILGLIVFKSDLHDPSSALSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGL  88

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SG+IGRGLEKL+HL VLSL+ NNF+G ++PQL L  +L  +N S+NS+SG +P SL +MS
Sbjct  89   SGRIGRGLEKLQHLKVLSLSGNNFTGNLNPQLALPPSLDRVNFSRNSLSGRIPVSLISMS  148

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            S++FLD S N LSGP+ D M  N  SL +LSLA + F
Sbjct  149  SVRFLDFSDNLLSGPLPDEMFVNCSSLHYLSLASNMF  185



>emb|CBI39439.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  8    IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  67

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  68   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  127

Query  612  LQFLDLSGNSLSGPVSDSMLEN  677
            ++FLDLS NSL+GP+ D M EN
Sbjct  128  IRFLDLSHNSLAGPIPDEMFEN  149



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G A S QLNDDVLGLIVFK+ + DP+SHL +W+EDD SPC+W ++KC+PA GRVSE+ L 
Sbjct  23   GDAGSFQLNDDVLGLIVFKADINDPSSHLESWNEDDYSPCSWKYIKCNPATGRVSEISLD  82

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GLGLSGKIGRG++KL+HL VLSL+ NNF+G I PQ+GL+T LQ LNLS N +SG +P SL
Sbjct  83   GLGLSGKIGRGVQKLQHLKVLSLSDNNFTGNIIPQIGLITGLQKLNLSHNRLSGIIPSSL  142

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G++SSL+FLDLS NSLSG + D    N   LR+LSLA
Sbjct  143  GSISSLKFLDLSENSLSGTIPDDFFRNNSPLRYLSLA  179



>ref|XP_004156987.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040-like [Cucumis 
sativus]
Length=1007

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L  +L  +N S NS+SG +P SL +MSS+
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVLPPSLDRVNFSGNSLSGRIPVSLISMSSI  150

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +FLD S N LSGP+ D M  N  SL +LSLA
Sbjct  151  RFLDFSDNLLSGPLPDEMFVNCSSLHYLSLA  181



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L  +L  +N S NS+SG +P SL +MSS+
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVLPPSLDRVNFSGNSLSGRIPVSLISMSSI  150

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +FLD S N LSGP+ D M  N  SL +LSLA
Sbjct  151  RFLDFSDNLLSGPLPDEMFVNCSSLHYLSLA  181



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +3

Query  231  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  410
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  28   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  87

Query  411  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  590
            L GLGLSGKIG+GL+KLE+L VLSL+ NNFSG+I    G+L +L+ L+LS N++SG++P 
Sbjct  88   LDGLGLSGKIGKGLQKLEYLKVLSLSRNNFSGIIGRAFGVLNSLERLDLSYNNLSGSIPS  147

Query  591  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +  NM+S++FLDLS NSLSG + + + +   SLRFLSL+ +SF
Sbjct  148  TFVNMNSIRFLDLSRNSLSGSIPEELFQTCSSLRFLSLSENSF  190



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  34   IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  93

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  94   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  153

Query  612  LQFLDLSGNSLSGPVSDSMLEN  677
            ++FLDLS NSL+GP+ D M EN
Sbjct  154  IRFLDLSHNSLAGPIPDEMFEN  175



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  231  GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  410
            G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  29   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  88

Query  411  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  590
            L GLGLSGKIG+GL+KL +L VLSL+ N+FSG I    G+L +L+ L+LS N++SG++P 
Sbjct  89   LDGLGLSGKIGKGLQKLMYLKVLSLSRNDFSGTIGRAFGVLNSLERLDLSYNNLSGSIPS  148

Query  591  SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +  NM+S++FLDLSGNSLSG + + + +   SLRFLSL+ +SF
Sbjct  149  TFVNMNSIRFLDLSGNSLSGSIPEELFQTCSSLRFLSLSENSF  191



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   183 bits (465),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++FLDLS NS SGP+ +S  E+  SL  +SLA + F
Sbjct  151  IKFLDLSENSFSGPMPESFFESCSSLHHISLARNMF  186



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   183 bits (464),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++FLDLS NS SGP+ +S  E+  SL  +SLA + F
Sbjct  151  IKFLDLSENSFSGPMPESFFESCSSLHHISLARNMF  186



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   182 bits (463),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++FLDLS NS SGPV +S  E+  SL  +SLA + F
Sbjct  151  IRFLDLSENSFSGPVPESFFESCSSLHHISLARNIF  186



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++FLDLS NS SGPV +S  E+  SL  +SLA + F
Sbjct  151  IRFLDLSENSFSGPVPESFFESCSSLHHISLARNIF  186



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            SLQLNDDVLGLIVFK+ + DP+S L +W+EDD++PC+W +V+C P++GRV+E+ L GLGL
Sbjct  32   SLQLNDDVLGLIVFKTDLHDPSSLLGSWNEDDNTPCSWKYVRCDPSSGRVTELSLDGLGL  91

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SGKIGRGLEKL++L VLSL+ NNF+G ISP+L L+ +L TLNLS NS+SG +P  LGNMS
Sbjct  92   SGKIGRGLEKLQNLQVLSLSHNNFTGDISPELSLIGSLTTLNLSHNSLSGRIPVELGNMS  151

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +L+FLDLS NSLSGP+ D + +N  SL F S A
Sbjct  152  ALRFLDLSENSLSGPLPDGLFQNCFSLHFFSSA  184



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            QLNDDVLGLIVFKS +QDP+SHLA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLSG
Sbjct  43   QLNDDVLGLIVFKSDLQDPSSHLASWNEDDVNPCSWQFVQCNPESGRVSEVSLDGLGLSG  102

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
            KIGRGLEKL+HL VLSL+ NN SG ISP L L   LQ LNLS N++SG++P S  NM+S+
Sbjct  103  KIGRGLEKLQHLTVLSLSHNNLSGGISPSLTLSNTLQRLNLSHNALSGSIPTSFVNMNSI  162

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +FLDLS NS SG + ++  +   SL  +SLA + F
Sbjct  163  KFLDLSENSFSGSIPETFFDTCSSLHHISLARNMF  197



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            QLN+DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLKG  91

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNSISGTVPDSLGNMSS  611
            KIG+GL+ L++L VLSL+SNNFSG ISP+   L  NL+ LNLS NS+SG +P +L NMSS
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPPNLEKLNLSHNSLSGLIPTNLFNMSS  151

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+
Sbjct  152  IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGN  185



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 144/183 (79%), Gaps = 2/183 (1%)
 Frame = +3

Query  171  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  344
            +MG+  +LL + +SV+    G  G++S  +Q+NDDV GLIVFK+ + DP S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSVVVSLKGCMGSDSGPIQMNDDVFGLIVFKADLIDPFSYLSSWNEDD  65

Query  345  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  524
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISHEL  125

Query  525  glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSL  704
            G L+NL+ LNLS NSISG +P  L NMSS++FLDLS NS SGP+ D++  N  SLR+LSL
Sbjct  126  GFLSNLERLNLSHNSISGLIPSFLDNMSSIKFLDLSENSFSGPLPDNLFRNSQSLRYLSL  185

Query  705  AGS  713
            AG+
Sbjct  186  AGN  188


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            + E+ L G   SG +   +    HLN L L+ N FSGV+   L  L+++   +LSKN ++
Sbjct  254  LKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGVLPESLRRLSSMSFFSLSKNMLA  313

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G  P  +G++++L++LDLS N+L+G +  S + +L SLR+LSL+ +  
Sbjct  314  GEFPRWIGSLTNLEYLDLSSNALTGSIPSS-IGDLKSLRYLSLSNNKL  360



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 145/183 (79%), Gaps = 2/183 (1%)
 Frame = +3

Query  171  IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  344
            +MG+  +LL + +S++    G  G++S  +Q+NDDV GLIVFK+ + DP+S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSIVVSLEGCMGSDSVPIQINDDVFGLIVFKADLIDPSSYLSSWNEDD  65

Query  345  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  524
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISLEL  125

Query  525  glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSL  704
            G L+NL+ LNLS NS+SG +P  L NMSS++FLDLS NS SGP+ D++  N  SLR+LSL
Sbjct  126  GFLSNLERLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPLPDNLFRNSHSLRYLSL  185

Query  705  AGS  713
            AG+
Sbjct  186  AGN  188


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            + E+ L G   SG +   +    HLN L L+ N FSG +   L  L+++   +LSKN ++
Sbjct  254  LKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGALPESLQRLSSMSLFSLSKNMLA  313

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G  P  +G++++L++LDLS N+L+G +  S + +L SLR+LSL+ +  
Sbjct  314  GEFPRWIGSLTNLEYLDLSSNALTGSIPSS-IGDLKSLRYLSLSNNKL  360



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   180 bits (457),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = +3

Query  174  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  347
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS ++DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLRDPSSYLSSWNEDDD  60

Query  348  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  527
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  528  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            L+++L++LNLS NS+SG +P  L NMSS++FLDLS NS SGP+ D +  N  SLR+LSLA
Sbjct  121  LISSLESLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPLPDDLFRNSFSLRYLSLA  180

Query  708  GS  713
            G+
Sbjct  181  GN  182


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            + E+ L G   SG +   +    HLN L  +SN FSG +   L  L+++   + SKN ++
Sbjct  248  LKELQLQGNRFSGPLPVDIGLCPHLNRLDFSSNLFSGALPESLQRLSSINYFSSSKNMLT  307

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G  P  +G++S+L++LDLS N+L+G +S S + +L SLR+LSL+
Sbjct  308  GEFPRWIGSLSNLEYLDLSSNALTGSISSS-IGDLKSLRYLSLS  350



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = +3

Query  174  MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  347
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS + DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLSDPSSYLSSWNEDDD  60

Query  348  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  527
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  528  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            L+++L++LNLS NS+SG +P  L NMSSL+FLDLS NS +GP+ D +  N  SLR+LSLA
Sbjct  121  LISSLESLNLSHNSLSGLIPSFLDNMSSLKFLDLSENSFTGPLPDDLFRNSFSLRYLSLA  180

Query  708  GS  713
            G+
Sbjct  181  GN  182


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            + E+ L G   SG +   +    HLN L L+SN FSG +   L  L+++   +LSKN ++
Sbjct  248  LKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLT  307

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G  P  +G++S+L++LDLS N+L+G +S S + +L SLR+LSL+ +  
Sbjct  308  GEFPRWIGSLSNLEYLDLSSNALTGSISSS-IGDLKSLRYLSLSNNKL  354



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            QLN DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNSDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLRG  91

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNSISGTVPDSLGNMSS  611
            KIG+GL+ L++L VLSL+SNNFSG ISP+   L +NL+ LNLS NS+SG +P +L NMSS
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPSNLEKLNLSHNSLSGIIPTNLFNMSS  151

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+
Sbjct  152  IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGN  185



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +3

Query  234  AGGAES-LQLNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  407
            AGGA + LQLNDDVLGLIVFKSG   DP   L +W+EDDDSPCAW FVKC+  N RVSEV
Sbjct  22   AGGATTTLQLNDDVLGLIVFKSGFHSDPLKSLDSWNEDDDSPCAWRFVKCNAGNSRVSEV  81

Query  408  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  587
             L GL LSGKIGRGLEKL+ L VLSL++NN +G ++P L L+ NL+ LNLS+NS+SG VP
Sbjct  82   SLDGLSLSGKIGRGLEKLQSLKVLSLSNNNLTGAVNPGLALIPNLERLNLSRNSLSGDVP  141

Query  588  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSL  704
             S  + SSLQFLDLS N LSGP+ D++ +N  SLR  +L
Sbjct  142  SSFSDASSLQFLDLSQNLLSGPLPDNIFQNCSSLRLRTL  180


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASN----NFSGVISPqlglltnlqtlnlSK  563
            +S +D      +G I   L+KL  LN L+L+ N    +F   I  Q       + ++ S 
Sbjct  225  LSRIDFSNNLFTGTIPASLQKLNSLNFLNLSFNFLTGDFPQWIGSQTTTAAAFEYIDFSN  284

Query  564  NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            N+++GT+P ++G++ SL+FL LS N LSGP+ +S L  L SL  + L G++F
Sbjct  285  NALTGTLPATIGDLKSLKFLSLSENKLSGPLPNS-LSGLASLSVIRLKGNAF  335



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   177 bits (449),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPVNGRVSHVSLDGLGL  99

Query  429  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  599
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            NM +++FLDLS N LSGPV   + EN  SLR+LSLAG+
Sbjct  160  NMMNMKFLDLSNNLLSGPVPYQLFENCASLRYLSLAGN  197



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPINGRVSHVSLDGLGL  99

Query  429  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  599
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            NM +++FLDLS N LSGPV   + EN  SLR+LSLAG+
Sbjct  160  NMMNMKFLDLSNNLLSGPVPYQLFENCASLRYLSLAGN  197



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            ++QLNDDVLGLIVFKS +QDP+SHL++W+EDDD+PC+W FV+C+P   RVSE+ L  LGL
Sbjct  34   AVQLNDDVLGLIVFKSDIQDPSSHLSSWNEDDDTPCSWKFVRCNPVTNRVSEISLDNLGL  93

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgl--ltnlqtlnlSKNSISGTVPDSLGN  602
            SG+IG+GLEKL+HL  LSL+ NNFSG ++P+       +L+ LNLS+N +SG +P SL  
Sbjct  94   SGRIGKGLEKLQHLKALSLSGNNFSGDVTPEKLALPTNSLEILNLSRNRLSGRIPSSLVK  153

Query  603  MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            MS ++ LDLS N LSGPV D++ ++  SL  LSLAG+S 
Sbjct  154  MSLIRVLDLSENLLSGPVPDNLFDSCFSLHSLSLAGNSL  192



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            S+QLNDDVLGLIVFKS +QDP+SHL++W+EDD+SPC+W++VKC+P   RV+E+ L+GL L
Sbjct  30   SIQLNDDVLGLIVFKSDLQDPSSHLSSWNEDDNSPCSWSYVKCNPKTSRVTELSLNGLSL  89

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            +GKIGRG++KL+HL VLSL++NNF+G I   L    NL+ L+LS N++SG++P S G++S
Sbjct  90   TGKIGRGIQKLQHLKVLSLSNNNFTGNII-ALSKNNNLKKLDLSNNNLSGSIP-SFGSIS  147

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            SLQ+LDL+GNS SG +SD    N  SLRFLSL+ ++ 
Sbjct  148  SLQYLDLTGNSFSGTLSDEFFNNCSSLRFLSLSQNNL  184



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GL L+GKIGRG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G++SSLQ LDL+GNS SG +SD    N  SLR+LSL+
Sbjct  146  GSISSLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLS  182



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G   S QLNDDVLGLIVFKS + DP+S L +WSEDD SPC+W +V+C P  GRV++V L 
Sbjct  32   GDDVSAQLNDDVLGLIVFKSDLTDPSSSLVSWSEDDASPCSWRYVQCDPLTGRVAQVSLD  91

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GLGLSGKIGRGLEKL+ L VLSL+ NNF+G ISPQL L + LQ LNLS+N +SG  P SL
Sbjct  92   GLGLSGKIGRGLEKLDRLKVLSLSRNNFTGSISPQLSLPSGLQRLNLSRNGLSGPFPTSL  151

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
             N+SS++FLDLS NS SGP+ D +  +  SL F+S AG+
Sbjct  152  VNVSSIRFLDLSENSFSGPLPDGLFGSCSSLHFISFAGN  190


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            + E+ L G   +G++   +    HL  L  + N  +G +   L  L +L +L+L+ N ++
Sbjct  256  LKELRLGGNHFAGQLPADVGLCPHLTALDFSDNLLTGALPASLQYLYSLVSLSLANNMLT  315

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G  P+ +G ++SLQ+LD SGN  +G +  S+  NL SLR+LSL+G+  
Sbjct  316  GDFPNWIGKITSLQYLDFSGNKFTGSIPTSV-GNLQSLRYLSLSGNEL  362



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +3

Query  225  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  404
            T  A    ++QLNDDVLGLIVFKS +QDP+S+L++W+EDD +PC+W +VKC+P   RVSE
Sbjct  52   TCFANNDVTIQLNDDVLGLIVFKSDLQDPSSYLSSWNEDDINPCSWQYVKCNPQTQRVSE  111

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            + L GLGLSGK+GR LEKL+HL  LSL+ NNFSG ISP L L   LQ LNLS NS SG +
Sbjct  112  LSLDGLGLSGKLGRSLEKLQHLVTLSLSHNNFSGTISPSLTLSNTLQKLNLSHNSFSGPL  171

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P S  NMSS++F+DLS NS +G + D   EN  SLR +SL+ + F
Sbjct  172  PLSFVNMSSIRFIDLSHNSFAGQMPDGFFENCFSLRRVSLSMNLF  216



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G  +++QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDTIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G++SSLQ LDL+GNS +G +SD    N  SLR+LSL+
Sbjct  146  GSISSLQHLDLTGNSFTGTLSDDFFNNCSSLRYLSLS  182



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   172 bits (435),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 126/155 (81%), Gaps = 1/155 (1%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            +QLN DVLGL+VFKS + DP+S+L++W+EDDDSPC+WNF++C+P+ GRVS+++L GLGL 
Sbjct  26   VQLNYDVLGLLVFKSDLHDPSSYLSSWNEDDDSPCSWNFIQCNPSTGRVSQLNLDGLGLK  85

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNSISGTVPDSLGNMS  608
            GK G+GL+ L+HL VLSL+ NNF+G +SP+   L  +LQTLNLS+NS SG VP +L N S
Sbjct  86   GKPGKGLQNLQHLKVLSLSGNNFTGELSPEKLALPPSLQTLNLSRNSFSGLVPTTLVNFS  145

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            S++FLDLS NSLSG + DS+     SLR+LSL+G+
Sbjct  146  SIRFLDLSQNSLSGSLPDSLFGACSSLRYLSLSGN  180


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            + E+D   +GL+G I  G  KL E L +L L+ NN  G I  ++GL +NL+ LN S N++
Sbjct  389  LEEIDFSNMGLTGSIPPGSSKLFESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNFSWNNL  448

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
               +P  LG  S+L  LDL  ++LSGP+   + ++ GSL  L L G+S 
Sbjct  449  QSRIPPELGFFSNLTVLDLRNSALSGPIPGEICDS-GSLDILQLDGNSL  496



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   171 bits (434),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GL L+GKI RG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +  SL
Sbjct  87   GLALTGKINRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQILSSL  145

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G+M+SLQ LDL+GNS SG +SD    N  SLRFLSL+
Sbjct  146  GSMTSLQHLDLTGNSFSGTLSDDFFNNCSSLRFLSLS  182



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = +3

Query  246  ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  425
            +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV+E+ L+GL 
Sbjct  29   DSIQLNDDVLGLIVFKSDLNDPFSHLQSWNEDDNTPCSWSYVKCNPKTSRVTELSLNGLA  88

Query  426  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  605
            L+GKI RG++KL+ L VLSL++NNF+G I+  L    NLQ L+LS N++SG +P SLG++
Sbjct  89   LTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSTNNNLQKLDLSHNNLSGQIPSSLGSI  147

Query  606  SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            SSLQ LDL+GNS SG +SD    N  SLR+LSL+
Sbjct  148  SSLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLS  181



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G  +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV E+ L 
Sbjct  26   GDTDSIQLNDDVLGLIVFKSDLNDPFSHLESWTEDDNTPCSWSYVKCNPKTSRVIELSLD  85

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GL L+GKI RG++KL+ L VLSL++NNF+G I+  L    +LQ L+LS N++SG +P SL
Sbjct  86   GLALTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSNNNHLQKLDLSHNNLSGQIPSSL  144

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G+++SLQ LDL+GNS SG +SD +  N  SLR+LSL+
Sbjct  145  GSITSLQHLDLTGNSFSGTLSDDLFNNCSSLRYLSLS  181



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   169 bits (427),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G   S ++LDL+GNS SG +SD +  N  SL +LSL+ + F
Sbjct  144  G---STKYLDLTGNSFSGTLSDDLFTNCSSLTYLSLSHNRF  181



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 123/161 (76%), Gaps = 4/161 (2%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G   S+++LDL+GNS SG +S+ +  N  SL +LSL+ + F
Sbjct  144  G---SIKYLDLTGNSFSGTLSNDLFTNCSSLTYLSLSHNRF  181



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 121/152 (80%), Gaps = 3/152 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFKS V D  + LA+W+EDD+SPCAW FV+C P +GRV+ V L G+GLSGKI
Sbjct  2    NDDVLGLIVFKSAVVDARNRLASWNEDDESPCAWRFVECDPGSGRVTAVSLDGVGLSGKI  61

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGLEKL++L  LSL+ NNFSG +SP+L LL NLQ LNLS N ++G++P S+  +S LQF
Sbjct  62   GRGLEKLQYLRTLSLSGNNFSGSVSPELLLLPNLQKLNLSGNGLAGSLPPSV--VSKLQF  119

Query  621  LDLSGNSLSGPVSDSM-LENLGSLRFLSLAGS  713
            LDLSGN+LSGP+ D+  + N  SLR LSLAG+
Sbjct  120  LDLSGNALSGPLPDTTFVNNCSSLRHLSLAGN  151


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  390  GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  569
             R+  VDL G  LSG I  G+  +  L  LSL  N FSG +   +G   +L  L+LSKN 
Sbjct  191  ARLRTVDLSGNLLSGSIPGGISVVRSLKQLSLHGNQFSGPLPEDIGFCPHLTHLDLSKNQ  250

Query  570  ISGTVPDSLGNM-SSLQFLDLSGNSLSG  650
             +GT+P+SL N+ ++LQ LDLS N L+G
Sbjct  251  FTGTIPESLQNLTTTLQHLDLSNNFLTG  278


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DLH  G +G I   +     LN+L L  N+ +G I  ++G  ++L  L LS N++SGT+
Sbjct  440  LDLHAGGFTGSIPGDICDSGSLNILQLDGNSLTGAIPDEIGNCSSLHQLGLSNNNLSGTI  499

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSM--LENL  680
            P+SL  +S L+ L+L  N LSG +   +  LENL
Sbjct  500  PESLSRLSKLEVLELEMNQLSGEIPQRLADLENL  533



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 128/158 (81%), Gaps = 1/158 (1%)
 Frame = +3

Query  237  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  413
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
             GL LSGKIGRG++KL++L VLSL+ N+F+G + P++GLL+NLQ LNLS+N +SG +P S
Sbjct  84   DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGNVIPEIGLLSNLQNLNLSQNRLSGIIPAS  143

Query  594  LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            LG++SSL+FLDLS NS SG + D  L N  SLR+LSLA
Sbjct  144  LGSISSLKFLDLSKNSFSGSLPDDFLTNCSSLRYLSLA  181


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            + E++L G   SG +   +    HLN L L+ N FSG +      L +L  L+LS N +S
Sbjct  249  LKELNLQGNQFSGSLPADVGSCPHLNRLDLSYNLFSGEVPSAFQRLNSLMFLSLSHNLLS  308

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G  P  +G + SL+ LDLS N+L+G +  SM  NL SL+FL L+ +  
Sbjct  309  GDFPRWIGTLRSLEHLDLSNNALTGELPSSM-GNLRSLKFLVLSNNQL  355



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G  +S QLNDDVLGLIVFKS + DP+SHL++W+EDD SPC+W +VKC+P   RV+E+ L 
Sbjct  25   GDLDSTQLNDDVLGLIVFKSDLHDPSSHLSSWNEDDISPCSWTYVKCNPKTSRVTELSLS  84

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GL L+GKIGRG++KL+HL VLSL++NN +G I+  L     LQ L+LS NS+SG +P SL
Sbjct  85   GLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALSNNNRLQKLDLSHNSLSGQIPSSL  143

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
               +SL+ LDL+GNS SG +SD +  N  SLR LSL+ + F
Sbjct  144  ---TSLRHLDLTGNSFSGTLSDDVFTNCSSLRHLSLSRNRF  181



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDDDSPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDDSPCSWSYVKCNPKTSRVTELSLD  84

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GL L+GKIGRG++KL+HL VLSL++NNF+G I   L    +LQ L+LS N++SG +P SL
Sbjct  85   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGSII-DLSNNNDLQKLDLSHNNLSGQIPSSL  143

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G+ SSL++LDL+GNS SG +SD    N  SLR LSL+
Sbjct  144  GSRSSLRYLDLTGNSFSGRLSDDFFNNCSSLRHLSLS  180



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 113/157 (72%), Gaps = 0/157 (0%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            ++QLNDDVLGLI+FKS + DP SHL++W+EDD +PC+W ++KC+P N RV EV L GL L
Sbjct  33   AIQLNDDVLGLILFKSDLHDPFSHLSSWNEDDANPCSWQYIKCNPQNTRVIEVSLDGLSL  92

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SGK+GRG EKL+HL  LSL+ NN SG ISP L L   LQ LNLS NS  G +P S  NMS
Sbjct  93   SGKLGRGFEKLQHLVSLSLSHNNLSGNISPFLTLSNTLQKLNLSHNSFHGEIPISFINMS  152

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            S++ LDLS NS +G + ++  EN   L  LSLA + F
Sbjct  153  SIRLLDLSHNSFNGQIHETFFENCFMLHQLSLARNLF  189



>gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +3

Query  228  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  407
            + A     ++LNDDVLGLIVFK  + DP S L +W+EDDDSPC+W F+ C+P  GRVS V
Sbjct  22   AKANDEVPIKLNDDVLGLIVFKYDLIDPFSSLTSWNEDDDSPCSWKFISCNPVTGRVSHV  81

Query  408  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  587
             L  L LSGK+ +GL+KL+HL VLSL+ NNFSG I     ++  L+ LNLS NS+SG +P
Sbjct  82   LLDNLSLSGKLSKGLQKLQHLEVLSLSYNNFSGEIITDFPVIPTLENLNLSHNSLSGQLP  141

Query  588  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             S+  M+S++FLDLS NSLSGP+ D++ +N  SLR+LSLA +S 
Sbjct  142  LSV--MTSIKFLDLSYNSLSGPLPDNLFQNCLSLRYLSLASNSL  183



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFNGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G++SSLQ LDL+GNS SG +SD    N  SLR+LSL+
Sbjct  146  GSISSLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLS  182



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   157 bits (398),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 118/157 (75%), Gaps = 4/157 (3%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+++ L 
Sbjct  25   GDNNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTDLSLS  84

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            GLGL+G IGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85   GLGLTGTIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQRLDLSHNNLSGTIPFSL  143

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G   S + LDL+GNS SG +S+ +  N  SL +LSL+
Sbjct  144  G---SAKHLDLTGNSFSGSLSNDLFTNCSSLTYLSLS  177



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   157 bits (397),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 109/158 (69%), Gaps = 25/158 (16%)
 Frame = +3

Query  237  GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  413
            G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24   GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
             GL LSGKIGRG++KL++L VLSL+ N+F+G+I                        P S
Sbjct  84   DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGII------------------------PAS  119

Query  594  LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            LG++SSL+FLDLS NS SG + D  L N  SLR+LSLA
Sbjct  120  LGSISSLKFLDLSKNSFSGSLPDDFLTNCSSLRYLSLA  157


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            + E++L G   SG +   +    HLN L L+ N FSG +      L +L  L+LS N +S
Sbjct  225  LKELNLQGNQFSGSLPADVGSCPHLNRLDLSYNLFSGEVPSAFQRLNSLMFLSLSHNLLS  284

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G  P  +G + SL+ LDLS N+L+G +  SM  NL SL+FL L+ +  
Sbjct  285  GDFPRWIGTLRSLEHLDLSNNALTGELPSSM-GNLRSLKFLVLSNNQL  331



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  9    QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  68

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNSISGTVPDSLGNMSS  611
            +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  69   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  128

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+
Sbjct  129  IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGN  162



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  91

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNSISGTVPDSLGNMSS  611
            +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  92   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  151

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+
Sbjct  152  IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGN  185



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFKS + DP + L++W+EDD S C+W +++C+P+ GRV  + L GLGLSG+
Sbjct  33   LNDDVLGLIVFKSDLHDPPA-LSSWTEDDGSSCSWKYIQCNPSTGRVIGLSLTGLGLSGR  91

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM-SSL  614
            +G+GL+KL+ L VLSLA NN +G ISP+L  L  L TL+LS N  +G +P S  N+ SSL
Sbjct  92   LGKGLQKLQELKVLSLAKNNLTGEISPELAQLPKLHTLDLSFNKFTGQIPTSFSNLGSSL  151

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++LDL+ N LSGP+ D + +   SL +LSL+G+SF
Sbjct  152  RYLDLTQNVLSGPLPDDIFQTFQSLNYLSLSGNSF  186



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LND+VLGLIVFK+ ++DP + LA+W+EDD +PC+W  V+C PA  RVS + L  L LSG 
Sbjct  30   LNDEVLGLIVFKAALEDPTAALASWNEDDSTPCSWAHVECDPATSRVSRLALDSLSLSGP  89

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            + RGL++L  L  LSL++NN SG I P L LL  L++L+LS+N+ SG +PD L  + S++
Sbjct  90   LPRGLDRLPALVALSLSNNNLSGPIPPGLSLLPALRSLDLSRNAFSGGLPDDLARLPSIR  149

Query  618  FLDLSGNSLSGPVSDSMLEN--LGSLRFLSLA  707
             LDLS N+LSGP+  S+  N   G+LRFLSLA
Sbjct  150  SLDLSSNALSGPLLSSIFSNATCGTLRFLSLA  181



>gb|KJB67930.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=698

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  38   LNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  97

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +LE L  LSLA+NN SG ISP                        ++  + SL 
Sbjct  98   IGRGLLQLEFLRKLSLANNNLSGTISP------------------------NMVKLESLI  133

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSL+G + D   +  GSLR++SLA + F
Sbjct  134  AIDLSENSLTGSIPDDFFKQCGSLRYISLANNHF  167



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  40   LNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  99

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +LE L  LSLA+NN SG ISP                        ++  + SL 
Sbjct  100  IGRGLLQLEFLRKLSLANNNLSGTISP------------------------NMVKLESLI  135

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSL+G + D   +  GSLR++SLA + F
Sbjct  136  AIDLSENSLTGSIPDDFFKQCGSLRYISLANNHF  169



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  127

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLSGNSLSG + D   +  GSLR +SLA + F
Sbjct  128  VIDLSGNSLSGSIPDEFFKQCGSLRVISLAKNRF  161


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL    L G+I +G+E L++L V++L+ N FSG I   +G  + L+T++ S+NS SG +
Sbjct  202  LDLSDNFLEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCSLLRTIDFSENSFSGNL  261

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P+++  +S   F++L  N  SG V   + E L SL  L L+G+ F
Sbjct  262  PETMQKLSLCNFMNLRKNLFSGEVPKWIGE-LESLETLDLSGNKF  305



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  54   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  113

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  114  IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  149

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLSGNSLSG + D   +  GSLR +SLA + F
Sbjct  150  VIDLSGNSLSGSIPDEFFKQCGSLRVISLAKNRF  183


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL    L G+I +G+E L++L V++L+ N FSG I   +G  + L+T++ S+NS SG +
Sbjct  224  LDLSDNFLEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCSLLRTIDFSENSFSGNL  283

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P+++  +S   F++L  N  SG V   + E L SL  L L+G+ F
Sbjct  284  PETMQKLSLCNFMNLRKNLFSGEVPKWIGE-LESLETLDLSGNKF  327



>gb|KDO67528.1| hypothetical protein CISIN_1g002321mg [Citrus sinensis]
Length=936

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  127

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLSGNSLSG + D   +  GSLR +SLA + F
Sbjct  128  VIDLSGNSLSGSIPDEFFKQCGSLRVISLAKNRF  161


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL    L G+I +G+E L++L V++L+ N FSG I   +G  + L+T++ S+NS SG +
Sbjct  202  LDLSDNLLEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCSLLRTIDFSENSFSGNL  261

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P+++  +S   F++L  N  SG V   + E L SL  L L+G+ F
Sbjct  262  PETMQKLSLCNFMNLRKNLFSGEVPKWIGE-LESLETLDLSGNKF  305



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  LSG+
Sbjct  31   LNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTLSGR  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSLA NN SG ISP                        +L  + SL+
Sbjct  91   IGRGLLQLKFLRKLSLARNNLSGTISP------------------------NLAKLESLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG + D   +  GSLR +SLA + F
Sbjct  127  IIDLSENSLSGFIPDDFFKQCGSLRSISLANNRF  160



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  LSG+
Sbjct  31   LNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTLSGR  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSLA NN SG ISP                        +L  + SL+
Sbjct  91   IGRGLLQLKFLRKLSLARNNLSGTISP------------------------NLAKLESLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG + D   +  GSLR +SLA + F
Sbjct  127  IIDLSENSLSGFIPDDFFKQCGSLRSISLANNRF  160



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG +
Sbjct  24   NDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGHV  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L +LSLA+NNF+G I+P                         L ++ SLQ 
Sbjct  84   GRGLLRLQFLQILSLANNNFTGTINP------------------------DLPHLGSLQV  119

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLS NSLSGP+ D      GSLR +S A
Sbjct  120  IDLSQNSLSGPIPDEFFMQCGSLRVVSFA  148



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG +
Sbjct  24   NDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGHV  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L +LSLA+NNF+G I+P                         L ++ SLQ 
Sbjct  84   GRGLLRLQFLQILSLANNNFTGTINP------------------------DLPHLGSLQV  119

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLS NSLSGP+ D      GSLR +S A
Sbjct  120  IDLSQNSLSGPIPDEFFMQCGSLRVVSFA  148



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   137 bits (345),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 96/154 (62%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  44   LNDDVLGLIVFKADILDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  103

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +LE L  LSLA+NN SG ISP                        ++  + SL 
Sbjct  104  IGRGLLQLEFLRKLSLANNNLSGTISP------------------------NMVKLESLI  139

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSL+G + D   +  GSLR++SLA + F
Sbjct  140  AIDLSENSLTGSIPDEFFKQCGSLRYISLANNQF  173



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 2/160 (1%)
 Frame = +3

Query  234  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  413
            A G     LND+VLGLIVFKS ++DP + LA+WSE D +PC W  V+C PA   V  + L
Sbjct  27   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDANPCGWAHVECDPATSHVLRLYL  86

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  87   DSLSLSGPLPRGLDRLPYLETLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  146

Query  594  LGNMSSLQFLDLSGNSLSGPVSDSMLE--NLGSLRFLSLA  707
            LGN+ SL+ +DLS NSLSGP+ DS+       SLR+LSLA
Sbjct  147  LGNIPSLRSVDLSSNSLSGPIPDSLFSAATCSSLRYLSLA  186



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 116/184 (63%), Gaps = 26/184 (14%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            A S  LNDDVLGLIVFK+ +QDPAS LA+W+EDDD PC W  VKC P   RV+E++L G 
Sbjct  19   ATSGALNDDVLGLIVFKADLQDPASKLASWNEDDDDPCGWTGVKCSPRTNRVTELNLDGF  78

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD----  590
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N +SG++PD    
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSRNNFSGSLNPNLSHLESLWSVDLSENHLSGSIPDEFFR  138

Query  591  ---------------------SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
                                 S+G+ S+L  L+LS N LSG +  S L +L  LR L L+
Sbjct  139  QCRSLRSVSLANNDFSGEIPLSVGSCSTLAALNLSSNRLSGRLP-SGLWSLYGLRSLDLS  197

Query  708  GSSF  719
            G+S 
Sbjct  198  GNSL  201



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 100/160 (63%), Gaps = 24/160 (15%)
 Frame = +3

Query  240  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  419
            G+ +  LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L  
Sbjct  22   GSLTPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTELTLDD  81

Query  420  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  599
              LSG+IGRGL +L+ L+ LSLA NN SG ISP                        +L 
Sbjct  82   FSLSGRIGRGLLQLQFLHKLSLARNNLSGNISP------------------------NLA  117

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +++L+ +DLS NSLSGP+ D   +  GSLR +SLA + F
Sbjct  118  RLANLRIIDLSENSLSGPIPDDFFQQCGSLRVISLAKNKF  157


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL G  LSG+    ++KL   N +SL++N  +G +   +G +  L+TL++S N ISG +
Sbjct  246  IDLSGNSLSGEFPETIQKLSLCNFMSLSNNLLTGEVPNWIGEMKRLETLDISGNKISGQI  305

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P S+GN+ SL+ L+ S N LSG + +SM  N GSL  L L+ +S 
Sbjct  306  PTSIGNLQSLKVLNFSSNDLSGSLPESM-ANCGSLLALDLSRNSM  349



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 97/160 (61%), Gaps = 23/160 (14%)
 Frame = +3

Query  240  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  419
            GA +  LNDDVLGLIVFKS VQDP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVQDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  420  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  599
             GLSG+I RGL +L+ L  LSLA+NN +G IS                         SL 
Sbjct  79   FGLSGRISRGLLRLQFLYKLSLANNNLTGSISVV-----------------------SLS  115

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +++L+ LDLS NSLSGP+     E  G LR +SLA + F
Sbjct  116  QLANLKILDLSENSLSGPIPGDYFEKCGPLRSISLAKNKF  155


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +3

Query  426  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  605
            LSG I   LEKLE L VL+L+ N  SG +   +    NL TL++S N+++GTVP ++G +
Sbjct  299  LSGTIPTSLEKLESLKVLNLSQNAISGSLPESISSCVNLLTLDVSHNNLTGTVPKTVGQL  358

Query  606  SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
              L  LDLS N L G V   + E + SL+ L L  ++ 
Sbjct  359  KLLGILDLSENRLYGTVPAEIGE-VTSLKELRLEKNAL  395



>ref|XP_008350571.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=485

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GRGL +L++L  LSL+ NNF+G I+P L  L +LQ ++LS+NS+SG++P+       SL 
Sbjct  84   GRGLLRLQNLKKLSLSDNNFTGFINPDLPHLGSLQVIDLSRNSLSGSIPEEFFKQCGSLG  143

Query  618  FLDLSGNSLSGPVSDSM  668
             +  +GN+L+G + +S+
Sbjct  144  VVSFAGNNLTGRIPESL  160



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 ref|XP_004160330.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 93/149 (62%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L +LSLA+NNF                        +GT+  +L ++ +LQ 
Sbjct  84   GRGLLRLQFLQILSLANNNF------------------------TGTINSALSHLGNLQV  119

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLS NSLSGP+ + +    GS+R LS A
Sbjct  120  IDLSDNSLSGPIPEQLFLQCGSIRVLSFA  148



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 99/160 (62%), Gaps = 24/160 (15%)
 Frame = +3

Query  240  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  419
            GA +  LNDDVLGLIVFKS V+DP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVEDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  420  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  599
             GLSG+I RGL +L+ L+ LSLA+NN +G IS                         SL 
Sbjct  79   FGLSGRISRGLLRLKFLHKLSLANNNLTGSISV------------------------SLS  114

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +++L+ LDLS NSLSGP+     E  G LR +SLA ++F
Sbjct  115  QLANLKILDLSQNSLSGPIPGDYFEKCGPLRSISLAKNNF  154



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 92/150 (61%), Gaps = 24/150 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L VLSLA+NNF+G I+P                         L  +  LQ
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINP------------------------DLPRLGGLQ  118

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS NSLSG + D   +  GSLR +S A
Sbjct  119  VIDLSENSLSGSIPDGFFQQCGSLRSVSFA  148



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 95/152 (63%), Gaps = 24/152 (16%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG IG
Sbjct  25   DDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHIG  84

Query  444  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  623
            RGL +L+ L +LSLA+NNF+G                        T+  +L ++ +LQ +
Sbjct  85   RGLLRLQFLQILSLANNNFTG------------------------TINSALSHLGNLQVI  120

Query  624  DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            DLS N+LSGP+ + + +  GS+R LS A +S 
Sbjct  121  DLSDNNLSGPIPEQLFQQCGSIRVLSFARNSL  152



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  141  MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  200

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  201  GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  260

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L++LDL+GN+ SGP+  +      +LRFL L+G+ F
Sbjct  261  LRYLDLTGNAFSGPLPPAFPR---TLRFLVLSGNQF  293


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 64/109 (59%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+  +DL     SG +  G+ +L +L  LSL+ N F G +   +G   +L T++LS N+ 
Sbjct  333  RLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAF  392

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             G +PDS+G ++SL +L  SGN LSG V  + L  L +++ L L+ ++ 
Sbjct  393  DGHLPDSIGQLASLVYLSASGNRLSGDVP-AWLGKLAAVQHLDLSDNAL  440



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 96/157 (61%), Gaps = 24/157 (15%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SG++GRGL +LE L  LSL++NN SG ISP                        +   + 
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLSGNISP------------------------NFARVE  123

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +LQ +DLSGN+ SG VSD       SLR +SLA ++F
Sbjct  124  NLQMIDLSGNNFSGAVSDDFFRQCRSLRVISLANNNF  160



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  34   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  93

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  94   GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  153

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L++LDL+GN+ SGP+  +      +LRFL L+G+ F
Sbjct  154  LRYLDLTGNAFSGPLPPAFPR---TLRFLVLSGNQF  186



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GRGL +L++L  LSL+ NNF+G I+P L  L +L+ ++LS+NS+SG++P+       SL+
Sbjct  84   GRGLLRLQNLQKLSLSDNNFTGFINPDLPHLGSLRVIDLSRNSLSGSIPEEFFKQCGSLR  143

Query  618  FLDLSGNSLSGPVSDSM  668
             +  +GN+L+G + +S+
Sbjct  144  VVSFAGNNLTGRIPESL  160



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  33   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  92

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G + RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  93   GSMPRGLDRLPALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  152

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L++LDL+GN+ SGP+  +      +LRFL L+G+ F
Sbjct  153  LRYLDLTGNAFSGPLPPAFPR---TLRFLVLSGNQF  185


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+  +DL     SG +  G+ +L +L  LSL+ N FSG +   +GL  +L T++LS N+ 
Sbjct  225  RLRTLDLSRNQFSGPVTDGIARLHNLKTLSLSGNRFSGAVPADIGLCPHLSTIDLSSNAF  284

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             G +PDS+G + SL +L  SGN LSG V  + L  L +++ L L+ ++F
Sbjct  285  DGHLPDSIGQLGSLVYLSASGNRLSGDVP-AWLGKLAAVQHLDLSDNAF  332



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 91/150 (61%), Gaps = 24/150 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  25   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NN +G ++P                        ++ ++ +L+
Sbjct  85   IGRGLLQLQSLRKLSLSKNNLTGSLTP------------------------NIAHIDNLR  120

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             LDLS NS SGPV +      GSLR +SLA
Sbjct  121  ALDLSENSFSGPVPEDFFRQCGSLRTISLA  150



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   134 bits (337),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 91/150 (61%), Gaps = 24/150 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +L+ L  LSL+ NN +G ++P                        ++ ++ +L+
Sbjct  91   VGRGLLQLQSLRKLSLSKNNLTGSLTP------------------------NIAHIDNLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             LDLS NS SGPV +      GSLR +SLA
Sbjct  127  ALDLSENSFSGPVPEDFFRQCGSLRTISLA  156



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 91/150 (61%), Gaps = 24/150 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L VLSLA+NNF+G I+P                         L  +  LQ
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINP------------------------DLPRLGGLQ  118

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N LSG + D   +  GSLR +S A
Sbjct  119  VIDLSENGLSGSIPDGFFQQCGSLRSVSFA  148



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  614
            IGRGL +L+ L  LSLA NN +G I P L  L NL+ ++LS+NS+SGT+PD       SL
Sbjct  86   IGRGLLQLQFLRKLSLAKNNITGSIGPNLARLQNLRFIDLSENSLSGTIPDDFFKQCGSL  145

Query  615  QFLDLSGNSLSGPVSDSM  668
              + L+ N  SG + +S+
Sbjct  146  HAISLAKNKFSGKIPESV  163



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 91/149 (61%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG I
Sbjct  25   NDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGHI  84

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L VLSLA+N F+G I+P                         L  +  LQ 
Sbjct  85   GRGLLRLQFLQVLSLANNKFNGTINP------------------------DLPRLGGLQV  120

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLS NSLSG + D   +  GSLR +S A
Sbjct  121  IDLSDNSLSGSIPDGFFQQCGSLRSVSFA  149



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +LE L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIIN-----------------------PNLLLSLVNLK  123

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N+LSG +SD      GSLR LSLA
Sbjct  124  VVDLSSNALSGSLSDGFFRQCGSLRVLSLA  153



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +LE L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIIN-----------------------PNLLLSLVNLK  123

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N+LSG +SD      GSLR LSLA
Sbjct  124  VVDLSSNALSGSLSDGFFRQCGSLRVLSLA  153



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 92/150 (61%), Gaps = 24/150 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L VLSLA+N F+G ++P                         L  +  LQ
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNP------------------------DLPRLGGLQ  119

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS NSLSG + D   +  GSLR +S A
Sbjct  120  VIDLSDNSLSGSIPDGFFQQCGSLRSVSFA  149



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIIN-----------------------PNMLLSLVNLK  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N LSG + D      GSLR LSLA
Sbjct  122  VVDLSSNGLSGSLPDEFFRQCGSLRVLSLA  151



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 92/150 (61%), Gaps = 24/150 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L VLSLA+N F+G ++P                         L  +  LQ
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNP------------------------DLPRLGGLQ  119

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS NSLSG + D   +  GSLR +S A
Sbjct  120  VIDLSDNSLSGSIPDGFFQQCGSLRSVSFA  149



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 24/157 (15%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SG++GRGL +LE L  LSL++NN +G ISP                        +   + 
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLTGNISP------------------------NFARVD  123

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +LQ +DLSGN+ SG VSD       SLR +SLA + F
Sbjct  124  NLQVIDLSGNNFSGVVSDDFFRQCRSLRVVSLANNKF  160



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 90/150 (60%), Gaps = 24/150 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPDSKLISWNEDDDSPCNWVGVKCDPKTNRVSELVLEGFSLSGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRG+ +L+ L  LSL++NNF+G I+P                        +L  +  L+
Sbjct  85   IGRGVLQLKFLRKLSLSNNNFTGTINP------------------------NLARLEGLR  120

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N LSGP+ D      GSLR +S A
Sbjct  121  VIDLSDNRLSGPIPDDFFRQCGSLREMSFA  150


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +D     LSG +   + KL   + LSL  N FSG +   +G +  L+TL+LS+N  SG +
Sbjct  243  IDFSENSLSGSLPDSMRKLTMCSSLSLHGNLFSGELPAMIGEMRGLETLDLSRNIFSGGI  302

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSM  668
            PDSLGN+ SL+ L+LS N  +G V DS+
Sbjct  303  PDSLGNLQSLKLLNLSSNGFTGVVPDSL  330



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 111/165 (67%), Gaps = 3/165 (2%)
 Frame = +3

Query  225  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  404
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P  +  ++SL++LDL+GN+ SGP+  +      ++RFL L+G+ F
Sbjct  135  PGDVPLLASLRYLDLTGNAFSGPLPATF---PATVRFLMLSGNQF  176



>ref|NP_001170194.1| uncharacterized protein LOC100384143 precursor [Zea mays]
 gb|ACN36181.1| unknown [Zea mays]
Length=403

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            SL+ LDL+GN+ SGP+  +  E   ++RFL L+G+ F
Sbjct  153  SLRSLDLTGNAFSGPLPPAFPE---TIRFLVLSGNQF  186



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 111/165 (67%), Gaps = 3/165 (2%)
 Frame = +3

Query  225  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  404
             + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P  +  ++SL++LDL+GN+ SGP+  +      ++RFL L+G+ F
Sbjct  135  PGDVPLLASLRYLDLTGNAFSGPLPATF---PATVRFLMLSGNQF  176



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 99/156 (63%), Gaps = 26/156 (17%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  431
            LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  25   LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  84

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G+IGRGL++L+ L  LSLA+NN +G I+P                        ++  + +
Sbjct  85   GRIGRGLQRLQFLRKLSLANNNLTGGINP------------------------NIARIDN  120

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L+ +DLSGNSLSG VSD +    GSLR +SLA + F
Sbjct  121  LRVIDLSGNSLSGEVSDDVFRQCGSLRTVSLARNRF  156



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 94/154 (61%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  VKC+P   RV+E++L G  LSG+
Sbjct  38   LNDDVLGLIVFKADILDPNQKLSSWNEDDDTPCNWFGVKCNPRLNRVTELNLDGFSLSGR  97

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +LE L  LSLA NN +G ISP                        +L  + SL+
Sbjct  98   IGRGLLQLEFLRKLSLAKNNLTGSISP------------------------NLAKLESLR  133

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG + D   +  GS+R +SLA + F
Sbjct  134  IIDLSENSLSGSIPDDFFKQCGSVRSISLANNRF  167



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 93/153 (61%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+I
Sbjct  51   NDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGRI  110

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L +LSL+ NNF+G I+P                        SL  ++SL+ 
Sbjct  111  GRGLLRLQFLRILSLSKNNFTGTINP------------------------SLARIASLRV  146

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +DLS N+LSGP+ D      GSL  +SLAG+  
Sbjct  147  IDLSENNLSGPIPDEFFRQCGSLIVVSLAGNKL  179



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 95/150 (63%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL++NN +G ++P               N IS     SLG   SL+
Sbjct  89   IGRGLLQLQSLHKLSLSNNNLTGTVNP---------------NLIS-----SLG---SLK  125

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLSGN LSG + D      GSLR  S+A
Sbjct  126  VVDLSGNGLSGSLPDGFFRQCGSLRVFSVA  155



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIIN-----------------------PNLLLSLVNLK  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N LSG + D      GSLR LSLA
Sbjct  122  VVDLSSNGLSGSLPDGFFRQCGSLRVLSLA  151



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLI FK+G++DP S LA+W+E+D+ PC W+ +KC P + RV+ V L G  LSGK
Sbjct  26   LNDDVLGLIAFKAGIEDPRSKLASWNENDNDPCNWDGIKCDPKSNRVAVVALDGFALSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  614
            +GRGL +L+ L+ LSL+ NNFSG ++P    L +L+TL+LS N++SGT+PD   G   S+
Sbjct  86   LGRGLLRLQFLDTLSLSVNNFSGSVTPAFLRLESLRTLDLSANNLSGTIPDGFFGQCRSI  145

Query  615  QFLDLSGNSLSGPV  656
            + + L+ NS+SG +
Sbjct  146  RDISLAKNSISGKI  159



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            L  NDDVLGLI+FK+G+QDP   L+TW+EDD SPC W  VKC PAN RVS + L G  LS
Sbjct  28   LSFNDDVLGLIMFKAGLQDPKGKLSTWNEDDYSPCHWVGVKCDPANNRVSSLVLDGFSLS  87

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-  608
            G I RGL +L+ L +LSL+ NNF+G I+P L  + +L  ++LS+N++SG +PD +     
Sbjct  88   GHIDRGLLRLQFLQILSLSRNNFTGTIAPDLLTIGDLLVVDLSENNLSGPIPDGIFQQCW  147

Query  609  SLQFLDLSGNSLSGPVSDSM  668
            SL+ +  + N+L+G V DS+
Sbjct  148  SLRVVSFANNNLTGKVPDSL  167



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 91/154 (59%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N LSGP+ D       S+R +SLA ++F
Sbjct  122  NLDLSENKLSGPIPDDFFGQCRSIRAISLAKNAF  155



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 91/154 (59%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N LSGP+ D       S+R +SLA ++F
Sbjct  122  NLDLSENKLSGPIPDDFFGQCRSIRAISLAKNAF  155


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  465  HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  644
            +L VL L+SN FSG I P +  + +LQ LNLS NS SG++P+ LG + SL+ LDLSGN L
Sbjct  383  NLQVLVLSSNAFSGKIPPPVSNVRSLQFLNLSWNSFSGSIPEGLGKLKSLEVLDLSGNRL  442

Query  645  SGPV  656
            +G +
Sbjct  443  NGSI  446



>ref|XP_002972654.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
 gb|EFJ25875.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
Length=927

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = +3

Query  240  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  419
            G E++  NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L G
Sbjct  40   GDETVSWNDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDG  99

Query  420  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  599
            L LSG IGRGL KLE L  LSL++NN SG + P   L   L  ++L KN +SG +P  +G
Sbjct  100  LALSGTIGRGLLKLERLKTLSLSANNLSGNVVP--ELFRMLDFVDLKKNRLSGELPSPMG  157

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
              +S++++DLS N+ +G ++         LR+LSL+
Sbjct  158  --ASIRYVDLSDNAFTGALARDFFGGGHLLRYLSLS  191



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 94/150 (63%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+WSEDD SPC+WN VKCHP   RV+E+ L G  LSG+
Sbjct  26   LNDDVLGLIVFKADLRDPEQKLASWSEDDYSPCSWNGVKCHPRTNRVTELTLDGFSLSGR  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LS+++NN +G+I+                       P+ L ++ +L+
Sbjct  86   IGRGLLQLQFLHKLSMSNNNLTGIIN-----------------------PNLLLSLVNLK  122

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N LSG + D      GSLR  SLA
Sbjct  123  VVDLSSNGLSGSLPDGFFRQCGSLRVFSLA  152



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 26/156 (17%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  431
            LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  32   LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  91

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G+IGRGL++L+ L  LSLA+NN +G I+P                        ++  + +
Sbjct  92   GRIGRGLQRLQFLRKLSLANNNLTGGINP------------------------NIARIDN  127

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L+ +DLSGNSLSG VS+ +    GSLR +SLA + F
Sbjct  128  LRVIDLSGNSLSGEVSEDVFRQCGSLRTVSLARNRF  163



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 3/149 (2%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPESKLISWNEDDDSPCNWVGVKCDPRTNRVSELVLDGFSLSGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG-NMSSL  614
            IGRGL +L+ L  LSL++NNF+G I+P L  L  L+ ++LS NS+SG+ PD       SL
Sbjct  85   IGRGLLQLQFLRKLSLSNNNFTGSINPNLARLEGLRIIDLSDNSLSGSTPDDFFLQCGSL  144

Query  615  QFLDLSGNSLSGPVSDSML--ENLGSLRF  695
            + +  + N+LSG +  S++    L SL F
Sbjct  145  RAISFAKNNLSGQIPQSLISCSTLASLNF  173



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 26/156 (17%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA--WNFVKCHPANGRVSEVDLHGLGLS  431
            LNDDVLGLIVFK+ ++DP   LA+WSEDD+S C   W  VKC+P + RV E++L G  LS
Sbjct  32   LNDDVLGLIVFKADIRDPKGKLASWSEDDESACGAGWVGVKCNPRSNRVVEINLDGFSLS  91

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G+IGRGL++L+ L  LSLA+NN +G I+                         ++  + S
Sbjct  92   GRIGRGLQRLQFLRKLSLANNNLTGGIN------------------------SNIARIDS  127

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L+ +DLSGNSLSG VSD +    GSLR +SLA + F
Sbjct  128  LRVIDLSGNSLSGQVSDDVFRQCGSLRAVSLARNRF  163



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 112/179 (63%), Gaps = 26/179 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIV K+ +QDP S L +WSEDDD PC W  VKC+P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLQDPTSKLLSWSEDDDDPCGWIGVKCNPRTNRVTELNLDGFSLSGK  83

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD---------  590
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N++SG++PD         
Sbjct  84   IGRGLLQLQSLRKLSLSRNNFSGSLNPNLSQLESLWSVDLSENNLSGSIPDVFFRQCRSL  143

Query  591  ----------------SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
                            S+G+ S+L  L+ S N LSG +  S L +L  LR L L+G+S 
Sbjct  144  RSISLANNDFSGEIPPSVGSCSTLAVLNFSSNQLSGRLP-SGLWSLYGLRSLDLSGNSL  201



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL++NN +GVI+                       P+ L ++ +L+
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGVIN-----------------------PNFLLSLVNLK  124

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N+LSG + D   +  GSLR LSLA
Sbjct  125  VVDLSSNALSGSLPDEFFKQCGSLRVLSLA  154



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 113/179 (63%), Gaps = 26/179 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIV K+ ++DPAS LA+W+EDDD PC W  V C P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLEDPASKLASWNEDDDDPCGWVGVTCSPRTNRVTELNLDGFSLSGK  83

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD---------  590
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L +++LS+N++SG++PD         
Sbjct  84   IGRGLLQLQSLRKLSLSKNNFSGSLNPNLSQLESLSSVDLSENNLSGSIPDEFFRQCRSL  143

Query  591  ----------------SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
                            S+G+ S+L  L+LS N LSG +  S L +L  LR L L+G+S 
Sbjct  144  SSISLANNAFSGEIPPSVGSCSTLAELNLSSNRLSGRLP-SGLWSLYGLRSLDLSGNSL  201


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 9/108 (8%)
 Frame = +3

Query  408  DLHGL--------GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  563
            ++HGL         LSG +   L +L+ L VL L+ N  +G I P++G   +L  LNL K
Sbjct  402  NIHGLQFLNLSWNSLSGSMPASLGELKSLQVLDLSGNRLNGSIPPEIGEAVSLNELNLHK  461

Query  564  NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            NS++G +P  +GN SSL  L LS N+L+GPV  S   N+ +L+ + L+
Sbjct  462  NSLTGGIPTQIGNCSSLASLILSQNNLTGPVP-STFSNITNLQTIDLS  508



>ref|NP_001290509.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040 precursor [Elaeis guineensis]
 gb|AAO26311.1| receptor-like protein kinase [Elaeis guineensis]
Length=938

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 91/154 (59%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +++P S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLREPDSKLVSWNEDDDEPCCWTGIKCEPKTNRVTELSLNGFSLSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N LSGP+ D       S+R +SLA ++F
Sbjct  122  NLDLSENKLSGPIPDDFFGQCRSIRAISLAKNAF  155



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LN DVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNGDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIIN-----------------------PNMLLSLVNLK  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N LSG + D      GSLR LSLA
Sbjct  122  VVDLSSNGLSGSLPDEFFRQCGSLRVLSLA  151



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  38   MPVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWRRVECDPATSRVLRLSLDGLALS  97

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G + RGL++L  L  L+LA NN SG + P L LLT+L++L+LS N+ SG +PD +  ++S
Sbjct  98   GPMPRGLDRLPALQELTLARNNLSGPLPPGLSLLTSLRSLDLSYNAFSGPLPDDVALLAS  157

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L++LDL+GN+ SGP+  +      ++RFL L+ + F
Sbjct  158  LRYLDLTGNAFSGPLPPAFPP---TIRFLMLSCNQF  190



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 90/154 (58%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ VQDP   LA+W EDDD+PC W   KC+P + RV E++L G  LSG 
Sbjct  27   LNDDVLGLIVFKADVQDPKGKLASWDEDDDNPCNWVGCKCNPRSNRVVELNLDGFSLSGH  86

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +L+ L  LSLA NN +G IS                         S+  + +L+
Sbjct  87   LGRGLLQLQFLRKLSLAKNNLTGSIS------------------------SSIARIDNLR  122

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS NSLSG + D      GSLR +SLA + F
Sbjct  123  VLDLSENSLSGTIPDEFFRQCGSLRSVSLASNKF  156



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL+ NN +G I P                        +L  + +L+
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSIDP------------------------NLTRLENLR  123

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG +S+ + +   +LR LSLA + F
Sbjct  124  IIDLSENSLSGTISEDLFKECAALRDLSLANNKF  157



>gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+EV L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTEVMLDGFSLSGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSLA NN +G IS                         +L  + +L+
Sbjct  85   IGRGLLQLQFLHKLSLARNNLTGSISL------------------------NLSRLENLR  120

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG + D      GSLR +SLA + F
Sbjct  121  IIDLSDNSLSGSIQDDFFAQCGSLRAISLAKNKF  154


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +  +D     +SG +   ++KL   N LSL++N  +G +   +G +  L+TL+LS N  S
Sbjct  240  IRAIDFSENSISGYLPETMQKLSLCNYLSLSNNMLAGEVPNWIGEMKQLETLDLSGNKFS  299

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G VP+S+GN+ SL+ L+LS N LSG + +SM  N G L  L  + +S 
Sbjct  300  GQVPNSIGNLQSLKVLNLSANGLSGNLPESM-ANCGGLVALDFSRNSI  346



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 91/153 (59%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP   L+TW+ED + PC W  +KC P + RV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLHDPKDKLSTWNEDAEYPCDWVGIKCDPRSKRVTEVALDGFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L VLSL+ NNFSG I+                         SL ++ +LQ 
Sbjct  84   GRGLLRLQFLQVLSLSKNNFSGPIN------------------------TSLTHIGTLQV  119

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            LDLS N+ +G + D M +  GSLR +S A +S 
Sbjct  120  LDLSENNFTGAIPDEMFQQCGSLRVVSFAKNSL  152



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
            SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            SL+ LDL+GN+ SGP+  +  E   ++RFL L+G+ F
Sbjct  153  SLRSLDLTGNAFSGPLPPAFPE---TIRFLVLSGNQF  186



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 88/152 (58%), Gaps = 24/152 (16%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWGGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  444  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  623
            RGL +LE L  LSLA NN                        +SG VP  L  + +LQ L
Sbjct  92   RGLLRLEALQSLSLARNN------------------------LSGDVPAELARLPALQTL  127

Query  624  DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            DLS N+ +G + + +     SLR +SLAG++F
Sbjct  128  DLSANAFAGAIPEGLFGRCRSLRDVSLAGNAF  159



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL+ NN +G I+P                        +L  + +L+
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSINP------------------------NLTRLENLR  123

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG +S+   +   +LR LSLA + F
Sbjct  124  IIDLSENSLSGTISEDFFKECAALRDLSLANNKF  157



>ref|XP_008388889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=469

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L +WSEDDDS C+W  VKCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLXSWSEDDDSACSWVGVKCHPRSNRVIELNLDDFSLSGH  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NN +G ++P                        ++ ++ +L+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTP------------------------NIAHIDNLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS NS SG V +      GSLR +SLA + F
Sbjct  127  VLDLSENSFSGDVPEEFFRQCGSLRXISLAKNKF  160



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 89/152 (59%), Gaps = 24/152 (16%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVLGLIVFK+ V DP   LATWSEDD+  CAW+ V C P  GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPEGRLATWSEDDERACAWDGVTCEPRTGRVSALSLAGFGLSGKLG  91

Query  444  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  623
            RGL +LE L  L+LA NN                        +SG VP  L  + +LQ L
Sbjct  92   RGLLRLEALQSLNLAHNN------------------------LSGDVPAELARLPALQTL  127

Query  624  DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            DLS N+ +G + + +     +LR +SLAG++F
Sbjct  128  DLSANAFAGAIPEGLFGRCRALRDVSLAGNAF  159



>ref|XP_002988156.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
 gb|EFJ10948.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
Length=864

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGL+VFK+G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L GL LSG I
Sbjct  1    NDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDGLALSGTI  60

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL KLE L  LSL++NN SG + P   L   L  ++L KN +SG +P  +G  +S+++
Sbjct  61   GRGLLKLERLKTLSLSANNLSGNVVP--ELFRMLDFVDLKKNRLSGELPSPMG--ASIRY  116

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLS N+ +G ++         LR+LSL+
Sbjct  117  VDLSDNAFTGALARDFFGGGHLLRYLSLS  145



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVF++ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLIVFEADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  88

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  89   IGRGLLQLQFLHKLSLSNNNLTGIIN-----------------------PNFLLSLVNLK  125

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N+LSG + D   +  GSLR LSLA
Sbjct  126  VVDLSSNALSGSLPDGFFKQCGSLRVLSLA  155



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            ++DDVLGL+ FK+G+ DP   L +W +DD SPCAW  + C    GRVSE++L GL L+G+
Sbjct  4    MSDDVLGLMAFKAGLSDPTGALHSWRQDDASPCAWVGIVCDRLTGRVSELNLVGLFLAGQ  63

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL KL+ L +L+L+SNNF+G I  ++  L  L+ LN+S N ++G +   L N SSL 
Sbjct  64   IGRGLAKLDELQILNLSSNNFTGSIDTEVAGLPMLRKLNVSNNQLNGVITPLLTNNSSLM  123

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
             LDLS N+L+GP+++       SL  L L G+
Sbjct  124  VLDLSSNALTGPMAEKFFTTCQSLVSLYLGGN  155



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 92/154 (60%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFKS VQDP   L +W+E+DDSPC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDVQDPYGKLKSWNEEDDSPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            I RGL +L+ L+ LSLA NN +G IS                         SL  ++ L+
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISV------------------------SLAQLAYLK  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            FLDLS N+LSG +     +  G LR +SLA +  
Sbjct  122  FLDLSENNLSGNIPGDYFQQCGPLRSISLANNKI  155



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 114/184 (62%), Gaps = 26/184 (14%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            A S  LNDDVLGLIVFK+ +QDP S L +W+EDD+ PC W  + C+P   RV+E++L G 
Sbjct  19   AMSGALNDDVLGLIVFKADLQDPTSKLTSWNEDDNDPCGWMGITCNPTTNRVTELNLDGF  78

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS---  593
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L T++LS+N++SG++PD    
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSKNNFSGSLNPNLSRLESLWTVDLSENNLSGSIPDEFFQ  138

Query  594  ----------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
                                  +G+ S+L  L++S N LSG +  S L +L  LR L L+
Sbjct  139  QCRSLRTILLANNAFSGEIPPGVGSCSTLAELNISSNRLSGRLP-SGLWSLYGLRSLDLS  197

Query  708  GSSF  719
            G+S 
Sbjct  198  GNSL  201


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  426  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  605
            L+GK+   L+KL   + LSL SN+FSG +   +G + +L+TLNLS N  SG VPDS+GN+
Sbjct  249  LTGKLPETLQKLSICSYLSLGSNSFSGEVPTWIGEMKSLETLNLSGNGFSGQVPDSIGNL  308

Query  606  SSLQFLDLSGNSLSGPVSDSM  668
              ++ LD S N+ +G + +S+
Sbjct  309  QVVKRLDFSQNNFTGSLPESI  329



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 96/150 (64%), Gaps = 23/150 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLI+FK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLILFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRG+ +L+ L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  88   IGRGILQLQFLHKLSLSNNNLTGIIN-----------------------PNFLLSLVNLK  124

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +DLS N+LSG + D   +  GSLR LSLA
Sbjct  125  VVDLSSNALSGSLPDEFFKQCGSLRVLSLA  154


 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 91/157 (58%), Gaps = 25/157 (16%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  416
            G   SL+  D  L +  F   ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L 
Sbjct  287  GEMRSLETLD--LSMNKFSGQLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLD  344

Query  417  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
            G  LSG+IGRG+ +L+ L+ LSL++NN +G+I+                       P+ L
Sbjct  345  GFSLSGRIGRGILQLQFLHKLSLSNNNLTGIIN-----------------------PNFL  381

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             ++ +L+ +DLS N+LSG + D   +  GSLR LSLA
Sbjct  382  LSLVNLKVVDLSSNALSGSLPDGFFKQCGSLRVLSLA  418



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 93/159 (58%), Gaps = 24/159 (15%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC WN + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWNGIHCNPRSNRVSQIVLDGF  82

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  602
            GLSGKI RGL +L+ L  LSLA NNF+G IS                         S+  
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSIS------------------------SSVVQ  118

Query  603  MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++ L+ LDLS N+L G +     E  G LR +SLA + F
Sbjct  119  LAYLRILDLSENNLFGTIPGDFFEQCGPLRSISLAKNKF  157



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+GV+DP S LA+W+EDD  PC W  V+C   + RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKAGVEDPRSKLASWNEDDVDPCNWAGVRCDAKSNRVTELALDGFALSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  614
            +GRGL  L+ L  LSL+ NNFSG +SP L  L +L+TL+LS N +SGT+PD   G   S+
Sbjct  86   LGRGLLWLQFLETLSLSMNNFSGSLSPDLLRLESLRTLDLSANHLSGTIPDGFFGQCRSI  145

Query  615  QFLDLSGNSLSGPV  656
            + + L+ NS+SG +
Sbjct  146  RDISLAKNSISGKI  159



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 88/152 (58%), Gaps = 24/152 (16%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW+ V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWDGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  444  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  623
            RGL +LE L  LSLA NN                        +SG VP  L  + +LQ L
Sbjct  92   RGLLRLEALQSLSLARNN------------------------LSGDVPADLARLPALQTL  127

Query  624  DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            DLS N+ +G V + +     SLR +SLA ++F
Sbjct  128  DLSANAFAGAVPEGLFGRCRSLRDVSLANNAF  159



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 117/170 (69%), Gaps = 8/170 (5%)
 Frame = +3

Query  234  AGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  410
            AGGA+    LND+VLGLIVFKS ++DPA  LATW+E D +PC W+ V+C  A+ RV  +D
Sbjct  31   AGGADLPTPLNDEVLGLIVFKSVLEDPAGALATWNEADATPCNWSHVECGVASSRVVRLD  90

Query  411  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  590
            L  L LSG + RGL++L  L  LSLA NN SG I P L LL +L++L+LS+N+ SG +PD
Sbjct  91   LASLSLSGPLPRGLDRLPALASLSLADNNLSGPIPPGLSLLPSLRSLDLSRNAFSGRLPD  150

Query  591  SLGNMSSLQFLDLSGNSLSGPVSDSML-------ENLGSLRFLSLAGSSF  719
             L  +SS++ LDLS NSL+GP+ DS            GSLR+LSLAG+ F
Sbjct  151  DLSLLSSIRSLDLSSNSLAGPIPDSFFSSSHSSATTCGSLRYLSLAGNRF  200


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+  +DL     SG I  G+  L +L  L L  N FSGVI   +GL  +L TL+LS NS 
Sbjct  239  RLRVLDLSRNSFSGPIPAGIGDLHNLKHLQLNHNQFSGVIPAGIGLCPHLDTLDLSFNSF  298

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             G +PDS+  +SS+ FL LS N LSG V    + NL S++ L L+ + F
Sbjct  299  DGHLPDSVQYLSSMTFLSLSNNQLSGDVL-PWIGNLTSVQHLDLSNNKF  346



>ref|XP_006842493.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK  + DP + L++WSEDD+SPC W  ++C+P   RV+E+ L+ L LSGK
Sbjct  29   LNDDVLGLIVFKFDLHDPKNVLSSWSEDDNSPCNWFGIQCNPRTQRVTEILLNDLSLSGK  88

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL++N FSG ISP                         L  + SL+
Sbjct  89   IGRGLVRLQFLRKLSLSNNYFSGTISP------------------------DLATIQSLR  124

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +D SGN+L+G + D   +  GSLR++S A ++F
Sbjct  125  AVDFSGNNLTGEIPDQFFKQCGSLRYVSFARNNF  158



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  26   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  85

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL+
Sbjct  86   GRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSLR  145

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+GP+ +S+
Sbjct  146  EVSFANNNLTGPIPESL  162



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ + DP S LA+W+ED+D PC W  VKC+    RV+E+ L G  LSGK
Sbjct  32   LNDDVLGLIVFKADILDPLSKLASWNEDEDDPCGWTGVKCNAKTNRVTELSLVGFSLSGK  91

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  614
            IGRGL +L+ +  L L+ NNFSG ++P+L  L +L+ ++LS+N++SG +PD   G   SL
Sbjct  92   IGRGLLQLQSIQKLYLSKNNFSGSLNPKLSQLESLRVVDLSENNLSGVIPDEFFGQCRSL  151

Query  615  QFLDLSGNSLSGPVSDSM  668
            + L L+ N+ +G +  S+
Sbjct  152  RSLSLANNAFTGHIPPSL  169



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 92/154 (60%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFKS +QDP   L +W+E+DD+PC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDIQDPYKKLKSWNEEDDTPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            I RGL +L+ L+ LSLA NN +G IS                         SL  ++ L+
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISV------------------------SLAQLAYLK  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            FLDLS N+LSG +     +  G LR +SLA +  
Sbjct  122  FLDLSENNLSGNIPGDYFQQCGPLRSISLANNKI  155



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+QDP S L +W+ED ++PC W  VKC P   RV+E+ L G  LSG I
Sbjct  27   NDDVLGLIVFKAGLQDPESKLTSWNEDSENPCNWVGVKCDPKTQRVTELALDGFFLSGHI  86

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GRGL +L+ L +LSL++NNF+G I+P L  L  LQ ++LS+N +SG +PD       SL+
Sbjct  87   GRGLIRLQFLQILSLSNNNFTGTINPDLSQLGGLQVIDLSRNKLSGFIPDEFFKQCGSLR  146

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+LSG + +S+
Sbjct  147  SVSFAKNNLSGQIPESL  163



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  26   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  85

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL+
Sbjct  86   GRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSLR  145

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+GP+ +S+
Sbjct  146  EVSFANNNLTGPIPESL  162



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG I
Sbjct  28   NDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGHI  87

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GRGL +L+ L VLSL++NNF+G I+  L     LQ ++ S+N++SG +PD       SL+
Sbjct  88   GRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQVVDFSENNLSGLIPDEFFRQCGSLR  147

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+GP+ +S+
Sbjct  148  EVSFANNNLTGPIPESL  164



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ VQDP   LA+W+EDD+SPC W  V+C+P + RV+E++L G  LSG+
Sbjct  32   LNDDVLGLIVFKADVQDPKGMLASWNEDDNSPCGWMGVRCNPRSKRVTELNLDGFSLSGR  91

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +L+ L  LSLA                        +NS++G++  ++  + +L+
Sbjct  92   LGRGLLQLQFLRKLSLA------------------------RNSLNGSISSNIARIDNLR  127

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDL  NS SG + +      GSLR LSLA + F
Sbjct  128  VLDLRDNSFSGDIPEDFFRQCGSLRVLSLAKNKF  161


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            ++ +DL    LSG +  G+  L  +  L L+ N   G I   +  L NL+T+NL KN +S
Sbjct  175  IASIDLSSNRLSGSLPSGIWSLNGIRSLDLSDNFLEGEIPKAIQGLNNLRTINLGKNRLS  234

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            GTVPD +G+   L+F+DL  NS SG + ++M + L    +L+L G+SF
Sbjct  235  GTVPDGIGSCLLLRFIDLGENSFSGSLPETM-QKLSLCNYLNLHGNSF  281



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 23/154 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC+WN VKCH    RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCSWNGVKCHTRTNRVTELTLDGFSLSGR  87

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGIIN-----------------------PNLLLSLVNLK  124

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS N LSG + D      GSLR  SLA ++ 
Sbjct  125  VVDLSSNGLSGSLPDGFFRQCGSLRAFSLAKNTL  158



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL+ N  +G I+P                        +L  + +L 
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINP------------------------NLTRLENLG  125

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG + +   E+ G+LR +SLA + F
Sbjct  126  IIDLSENSLSGTIPEDFFEDCGTLRDISLAKNKF  159


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +S VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  S
Sbjct  245  LSSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFS  304

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G VP S+GN+ SL+  +LS NSLSG + +SM  N G+L  L  +
Sbjct  305  GQVPTSIGNLQSLKVFNLSANSLSGNLPESM-TNCGNLLVLDFS  347



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 106/156 (68%), Gaps = 5/156 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            +N++VLGL+VF+S + DP+  LA W+E D +PC W  V+C PA  RV  + L GLGLS  
Sbjct  30   VNEEVLGLVVFRSALTDPSGALAAWAESDATPCGWPHVECDPATSRVLRLALDGLGLSSD  89

Query  438  IG--RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
             G  RGL++L  L  LSLA NN SG + P L LL +L+ L+LS+N++SG +PD L  ++S
Sbjct  90   SGVPRGLDRLPRLQSLSLARNNLSGALRPGLSLLPSLRLLDLSRNALSGALPDDLPLLAS  149

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L++LDLS N+LSGP+  S      +LRFL ++G+  
Sbjct  150  LRYLDLSSNALSGPLPMSFPP---ALRFLVISGNRL  182



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L+ LSL+ N  +G I+P                        +L  + +L 
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINP------------------------NLTRLENLG  125

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLS NSLSG + +   E+ G+LR +SLA + F
Sbjct  126  IIDLSENSLSGTIPEDFFEDCGTLRDISLAKNKF  159


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +S VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  S
Sbjct  245  LSSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFS  304

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            G VP S+GN+ SL+  +LS NSLSG + +SM  N G+L  L  +
Sbjct  305  GQVPTSIGNLQSLKVFNLSANSLSGNLPESM-TNCGNLLVLDFS  347



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NN  G ++P                        ++ ++ +L+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTP------------------------NIAHIDNLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS NS SG V +      GSLR +SLA + F
Sbjct  127  VLDLSENSFSGDVPEEFFRQCGSLRVISLAKNKF  160



>ref|XP_008782666.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=938

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 90/154 (58%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPGSKLVSWNEDDDDPCHWLGVKCDPKTNRVTELSLVGFFLSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N LSGP+ D       S+R +SLA ++F
Sbjct  122  NLDLSENKLSGPIPDDFFGQCRSIRSISLAKNAF  155


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 61/101 (60%), Gaps = 1/101 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL     SG I  G+ KL+ L VL L+ N  +G I  Q+G   +L+ L L KNS+ G  
Sbjct  387  LDLSSNAFSGSIPEGVGKLKSLEVLDLSGNRLNGSIPSQIGGAASLKELRLGKNSLKGAX  446

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            P  +GN SSL  LDLS N+L+GP+  + L NL +L+ ++ +
Sbjct  447  PTQIGNCSSLTSLDLSQNNLTGPIPPT-LANLTNLQIINFS  486


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = +3

Query  426  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  605
            LSG +  GL  L  L  L L+ NN  G I   +  + NL++++L  N +SG +PD +G+ 
Sbjct  179  LSGSLPCGLWSLNALRSLDLSDNNLVGEIPVGISKMYNLRSISLHGNRLSGHLPDDIGDC  238

Query  606  SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
              L+ LDL+GNSLSG + +SM  NL    +LSL+ +SF
Sbjct  239  LLLKSLDLAGNSLSGSLPESM-RNLSICTYLSLSSNSF  275



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NN  G ++P                        ++ ++ +L+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTP------------------------NIAHIDNLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS NS SG V +      GSLR +SLA + F
Sbjct  127  VLDLSENSFSGDVPEEFFRQCGSLRVISLAKNKF  160



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 97/137 (71%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDV+GLIVFK+G+ DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG I
Sbjct  24   NDDVMGLIVFKAGLTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GR L +L+ L VLSL+ NNF+G I+P L  + +L+ ++LS N++SG++PD  L   +SLQ
Sbjct  84   GRSLLRLQFLKVLSLSHNNFTGNINPILSQIPSLRVIDLSHNTLSGSIPDEFLQQCTSLQ  143

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+G +  S+
Sbjct  144  SVSFANNNLTGQIPQSL  160



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  434
            LNDDVLGLIVFK+ +QDP   L++W+E+DDSPC  W  VKC+P + RVS++ L G GLSG
Sbjct  25   LNDDVLGLIVFKADIQDPDGKLSSWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLSG  84

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSS  611
            K+GRGL +L+ L  LSLA NN +G IS     L++L+ L+LS+N  SG++P D      S
Sbjct  85   KLGRGLLQLQFLRKLSLAKNNLTGSISLSFSELSDLRVLDLSENGFSGSIPSDFFSQCGS  144

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L+ + L+ N  SGP+ +S L +  +L  L+L+G+ F
Sbjct  145  LRSISLAKNRFSGPIPES-LGSCSTLAALNLSGNQF  179



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 102/150 (68%), Gaps = 3/150 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  VKC P + RVSE+ L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLTDPQSRLTSWNEEDDSACNWVGVKCDPTSNRVSELLLDGFSLSGHL  87

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQ  617
            GR L +L+ L VL L+ NNFSG I+P L  +  L+T++LS+NS+SG++P+ +     SL+
Sbjct  88   GRSLIRLQSLKVLQLSRNNFSGTINPILTQIPYLETIDLSQNSLSGSIPEEIFQQCGSLK  147

Query  618  FLDLSGNSLSG--PVSDSMLENLGSLRFLS  701
             + L+ N+L+G  P S +   NL  L F S
Sbjct  148  EISLAKNNLTGLIPQSLTSCTNLKRLNFSS  177



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP + L +W+EDDDSPC W  V C+P +  V E++L G  LSG 
Sbjct  26   LNDDVLGLIVFKADIQDPKAKLGSWNEDDDSPCGWVGVNCNPRSNAVVELNLDGFSLSGH  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL                        SKN+++G++   + ++ +L+
Sbjct  86   IGRGLLQLQSLRKLSL------------------------SKNNLTGSLSAKIAHIDNLR  121

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLSGN  SG V +      GSLR +SLAG+ F
Sbjct  122  VLDLSGNGFSGSVPEEFFRQCGSLRVVSLAGNKF  155



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  431
            LNDDVLGLIVFK+ +QDP   L +W+EDD+S C  +W  VKC+P + RV E++L+G  LS
Sbjct  23   LNDDVLGLIVFKADIQDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEINLNGFSLS  82

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  608
            G+IGRGL++L+ L  L LA+NN +G I+P + ++ NL+ L+LSKN++SG VPD       
Sbjct  83   GRIGRGLQRLQFLRRLYLANNNLTGNIAPNIAIIDNLRVLDLSKNNLSGVVPDDFFRQCG  142

Query  609  SLQFLDLSGNSLSGPVSDSM  668
            S++ + L+GN  SG +  S+
Sbjct  143  SMRVVSLAGNMFSGNIPSSL  162



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 93/159 (58%), Gaps = 24/159 (15%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC W+ + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWDGIHCNPRSNRVSQIVLDGF  82

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  602
            GLSGKI RGL +L+ L  LSLA NNF+G IS                         S+  
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSIS------------------------SSVVQ  118

Query  603  MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++ L+ LDLS N+L G +     E  G LR +SLA + F
Sbjct  119  LAYLRILDLSENNLFGTIPGDFFEQCGPLRSISLAKNKF  157



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDV GLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  30   LNDDVFGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRSNRVTELSLDGLSLSGQ  89

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSL  614
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL+ ++LS+NS+SGT+P D   +  +L
Sbjct  90   IGRGLMQLQFLHKLSLSRNCLTGSINPNLTRLENLRIIDLSENSLSGTIPEDFFKDCGAL  149

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            + + L+ N  SG +  S L +  SL  ++L+ + F
Sbjct  150  RDISLAKNKFSGKIP-STLSSCASLASINLSSNQF  183



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 92/149 (62%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP + LA+W+EDDDSPC+W  VKC P  GRV+EV L G  LSG I
Sbjct  24   NDDVLGLIVFKAGLSDPEAKLASWNEDDDSPCSWVGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L++L  LSL+ NNF+G I+P                         L ++ SLQ 
Sbjct  84   GRGLLRLQNLQRLSLSDNNFTGFINP------------------------DLPHLGSLQV  119

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLS NSLSG V +      GSLR +S A
Sbjct  120  IDLSRNSLSGSVPEEFFMQCGSLRVVSFA  148



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG I
Sbjct  39   NDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGHI  98

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GR L +L+ L VLSL+ NNF+G I+P L  + +L+ ++LS NS+SG +PD       SLQ
Sbjct  99   GRSLLRLQFLRVLSLSKNNFTGNINPILAQIPSLRVIDLSDNSLSGPIPDEFFRQCGSLQ  158

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+G + DS+
Sbjct  159  AVSFAKNNLTGQIPDSL  175



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC W  +KC+P   RV+E++L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCNWVGLKCNPRTNRVTELNLDGFSLSGR  87

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSL  614
            IGRGL +L+ L  LSL++NN +G I+P L  L +L+ ++LS N +SG++PD       SL
Sbjct  88   IGRGLLQLQFLRKLSLSNNNLTGNINPNLLSLQDLKIVDLSNNGLSGSIPDGFFRQCGSL  147

Query  615  QFLDLSGNSLSG--PVSDSMLENLGSLRFLS--LAGS  713
            + + L+ N+LSG  PVS S   +L +L   S  L+GS
Sbjct  148  RAISLANNNLSGKIPVSISSCSSLAALNLSSNHLSGS  184


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 25/129 (19%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL G GL G+I  G++ L +L VL L+ N FSG++  ++G    L+ ++LS+NS+SG +
Sbjct  198  LDLSGNGLEGEIPEGIDSLNNLRVLDLSRNRFSGLVPSEIGNCLLLKYVDLSENSLSGNL  257

Query  585  PDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  692
            PDSL                        G M SL+ LD S N  SG + DS + NL SL+
Sbjct  258  PDSLQKLNLCYFLDLGKNALEGDVPKWIGEMRSLETLDFSMNKFSGQIPDS-IGNLLSLK  316

Query  693  FLSLAGSSF  719
             L+L+ + F
Sbjct  317  TLNLSANGF  325



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG I
Sbjct  31   NDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGHI  90

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SLQ  617
             RGL +L+ L +LSL+ NNF+G I+P L  + +LQ ++LS+N++ G +PD +     SL+
Sbjct  91   DRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQVVDLSENNLYGPIPDGIFQQCWSLR  150

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+G V DS+
Sbjct  151  VVSFANNNLTGKVPDSL  167


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197  LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G +P+S+  ++S  FL L GNS +G +   + E + SL  L L+ + F
Sbjct  257  GRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGE-MKSLEVLDLSANRF  303



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG I
Sbjct  24   NDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GR L +L+ L VLSL++NNF+G I+P L  + +L+ ++LS NS+SG++PD       SLQ
Sbjct  84   GRSLLRLQFLRVLSLSNNNFTGNINPILAQIPSLRVIDLSDNSLSGSLPDDFFRQCGSLQ  143

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+G + DS+
Sbjct  144  AVSFAKNNLTGQIPDSL  160



>ref|XP_002990527.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
 gb|EFJ08404.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
Length=193

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 98/156 (63%), Gaps = 4/156 (3%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+ + DP   LA+WSED  SP  W  ++C P +G V++V L GL LSG +
Sbjct  16   NDDVLGLIVFKADLHDPRRALASWSEDSASPRNWTGIQCSPQSGTVTQVTLDGLELSGPL  75

Query  441  GRGLEKLEHLN---VLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GRGL KL+HL     L  + N  SG I   +G L+ L +L+LS NS+SG +P  LG    
Sbjct  76   GRGLLKLDHLQSLEALGASENRLSGSIPAGVGSLSRLSSLDLSHNSLSGEIPPELGQCQM  135

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L  LDLS N LSG +  S LE+L  L  L L G+SF
Sbjct  136  LVSLDLSYNLLSGEIP-SFLESLSRLEVLRLPGNSF  170



>ref|XP_008808300.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=939

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (61%), Gaps = 26/179 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCHWIGVKCDPKTNRVAELSLDGFSLSGK  85

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD---------  590
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+ L+LS+N +SG +PD         
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGSLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRFI  145

Query  591  ----------------SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
                            ++G+ S+L  LDLS N LSG +  + L +L +LR L L+ ++ 
Sbjct  146  GAISLAKNAFSGVIPPNVGSCSTLAALDLSSNRLSGSLP-AGLWSLNALRSLDLSDNAL  203


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 62/101 (61%), Gaps = 1/101 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL     SG I   + KL+ L  L L+ N  +G I  ++G   +L+ L L KNS+SG +
Sbjct  387  LDLSSNAFSGSIPESVGKLKSLEFLDLSGNRLNGSIPLEVGGAVSLKELRLEKNSLSGGI  446

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            P  +GN SSL  LDLS N+L+GP+  S L NL +L+ ++L+
Sbjct  447  PTQIGNCSSLATLDLSQNNLTGPIPPS-LANLTNLQVINLS  486



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 94/137 (69%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLI FK+G++DP   L+TW+ DD SPC W  VKC P N RVS + L G  LSG I
Sbjct  40   NDDVLGLITFKAGLEDPKGKLSTWNADDYSPCNWVGVKCDPVNNRVSSLVLDGFSLSGHI  99

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SLQ  617
             RGL KL+ L +LSL+ NNF G I+P L  + +LQ ++LS+N++SG +P+ +     SL+
Sbjct  100  DRGLLKLQFLQILSLSRNNFKGTIAPDLLGIGDLQVVDLSENNLSGLIPNEIFQQCWSLR  159

Query  618  FLDLSGNSLSGPVSDSM  668
             L  + N+L+G + DS+
Sbjct  160  VLSFANNNLTGKIPDSL  176


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 59/109 (54%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+  +DL    L G+I  G+  L  L  L L  N F+G I   +G    L+ ++ S NS+
Sbjct  205  RLQSIDLSNNLLEGEIPEGIRNLIDLRELRLGRNLFTGKIPEHIGDCLLLKMVDFSGNSL  264

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            SG +P+S+  +SS  FL L GNS +G +   + E + SL  L L+ + F
Sbjct  265  SGRLPESMQKLSSCTFLSLQGNSFTGGIPHWIGE-MKSLDILDLSANRF  312



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG I
Sbjct  31   NDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGHI  90

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS-SLQ  617
             RGL +L+ L +LSL+ NNF+G I+P L  + +LQ ++LS+N++ G +PD +     SL+
Sbjct  91   DRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQVVDLSENNLYGPIPDGIFQQCWSLR  150

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+G + DS+
Sbjct  151  VVSFANNNLTGKIPDSL  167


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197  LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            G +P+S+  ++S  FL L GNS +G +   + E + SL  L L+ + F
Sbjct  257  GRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGE-MKSLEVLDLSANRF  303



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 87/149 (58%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLI FK+G++DP + L +WS DD+ PC W  VKC P   RV+E+ L GL LSG +
Sbjct  27   NDDVLGLIFFKAGLKDPTAKLQSWSADDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGHV  86

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L  L VLSL                        SKN+++GT+   L  + SL+ 
Sbjct  87   GRGLLRLPFLQVLSL------------------------SKNNLTGTINSELSRIGSLRV  122

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLSGNSLSG + D      GSLR +S A
Sbjct  123  IDLSGNSLSGSIPDDFFTQCGSLRSISFA  151



>ref|XP_010553156.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=969

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 88/150 (59%), Gaps = 25/150 (17%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSGK  437
            NDDVLGLIVFK+G+ DP S LA+W+E+D+ PC  W  V C PA+ RV+E+ L G  LSG 
Sbjct  29   NDDVLGLIVFKAGLHDPGSKLASWNEEDNDPCINWVGVSCDPASNRVTELRLDGFSLSGH  88

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  L L++NN SG ++P                           +M SLQ
Sbjct  89   IGRGLLRLQSLQTLVLSNNNLSGALNP------------------------EFPHMGSLQ  124

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
             +D SGNSLSG + D   E  GSLR +S A
Sbjct  125  VVDFSGNSLSGRIPDGFFEQCGSLRSVSFA  154



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDV+GLIV K+G  DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG I
Sbjct  41   NDDVMGLIVLKAGFTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGHI  100

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
            GR L +L+ L VLSL++NNF+G I+P L  + +L+ ++LS N++SG++PD      SSLQ
Sbjct  101  GRSLLRLQFLKVLSLSNNNFTGNINPILSQIPSLRVIDLSHNTLSGSIPDEFFQQCSSLQ  160

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+G +  S+
Sbjct  161  SVSFANNNLTGEIPQSL  177



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  434
            LNDDVLGLIVFK+ VQDP   LA+W+E+DDSPC  W  VKC+P + RVS++ L G GLSG
Sbjct  27   LNDDVLGLIVFKADVQDPDGKLASWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLSG  86

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSS  611
            K+GRGL +L+ L  LSL+ NN +G ++     L++L+ L+LS+NS SG++P D      S
Sbjct  87   KLGRGLLQLQFLRKLSLSKNNLTGSVTLSFAQLSDLRVLDLSENSFSGSIPSDFFTQCGS  146

Query  612  LQFLDLSGNSLSGPVSDSM  668
            L+ + L+ N  SGP+ +S+
Sbjct  147  LRSISLARNKFSGPIPESL  165


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL G   SG++   ++KL   N L L  N F G +S  +G + +L++L+LS+N +SG +
Sbjct  227  IDLSGNSFSGRLPSTIQKLSLCNNLVLGKNGFEGDLSEWIGEMRSLESLDLSENGLSGRI  286

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSM  668
            PDSLG + SL+ L++S N+L+G + +SM
Sbjct  287  PDSLGKLQSLKVLNVSKNALNGSLPESM  314



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+GV+DP + L +W+E DD PC WN VKC P   RV+E+ L G  LSG+I
Sbjct  26   NDDVLGLIVFKAGVKDPDAKLVSWNESDDKPCKWNGVKCDPTTNRVTEITLDGFSLSGQI  85

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQ  617
             R L +L+ L  +SL++NN SG ++P+   L NLQ+++LS N++SG +P+ L     SL+
Sbjct  86   SRSLLRLQFLQKISLSNNNLSGTVNPEFAHLWNLQSIDLSGNNLSGFIPNELFQQCGSLK  145

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N LSG + DS+
Sbjct  146  SVSFANNVLSGELPDSL  162



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP + L++W+E+DD+PC W  VKC   + RVSE+ L G GLSG +
Sbjct  27   NDDVLGLIVFKAGLLDPEAKLSSWNEEDDTPCHWVGVKCDVRSNRVSELALDGFGLSGHV  86

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
             RGL +L+ +  LSL++NNF+G I+P                         L ++ +LQ 
Sbjct  87   NRGLLRLQVIQRLSLSNNNFTGSINP------------------------DLAHIGTLQV  122

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLS NSLSG + D   +  GSLR +S A
Sbjct  123  IDLSQNSLSGSIPDEFFQQCGSLRVVSFA  151



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 103/150 (69%), Gaps = 3/150 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G++DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLEDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGHV  87

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
             RGL +L+ L +LSL+ NNF+G+I+P L  L +LQ ++ S N++SG +P+       SL+
Sbjct  88   DRGLLRLQFLQILSLSRNNFTGLINPDLPRLGSLQAVDFSDNNLSGEIPEGFFQQCGSLR  147

Query  618  FLDLSGNSLSGPVSDSM--LENLGSLRFLS  701
             +  + N+L+G + +S+    NL ++ F S
Sbjct  148  TVSFAKNNLTGKIPESLSSCSNLATVNFSS  177


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +  +DL G  LSG++ + +++L     LSL  N+F+G I   +G L NL  L+LS NS S
Sbjct  242  LKSLDLSGNFLSGELPQSMQRLTSCTSLSLQGNSFTGGIPDWIGELKNLDMLDLSANSFS  301

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  671
            G +P SLGN+ SL  L+LS N L+G + DSML
Sbjct  302  GWIPKSLGNLDSLHRLNLSRNQLTGNLPDSML  333



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            +++   N+D+LGLIVFK+G++DP + L+TW+EDD SPC W+ VKC P+  RVS + L G 
Sbjct  23   SQNQPFNEDMLGLIVFKAGLEDPKNKLSTWNEDDYSPCNWDGVKCDPSTNRVSSLILDGF  82

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  602
             L G I RGL +L+ L +LSL+ NNF+G I   L  L NL+ ++LS+N++ GT+PD    
Sbjct  83   SLYGHINRGLMRLQFLQILSLSRNNFTGTIKNDLLTLWNLKVVDLSENNLFGTIPDGFFQ  142

Query  603  MS-SLQFLDLSGNSLSGPVSDSM  668
               SL+ L  S N+L+G + DS+
Sbjct  143  QCWSLRVLSFSKNNLTGKIPDSL  165



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDD+LGLIVFK+G++DP   L++W+EDD++PC W  VKC P+N +V+ + L G  LSG +
Sbjct  31   NDDILGLIVFKAGLKDPNHKLSSWNEDDNTPCNWEGVKCDPSNNKVTSLVLDGFSLSGHV  90

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
             RGL +L+ L +LSL  NNF+G I+P L  L  LQ ++LS N++ GT+P+       SL+
Sbjct  91   DRGLLRLQFLQILSLKGNNFTGFINPDLPKLGTLQVVDLSDNNLQGTIPEEFFQQCGSLR  150

Query  618  FLDLSGNSLSGPVSDSM  668
             +  + N+L+G + DS+
Sbjct  151  TVSFAKNNLTGKIPDSI  167


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL G  LSG I   +++L   N LSL  N+ +G I   +G L +L+ L+LS N  SG +
Sbjct  248  LDLSGNFLSGGIPNSMQRLSSCNSLSLQGNSLTGNIPDWIGELKDLEKLDLSSNRFSGLI  307

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSML  671
            P SLGN+  LQ L+ S N L G V DSM+
Sbjct  308  PKSLGNLDMLQILNFSRNQLVGNVPDSMI  336



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 93/160 (58%), Gaps = 24/160 (15%)
 Frame = +3

Query  240  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  419
            G+ +  LNDDVLGLIVFK+ +QDP   L++W+E+DDS C W  VKC P + RVSE+ L G
Sbjct  1    GSGTPSLNDDVLGLIVFKADIQDPEGKLSSWNEEDDSACNWVSVKCDPRSKRVSELSLDG  60

Query  420  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  599
              L+GK+GRGL +L+ L  LSLA NN +G +S                         SL 
Sbjct  61   FSLTGKLGRGLLQLQFLRKLSLAKNNLTGSLSL------------------------SLA  96

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             + +L+FLDLS N+ SG + +       SLR +SLA + F
Sbjct  97   QLPNLKFLDLSDNAFSGSIPNDFFTQCASLRSISLALNRF  136



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 103/150 (69%), Gaps = 3/150 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG +
Sbjct  28   NDDVLGLIVFKAGLDDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGHV  87

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
             RGL +L+ L +LSL+ NNF+G I+P L LL +LQ ++LS N++SG +P+       SL+
Sbjct  88   DRGLLRLQSLQILSLSRNNFTGSINPDLPLLGSLQVVDLSDNNLSGEIPEGFFQQCGSLR  147

Query  618  FLDLSGNSLSGPVSDSM--LENLGSLRFLS  701
             +  + N+L+G + +S+    NL S+ F S
Sbjct  148  TVSFAKNNLTGKIPESLSSCSNLASVNFSS  177



>ref|XP_009589224.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Nicotiana tomentosiformis]
Length=938

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  387  NGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKN  566
            NGRVSE++L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N
Sbjct  2    NGRVSELNLNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQN  61

Query  567  SISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGS  713
             +SG +P S+  M+SLQFLDLS NSLSGPVSD++ +N G SLR+LSL+G+
Sbjct  62   GLSGNIPASISKMTSLQFLDLSENSLSGPVSDTIFDNCGNSLRYLSLSGN  111


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  176  QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  235

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +G  P  + NMSSL++LD SGNSL G + DS + +L  L++LSL+G+  
Sbjct  236  NGDFPQWISNMSSLEYLDFSGNSLEGSLPDS-IGDLKMLKYLSLSGNKL  283



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 90/154 (58%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP   LA+WSE D+SPC W  VKC+P + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLASWSEVDNSPCNWVGVKCNPRSNRVIELSLDDFSLSGH  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NN +G ++P                        +  ++ +L+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTP------------------------NFTHIDNLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS NS SG V + +    GSLR +SLA + F
Sbjct  127  VLDLSENSFSGGVPEELFRQCGSLRVISLAKNKF  160



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 88/154 (57%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIV K+ +QDP   LA+WSE D SPC W  VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVLKADIQDPKGKLASWSEVDSSPCNWVGVKCHPRSNRVIELSLDDFSLSGH  90

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL +L+ L  LSL+ NN +G ++P                        +  ++ +L+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTP------------------------NFTHIDNLR  126

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS NS SG V + +    GSLR +SLA + F
Sbjct  127  VLDLSENSFSGGVPEELFRQCGSLRVISLAKNKF  160



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LND+V+GLIVFK+ ++DP + LA+W+E D +PC W  V+C P   RV  + L  L LSG 
Sbjct  49   LNDEVMGLIVFKAALEDPTAALASWNEADATPCGWAHVRCDPRTSRVVRLALDSLSLSGP  108

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            + RGL++L  L  LSL++NN SG + P L LL  L++L+LS+NS SG++P  L  + S+ 
Sbjct  109  LPRGLDRLPALASLSLSNNNLSGPVPPGLSLLPALRSLDLSRNSFSGSLPGDLAFLPSIV  168

Query  618  FLDLSGNSLSGPVSDSMLE--NLGSLRFLSLAGSSF  719
             LDLS N+LSGP+ DS+      GSLRFLSLAG+  
Sbjct  169  SLDLSSNALSGPLPDSLFSAATCGSLRFLSLAGNRL  204


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+  + L+G   SG I  G+    HL++L L+ N+F G +   +  L +L +L LS N +
Sbjct  267  RLRNLQLNGNRFSGTIPAGVGLCRHLSILDLSYNSFEGALPSSMRYLGSLTSLKLSDNQL  326

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            SG VP  +GN++++Q +DLS N L+G +  S L  L  + +LSL+
Sbjct  327  SGDVPAWIGNLTTIQQVDLSNNKLAGNLPAS-LGGLKEVNYLSLS  370



>ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
Length=964

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 89/154 (58%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +L+ L  LSLA+NN +G +SP                              +L+
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNN------------------------ARFENLR  120

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLSGN   G + D      GSLR +SLA +  
Sbjct  121  VVDLSGNGFHGMIPDDFFRQCGSLRVISLANNKI  154


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = +3

Query  408  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  587
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALVNLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  588  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +S+G + +L FLDLS N L+G + +++  ++ SL+ L L 
Sbjct  423  ESIGGLKALVFLDLSENQLNGSIPETLGRDV-SLKELRLG  461



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 89/154 (58%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +L+ L  LSLA+NN +G +SP                              +L+
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNN------------------------ARFENLR  120

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLSGN   G + D      GSLR +SLA +  
Sbjct  121  VVDLSGNGFHGMIPDDFFRQCGSLRVISLANNKI  154


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = +3

Query  408  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  587
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALVNLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  588  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +S+G + +L FLDLS N L+G + +++  ++ SL+ L L 
Sbjct  423  ESIGGLKALVFLDLSENQLNGSIPETLGRDV-SLKELRLG  461



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 87/149 (58%), Gaps = 24/149 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLI FK+G+ DP + L +WSEDD+ PC W  VKC P   RV+E+ L GL LSG +
Sbjct  24   NDDVLGLIFFKAGLDDPNAKLQSWSEDDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGHV  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L VLSL++NN +G I+                          L ++ SL+ 
Sbjct  84   GRGLLRLQFLQVLSLSNNNLTGPIN------------------------SELSHIGSLKV  119

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +DLSGNSLSG + D      GSL  +S A
Sbjct  120  IDLSGNSLSGLIPDDFFAQCGSLGSVSFA  148



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 26/156 (17%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  431
            LNDDVLGLIVFK+ ++DP   L +W+EDD+S C  +W  VKC+P + RV EV+L+G  LS
Sbjct  39   LNDDVLGLIVFKADIKDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEVNLNGFSLS  98

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G+IGRGL++L+ L  L L +NN +G I+                         ++  + +
Sbjct  99   GRIGRGLQRLQFLRRLYLGNNNLTGSINA------------------------NIATIDN  134

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L+ LDLS N+LSG V D      GS+R +SLA + F
Sbjct  135  LRVLDLSNNNLSGVVPDDFFRQCGSMRVVSLARNRF  170



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 88/154 (57%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E+ L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELHLDGFALNGR  84

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +L+ L  LSLA+NN +G +SP                              +L+
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNN------------------------ARFENLR  120

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             +DLSGN   G + D      GSLR +SLA +  
Sbjct  121  VVDLSGNGFHGMIPDDFFRQCGSLRVISLANNKI  154


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +3

Query  408  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  587
            D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366  DIKRSSLSTTVGKALANLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  588  DSLGNMSSLQFLDLSGNSLSGPVSDSM  668
            +S+G++ +L FLDLS N L+G + +++
Sbjct  423  ESIGDLKALVFLDLSENQLNGSIPETL  449



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 96/148 (65%), Gaps = 3/148 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG I
Sbjct  37   NDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGHI  96

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
             RGL +L+ L  LSL+ NNF+G I+P L  L +LQ ++ S N++ GT+P+       SL+
Sbjct  97   DRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQQCGSLK  156

Query  618  FLDLSGNSLSG--PVSDSMLENLGSLRF  695
             ++ + N+L+G  PVS      L ++ F
Sbjct  157  TVNFAKNNLTGNIPVSLGTCNTLANVNF  184


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +  +DL G  LSG I + +++L   N LSL  N+F+G I   +G L +L+ L+LS N  S
Sbjct  251  LKSLDLSGNLLSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFS  310

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  671
            G +P SLGN++ LQ L+ S N L+G + DSM+
Sbjct  311  GWIPKSLGNLNMLQRLNFSRNQLTGNLPDSMM  342



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 96/148 (65%), Gaps = 3/148 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG I
Sbjct  31   NDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGHI  90

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMSSLQ  617
             RGL +L+ L  LSL+ NNF+G I+P L  L +LQ ++ S N++ GT+P+       SL+
Sbjct  91   DRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQQCGSLK  150

Query  618  FLDLSGNSLSG--PVSDSMLENLGSLRF  695
             ++ + N+L+G  PVS      L ++ F
Sbjct  151  TVNFAKNNLTGNIPVSLGTCNTLANVNF  178


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +3

Query  396  VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  575
            +  +DL G  LSG I + +++L   N LSL  N+F+G I   +G L +L+ L+LS N  S
Sbjct  245  LKSLDLSGNLLSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFS  304

Query  576  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  671
            G +P SLGN++ LQ L+ S N L+G + DSM+
Sbjct  305  GWIPKSLGNLNMLQRLNFSRNQLTGNLPDSMM  336



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 85/151 (56%), Gaps = 24/151 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDV GLIVFK+G+QDP   L +W+EDD++P  W  VKC     RVSE+ L G  LSG I
Sbjct  24   NDDVWGLIVFKAGLQDPEEKLISWNEDDENPSKWVGVKCDSQTNRVSELSLDGFSLSGHI  83

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
             +GL +L+ L  LSL+ NNFSG I+P                         L ++  LQ 
Sbjct  84   DKGLLRLQFLQKLSLSKNNFSGTINP------------------------DLPHLGGLQV  119

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            +DLS N LSG + D   +  GSLR +S AG+
Sbjct  120  IDLSENRLSGQIPDEFFQQCGSLREVSFAGN  150



>emb|CBI25352.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (67%), Gaps = 5/142 (4%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  438  IGRGLEKLE-----HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  602
            IGRGL +L       L  +  +SN FSG +   +  L  L++L+LS N + G +P  + +
Sbjct  86   IGRGLLQLHVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDS  145

Query  603  MSSLQFLDLSGNSLSGPVSDSM  668
            + +L+ ++LS N  SGP+ D +
Sbjct  146  LYNLRAINLSKNRFSGPLPDGI  167



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C PA+ RVSE+ L    LSG I
Sbjct  26   NDDVLGLIVFKSGLDDPLSKLSSWNSEDYDPCNWVGCTCDPASNRVSELRLDSFSLSGHI  85

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L+ L L++NN +G ++P                           ++ SLQ 
Sbjct  86   GRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGSLQV  121

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +D SGNSLSG + D   E  GSLR +SLA +  
Sbjct  122  VDFSGNSLSGRIPDGFFEQCGSLRSVSLANNKL  154



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 93/165 (56%), Gaps = 24/165 (15%)
 Frame = +3

Query  225  TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  404
              G G A +  L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ 
Sbjct  19   AKGGGPASAAALDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAG  78

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            + L G GLSGK+GRGL +LE L  LSL+ NNF                        SG +
Sbjct  79   LSLAGFGLSGKLGRGLLRLESLQSLSLSGNNF------------------------SGDL  114

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P  L  +  LQ LDLS N+ SG + D    +  +LR +SLA ++F
Sbjct  115  PADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAF  159



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 87/153 (57%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C P + RV+E+ L G  LSG I
Sbjct  27   NDDVLGLIVFKAGLDDPYSKLASWNAEDYDPCNWAGCVCDPGSNRVTELRLDGFSLSGHI  86

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L+ L L++NN +G ++P                           ++ +LQ 
Sbjct  87   GRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGTLQV  122

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            LD SGN+LSG + D   E  GSLR +SLA +  
Sbjct  123  LDFSGNNLSGRIPDGFFEQCGSLRSVSLANNQL  155



>ref|XP_003605286.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87483.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=866

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 106/157 (68%), Gaps = 4/157 (3%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            +++   N+D+LGLIVFK+G++DP + L++W+EDD SPC W  VKC P+  RVS + L G 
Sbjct  22   SQNQPFNEDMLGLIVFKAGLEDPKNKLSSWNEDDYSPCNWEGVKCDPSTNRVSSLVLDGF  81

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDSLG  599
             LSG IG+ L +L+ L +LSL+ NNF+G I+  L +   NL+ ++LS+N++ GT+PD L 
Sbjct  82   SLSGHIGKSLMRLQFLQILSLSRNNFTGRINHDLLITLWNLKVVDLSENNLVGTIPDELF  141

Query  600  NMS-SLQFLDLSGNSLSGPVSDSM--LENLGSLRFLS  701
                SL+ L  + N+L+G + DS+    +L SL F S
Sbjct  142  KQCWSLRVLSFAKNNLTGTIPDSLSSCYSLASLNFSS  178



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score =   117 bits (292),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 98/150 (65%), Gaps = 3/150 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S L +W+E+DDS C W  V+C     RVSE+ L G  LSG +
Sbjct  39   NDDVLGLIVFKAGLTDPLSRLTSWNEEDDSACNWVGVRCDQDTNRVSELILDGFSLSGHL  98

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL-GNMSSLQ  617
            GR L +L+ L VL L+ NNFSG ++P L  + +LQ ++L++NS+SG +P+ L     SL 
Sbjct  99   GRSLIRLQFLRVLQLSRNNFSGSVNPILAQIPSLQVIDLTENSLSGFIPEELFQQCGSLN  158

Query  618  FLDLSGNSLSG--PVSDSMLENLGSLRFLS  701
             + L+ N+L+G  P S S   NL  L F S
Sbjct  159  SISLAKNNLTGSIPPSLSSCSNLERLNFSS  188



>ref|XP_009125388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=925

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 88/155 (57%), Gaps = 24/155 (15%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  22   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  81

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  602
             LSG IGRGL +L+ L+ L L++NN +G ++                          L +
Sbjct  82   SLSGHIGRGLLRLQSLHTLVLSNNNLTGALN------------------------SELTH  117

Query  603  MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
              +LQ LD SGN+LSG + D + E  GSLR +SL 
Sbjct  118  RGTLQLLDFSGNNLSGRIPDGLFEQCGSLRSVSLG  152



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 86/153 (56%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S L++W+ +D  PC W    C PA  RVSE+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGHI  84

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L+ L L++NN +G ++P                           ++ SLQ 
Sbjct  85   GRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGSLQV  120

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +D SGN+LSG + D   E  GSLR +SLA +  
Sbjct  121  VDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKL  153



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 105/156 (67%), Gaps = 1/156 (1%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            +++D+V+ L+VFK+GV DP S L++W++ D  PC W  + C  A GRV+++ L GL LSG
Sbjct  35   RISDEVMALLVFKAGVIDPNSVLSSWNDIDMDPCHWTGITCSSATGRVTDITLVGLSLSG  94

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
             I R L KLE L  L+LA+NNF+G ++ +L   ++L+ LN+S N++SG++P S G+  +L
Sbjct  95   TIARALVKLEELQTLTLANNNFTGPLNGELAEFSDLKVLNVSHNALSGSIPASFGSAGNL  154

Query  615  QFLDLSGNSLSGPVSDSMLE-NLGSLRFLSLAGSSF  719
              LDLS N+ +G +   +   N  SLR +S++ +S 
Sbjct  155  YALDLSNNAFTGTLPPELFSYNCQSLRIVSVSVNSL  190



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 105/161 (65%), Gaps = 8/161 (5%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            + +N++VLGL+VF+S + DP+  L+ WSE D +PC W  V+C PA  RV  + L  L LS
Sbjct  35   MPVNEEVLGLVVFRSALADPSGALSAWSESDATPCGWAHVECDPATSRVLRLSLDNLFLS  94

Query  432  -----GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  596
                 G I RGL++L  L  LSLA NNFSG +SP L LL +L++L+LS N+ SG +P+  
Sbjct  95   STSGTGGIPRGLDRLPALQSLSLAGNNFSGNLSPGLSLLASLRSLDLSHNAFSGNLPEDF  154

Query  597  GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
              + +L++LDL+ NS SG +  S      +LRFL L+G++F
Sbjct  155  PFLPALRYLDLTANSFSGSLPTSFPS---TLRFLMLSGNAF  192


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 1/109 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+  +DL    LSG +  G+  L +L  + L+ N FSG I   +GL  +L  ++LS N+ 
Sbjct  231  RLRALDLSNNRLSGPVAAGIASLHNLKTVDLSGNRFSGAIPADIGLCPHLSRIDLSSNAF  290

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             G +P S+G +SSL F   SGN LSG V  S    L +L+ L L+ ++ 
Sbjct  291  DGALPGSIGALSSLVFFSASGNRLSGQVP-SWFGGLTALQHLDLSDNTL  338



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 2/160 (1%)
 Frame = +3

Query  234  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  413
            A G     LND+VLGLIVFKS ++DP + LA+WSE D + C W  V+C PA   V  + L
Sbjct  25   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDATACGWAHVECDPATSHVLRLYL  84

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  85   DSLSLSGPLPRGLDRLPYLESLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  144

Query  594  LGNMSSLQFLDLSGNSLSGPVSDSMLE--NLGSLRFLSLA  707
            LGN+++L+ LDLS NSLSGP+ DS+       SLR+LSLA
Sbjct  145  LGNITNLRSLDLSSNSLSGPIPDSLFSAATCSSLRYLSLA  184



>emb|CBI18033.3| unnamed protein product [Vitis vinifera]
Length=808

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 93/139 (67%), Gaps = 3/139 (2%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+I
Sbjct  24   NDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGRI  83

Query  441  GRGLEKLEHLNVLS---LASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            GRGL +L+ L +LS    +SN  SG +   +  L  L++L+LS N + G +P+ +G++ S
Sbjct  84   GRGLLRLQFLRILSGVNFSSNQLSGQLPDGIWSLYGLRSLDLSNNFLEGEIPEGIGSLYS  143

Query  612  LQFLDLSGNSLSGPVSDSM  668
            L+ ++L  N  SG + DS+
Sbjct  144  LRAINLGKNKFSGRIPDSI  162



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 89/162 (55%), Gaps = 24/162 (15%)
 Frame = +3

Query  234  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  413
            A   ++   NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C P+  RV+E+ L
Sbjct  21   AAAGQNPTFNDDVLGLIVFKSGLHDPLSKLSSWNSEDLDPCNWLGCICDPSTNRVTELRL  80

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
             G  LSG IGRGL +L  L+ L L++NN +G ++P                         
Sbjct  81   DGFSLSGHIGRGLLRLNFLHTLLLSNNNLTGTLNP------------------------E  116

Query  594  LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
              ++ SLQ LD SGN+LSG + D+  +  GSLR +S A +  
Sbjct  117  FPHLGSLQVLDFSGNNLSGRIPDAFFQQCGSLRSVSFANNKL  158



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 89/164 (54%), Gaps = 24/164 (15%)
 Frame = +3

Query  228  SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  407
            +G G      LNDDVLGLIVFK+ V DP   LATWSEDD+  CAW  V C P   RVS +
Sbjct  20   AGRGAGSVAALNDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGVTCDPRTSRVSGL  79

Query  408  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  587
             L G GLSGK+GRGL +LE L  LSL+ NNF                        SG +P
Sbjct  80   SLDGFGLSGKLGRGLLRLESLQSLSLSRNNF------------------------SGDLP  115

Query  588  DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
              L  +  LQ LDLS N+ SG V D       SLR +SLA ++F
Sbjct  116  ADLARLPDLQSLDLSSNAFSGAVPDGFFGKCHSLRDVSLANNAF  159



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 85/153 (56%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L+ L L++NN +G ++P                            + SLQ 
Sbjct  85   GRGLLRLQFLHTLVLSNNNLTGNLNP------------------------EFPRLGSLQV  120

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++ SGN+LSG + D   E  GSLR +SLA +  
Sbjct  121  INFSGNNLSGRIPDGFFEQCGSLRSVSLANNKL  153



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 89/154 (58%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLSLAGFGLSGK  89

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +LE L  LSL+ NNF                        SG +P  L  +  LQ
Sbjct  90   LGRGLLRLESLQSLSLSGNNF------------------------SGDLPADLARLPDLQ  125

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N+ SG + D    +  +LR +SLA ++F
Sbjct  126  SLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAF  159



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 88/153 (58%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +LE L  LSL++NNFSG I P                         L  +  LQ 
Sbjct  91   GRGLLRLESLPSLSLSANNFSGDIPP------------------------DLARLPDLQS  126

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            LDLS N+ SG + D       +LR +SLA ++F
Sbjct  127  LDLSSNAFSGAIPDGFFGKCHALRDVSLANNAF  159



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 87/152 (57%), Gaps = 24/152 (16%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVVDPEGRLATWSEDDERPCAWASVTCDPLTGRVAGLSLAGFGLSGKLG  91

Query  444  RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  623
            RGL +LE L  LSL+ NNFSG                         +P  L  +  LQ L
Sbjct  92   RGLLRLESLQSLSLSRNNFSG------------------------DLPADLARLPDLQSL  127

Query  624  DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            DLS N+ SG + D    +  SLR +SLA ++F
Sbjct  128  DLSSNAFSGAIPDGFFGHCRSLRDISLANNAF  159



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 88/153 (58%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +LE L  LSL++NNFSG I P                         L  +  LQ 
Sbjct  91   GRGLLRLESLQSLSLSANNFSGDIPP------------------------DLARLPDLQS  126

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            LDLS N+ S P+ +       +LR +SLA ++F
Sbjct  127  LDLSCNAFSAPIPEGFFGKCHALRDVSLANNAF  159



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 82/153 (54%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L  L L++NN +G I+P                           ++ SLQ 
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTINP------------------------EFPHLGSLQV  120

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +D SGN LSG + +   E  GSL  +S A +  
Sbjct  121  VDFSGNHLSGRIPEGFFEQCGSLSSVSFANNKL  153



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +3

Query  348  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  527
            SPC+W +VKC+P   RV+E+ L GL L+GKIGRG++KL+HL VLSL++NN +G I+  L 
Sbjct  2    SPCSWTYVKCNPKTSRVTELSLSGLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALS  60

Query  528  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
               +LQ L+LS NS+SG +  SL   +SL++LDL+GNS SG +SD +  N  SLR LSL+
Sbjct  61   NNNHLQKLDLSHNSLSGQISSSL---TSLRYLDLTGNSFSGTLSDDVFTNCSSLRHLSLS  117

Query  708  GSSF  719
             + F
Sbjct  118  HNRF  121



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 88/154 (57%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L   GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPITGRVAGLSLACFGLSGK  89

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            +GRGL +LE L  LSL+ NNF                        SG +P  L  +  LQ
Sbjct  90   LGRGLLRLESLQSLSLSGNNF------------------------SGDLPADLARLPDLQ  125

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N+ SG + D    +  +LR +SLA ++F
Sbjct  126  SLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAF  159



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 82/153 (54%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L  L L++NN +G ++P                           ++ SLQ 
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTLNP------------------------EFPHLGSLQV  120

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +D SGN LSG + +   E  GSL  +S A +  
Sbjct  121  VDFSGNHLSGRIPEGFFEQCGSLSSVSFANNKL  153



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 82/153 (54%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGHI  84

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L  L L++NN +G ++P                           ++ SLQ 
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTLNP------------------------EFPHLGSLQV  120

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +D SGN LSG + +   E  GSL  +S A +  
Sbjct  121  VDFSGNHLSGRIPEGFFEQCGSLSSVSFANNKL  153



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 82/153 (54%), Gaps = 24/153 (16%)
 Frame = +3

Query  261  NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  440
            NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG I
Sbjct  25   NDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDSFSLSGHI  84

Query  441  GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            GRGL +L+ L  L L++NN +G ++P                           ++ SLQ 
Sbjct  85   GRGLLRLQFLRALVLSNNNLTGTLNP------------------------EFPHLGSLQV  120

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +D SGN LSG + +   E  GSL  +S A +  
Sbjct  121  VDFSGNHLSGRIPEGFFEQCGSLSSVSFANNKL  153



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 88/150 (59%), Gaps = 24/150 (16%)
 Frame = +3

Query  270  VLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRG  449
            VLGLIVFK+ ++DP   L +W+EDD+  C W  VKC+P + RVSE++L GL LSGK+GRG
Sbjct  36   VLGLIVFKADIKDPNGKLRSWNEDDNDSCKWYGVKCNPRSNRVSELNLDGLSLSGKLGRG  95

Query  450  LEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDL  629
            L +L+ L  LSL++NN +G +S                         +L  +++L+ LDL
Sbjct  96   LLQLQSLRKLSLSNNNLTGSLS------------------------SALVRLTNLRILDL  131

Query  630  SGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            S N+ SG +S       G LR ++LA + F
Sbjct  132  SDNNFSGVMSSDFFRQCGPLRSINLANNKF  161



>emb|CDP13903.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 101/184 (55%), Gaps = 31/184 (17%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL-----  422
            +NDDVLGLIVFK+ VQDP   LA+W+EDD+SPC WN V+C+P + RVSE+ L GL     
Sbjct  1    MNDDVLGLIVFKADVQDPQGKLASWNEDDESPCIWNGVQCNPRSNRVSELVLDGLSLADN  60

Query  423  GLSGKIGRGLEKLEHLNV-------------------------LSLASNNFSGVISPqlg  527
             L+G +   L +L +L                           LSLA N FSG I   L 
Sbjct  61   NLTGSLTLSLGQLPNLRTLDLSGNSLSGPISSDFFQQCGSLRSLSLAKNKFSGQIPASLS  120

Query  528  lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
              + L +LN+S N  SG +P  + +M +L+ LDLS N L G +    +E L +LR L+L 
Sbjct  121  SCSMLTSLNISSNQFSGQLPAGVWSMRALRTLDLSDNMLEGEIPKG-IEGLTALRALNLR  179

Query  708  GSSF  719
             + F
Sbjct  180  KNRF  183



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 98/178 (55%), Gaps = 27/178 (15%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  444  RGLEKLEHLNVLSLASNNFSGVISPqlgll--------------------------tnlq  545
            R L +L+ L  LSL  NN SG + P L                              +++
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRSLDLSSNRLAAPVPAELFAQCRSIR  148

Query  546  tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             L+L++N +SG +P ++ + +SL  L+LS N L+GP+ D  L +L SLR L L+G+  
Sbjct  149  ALSLARNELSGYIPPAVTSCASLVSLNLSSNRLAGPIPDG-LWSLPSLRSLDLSGNEL  205



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 98/178 (55%), Gaps = 27/178 (15%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVL L+VFK+GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  444  RGLEKLEHLNVLSLASNNFSGVISPqlgll--------------------------tnlq  545
            R L +L+ L  LSL  NN SG + P L                              +++
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRSLDLSSNRLAAPVPAELFAQCRSIR  148

Query  546  tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             L+L++N +SG +P ++ + +SL  L+LS N L+GP+ D  L +L SLR L L+G+  
Sbjct  149  ALSLARNELSGYIPPAVTSCASLVSLNLSSNRLAGPIPDG-LWSLPSLRSLDLSGNEL  205



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = +3

Query  306  DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSL  485
            DP   LA+WSED  SPC W  ++C P +GRV++V L GL LSG +GRGL KL+HL VLSL
Sbjct  1    DPRRALASWSEDSASPCNWTGIQCSPQSGRVTQVTLDGLELSGPLGRGLLKLDHLQVLSL  60

Query  486  ASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-DSLGNMSSLQFLDLSGNSLSGPVSD  662
            A NN SG ISPQ+ +L +L+ L+LS N++SG +P  SL ++  L  LD+S NS SG V  
Sbjct  61   ARNNLSGSISPQIRVLKSLRNLSLSHNALSGPLPGASLASLELLSLLDVSHNSFSGSVPP  120

Query  663  SMLENLG-SLRFLSLAGSSF  719
             +  N   SLR++ L+G+  
Sbjct  121  ELFANCSKSLRYVFLSGNQL  140



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            AE    NDDVLGLIVFK+G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  23   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  82

Query  423  GLSGKIGRGLEKLEHLNVLSL--ASNNFSGVISPqlglltnlqtlnlS--KNSISGTVPD  590
             LSG IGRGL +L+ L+ L L  + NN SG I P           ++S  +N ++G +P 
Sbjct  83   SLSGHIGRGLLRLQSLHTLLLDFSGNNLSGRI-PDGFFEQCGSLRSVSLGRNRLTGPLPV  141

Query  591  SLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSL  689
            SL   S+L  L+LS N LSG  P   S L++L SL
Sbjct  142  SLSYCSTLTHLNLSSNQLSGRLPRELSFLKSLKSL  176



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 102/177 (58%), Gaps = 28/177 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  438  IGRGLEKLE---------------------------HLNVLSLASNNFSGVISPqlgllt  536
            IGRGL +L                             L V S+A N  +G I   +G  +
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSGSLPDGFFRQCGSLRVFSVAENKLTGKIPVSVGSCS  148

Query  537  nlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            +L +LNLS N  SG++P  + ++++L+ LDLS N L G +  + +  L +LR + L+
Sbjct  149  SLASLNLSSNRFSGSMPLGIWSLNTLRSLDLSRNELEGELG-TKIGRLNNLRAIDLS  204



>ref|XP_001759642.1| predicted protein [Physcomitrella patens]
 gb|EDQ75554.1| predicted protein [Physcomitrella patens]
Length=901

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 94/156 (60%), Gaps = 2/156 (1%)
 Frame = +3

Query  240  GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  419
            GAE++   D+   L+ FK+ + D  S L TW  +D  PC W+ + C   N  V+ ++L  
Sbjct  30   GAEAIA-TDEGWALLDFKNAISDSRSTLRTWKSEDSYPCEWSGISCD-KNSHVTSINLRN  87

Query  420  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  599
             GLSG I   L +L  L +L L+ NNFSG I PQL  + +L  L L  N+++G++P  L 
Sbjct  88   AGLSGTIALELHRLRKLRILILSENNFSGPIPPQLSEIGSLWKLKLDHNNLTGSIPGELS  147

Query  600  NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            ++S+L+  DLS N+LSGP++D++      LRF+S A
Sbjct  148  HLSNLRIFDLSYNALSGPINDTIFRTCRRLRFVSFA  183



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 94/159 (59%), Gaps = 24/159 (15%)
 Frame = +3

Query  243  AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  422
            A +L  NDD+LGL+VFK+ +QDP  +L +W+E+DDSPC WN +KC+P + RVS++ L G 
Sbjct  21   ALNLSFNDDILGLMVFKADIQDPLGNLVSWNEEDDSPCNWNGIKCNPRSNRVSQIVLDGF  80

Query  423  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  602
            GLSGKI RGL +L+ L  LSLA NNF+G                    SIS TV      
Sbjct  81   GLSGKISRGLLRLQLLRKLSLAKNNFTG--------------------SISSTVVQ----  116

Query  603  MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            + +L+ LDLS N+  G +        G LR +SLA + F
Sbjct  117  LDNLRVLDLSENNFFGLIPGDFFRQCGPLRSVSLAKNKF  155



>ref|XP_002439964.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
 gb|EES18394.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
Length=944

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            ++DDVL L+V KSG+ DP+  LA WSED D  CAW  V C P  GRV+ +DL    L+G+
Sbjct  47   VSDDVLALVVLKSGLSDPSGRLAPWSEDADRACAWPGVSCDPRTGRVAALDLPAASLAGR  106

Query  438  IGR-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
            + R  L +L+ L  L+L  N  SG +     L   L+ L+LS N+ISG +P SL +  SL
Sbjct  107  LPRSALLRLDALVSLALPGNRLSGALP--DALPPRLRALDLSGNAISGGIPASLASCDSL  164

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
              L+LS N L+GPV D +  +L SLR + L+G+
Sbjct  165  VSLNLSRNRLTGPVPDGIW-SLPSLRSVDLSGN  196


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +3

Query  390  GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  569
             R+  ++L    +SG++   +  +  L VL +++N F GV+ P++G    L+ L + +NS
Sbjct  377  ARLQYLNLSSNSMSGQLPASIGLMLVLEVLDVSANKFEGVVPPEIGGAMALRQLLMGRNS  436

Query  570  ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            ++G +P  +G   SL  LDLS N L+GP+  SM  NL SL+ + L+
Sbjct  437  LTGGIPVQIGTCKSLIALDLSHNKLAGPIPMSM-GNLASLQTVDLS  481



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 83/154 (54%), Gaps = 24/154 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            ++DDVLGL+ FK+G+ DP   L +W EDD SPCAW  + C    GRVSE++L G  L G+
Sbjct  13   MSDDVLGLMAFKAGLHDPTEALRSWREDDASPCAWAGIVCDRVTGRVSELNLVGFSLIGQ  72

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            IGRGL KL+ L  L+L+ NN +G I                           +  +  L 
Sbjct  73   IGRGLIKLDELQTLNLSFNNLTGSID------------------------AEVARLPILV  108

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N+++GP+++    +  SL  L L G+S 
Sbjct  109  LLDLSNNAMTGPMAEDFFTSCQSLVSLYLVGNSL  142



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 100/177 (56%), Gaps = 28/177 (16%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  438  IGRGLEKLE--HLNVLSLASNNFSGVISPq-lglltnlqtlnlSKNSISGTVPDSLG---  599
            IGRGL +L    L V+ L+ N  SG +         +L+  ++++N ++G +P S+G   
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSGSLPDGFFRQCGSLRAFSVAENKLTGKIPVSVGSCS  148

Query  600  ---------------------NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
                                 ++++L+ LDLS N L G    + +  L +LR + L+
Sbjct  149  SLASLNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEGEFG-TKIGRLNNLRAIDLS  204



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  434
            LNDDVLGLIVFK+ ++DP   L++W+EDDDSPC  W  VKC+P + RVSE+ L G GLSG
Sbjct  25   LNDDVLGLIVFKADIRDPDQKLSSWNEDDDSPCNNWIGVKCNPRSNRVSELVLDGFGLSG  84

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV-PDSLGNMSS  611
            K+GRGL +L+ L  LSLA NN +G +S  L  L++L+ L+LS+N + G++  D      S
Sbjct  85   KLGRGLLQLQSLQKLSLAKNNLTGSLSLSLAQLSDLRVLDLSENGLWGSISSDFFMQCGS  144

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L+ + L+ N  SGP+ +S L +  +L  L+ +G+ F
Sbjct  145  LRSISLARNKFSGPIPES-LGSCSTLTSLNFSGNQF  179



>ref|XP_004961741.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=942

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 93/153 (61%), Gaps = 4/153 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            ++DDVL L+V KSG+ DPA  LA WSED D  C+W  V C P  GRV+ ++L    L+G+
Sbjct  46   VSDDVLALVVLKSGLSDPAGRLAPWSEDADRACSWPGVSCDPRTGRVAALELPAASLAGR  105

Query  438  IGR-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
            + R  L +L+ L  L+L  N  SG +     L   L+ L+LS N+IS  +P SL +  SL
Sbjct  106  LPRSALLRLDALVSLALPGNRLSGALP--DALPPRLRALDLSGNAISSGIPASLASCESL  163

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
              L+LS N L+GPV D +  +L SLR +  +G+
Sbjct  164  VSLNLSRNQLTGPVPDGIW-SLPSLRSVDFSGN  195



>ref|NP_001055847.2| Os05g0478300 [Oryza sativa Japonica Group]
 gb|AAT01367.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17761.2| Os05g0478300 [Oryza sativa Japonica Group]
Length=917

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 94/155 (61%), Gaps = 4/155 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            +NDDVL L+VFKSGV DP   LA WSED D  CAW  V C    GRV  V L   GLSG+
Sbjct  23   VNDDVLALVVFKSGVSDPGGVLAAWSEDADRACAWPGVSCDARAGRVDAVALPSAGLSGR  82

Query  438  IGRG-LEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
            + R  L +L+ L  L+L  NN SG +     L    + L+LS NS+SG +P +L +  SL
Sbjct  83   LPRSALLRLDALLSLALPGNNLSGPLP--DALPPRARALDLSANSLSGYLPAALASCGSL  140

Query  615  QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
              L+LSGN LSGPV D +  +L SLR L L+G+  
Sbjct  141  VSLNLSGNLLSGPVPDGIW-SLPSLRSLDLSGNQL  174



>ref|XP_001763904.1| predicted protein [Physcomitrella patens]
 gb|EDQ71308.1| predicted protein [Physcomitrella patens]
Length=796

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 94/154 (61%), Gaps = 1/154 (1%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            ++ D   L+ FK G+ DP   L +W+  D  PC W  V C+  + +V  + L G  LSG 
Sbjct  35   VSSDGEALLAFKVGLDDPTGILNSWNGADPYPCLWYGVTCN-EDLKVQRLLLQGTQLSGS  93

Query  438  IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  617
            I   L  L  L  L L+ NNFSG +  +LGL+ +L  LN+S+N++SG +P SLGN+S L+
Sbjct  94   ISPVLRNLTELRTLVLSRNNFSGPLPTELGLIGSLWKLNVSENALSGALPASLGNLSRLR  153

Query  618  FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             LDLS N+LSG +  ++  N  +LR++SLA + F
Sbjct  154  MLDLSKNALSGQIPPALFRNCETLRYISLAENRF  187



>ref|XP_008649763.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Zea mays]
 gb|AFW78385.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=938

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 92/151 (61%), Gaps = 4/151 (3%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVL L+V KSG+ DPA  LA WSED D  CAW  V C     RV+ +DL    L+G++ 
Sbjct  44   DDVLALVVLKSGLFDPAGRLAPWSEDADRACAWPGVSCDSRTDRVAALDLPAASLAGRLP  103

Query  444  R-GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  620
            R  L +L+ L  L+L  N  SG +     L   L++L+LS N+ISG +P SL +  SL  
Sbjct  104  RAALLRLDALVSLALPGNRLSGTLP--DALPPRLRSLDLSGNAISGGIPASLASCESLVS  161

Query  621  LDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  713
            L+LS N L+GPV D +  +L SLR + L+G+
Sbjct  162  LNLSRNRLTGPVPDGIW-SLPSLRSVDLSGN  191



>ref|XP_001775671.1| predicted protein [Physcomitrella patens]
 gb|EDQ59474.1| predicted protein [Physcomitrella patens]
Length=798

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 94/156 (60%), Gaps = 1/156 (1%)
 Frame = +3

Query  252  LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  431
            + +N D   L+ FK+G+ DP   L +W++ D  PC+W+ V C+  N RV  + L    LS
Sbjct  33   VAVNPDGKALLAFKAGLDDPTGILNSWNDADPYPCSWDGVTCN-ENLRVQLILLQDTQLS  91

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G I   L  L  L  L L+ NNF G +  ++G + +L  LN+S N++SG++P SLGN+S 
Sbjct  92   GPIAPVLRNLSELRTLVLSRNNFFGPLPSEVGQIGSLWKLNVSDNALSGSLPSSLGNLSR  151

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            L+ LDLS N+ +G +  ++     +LR++SLA + F
Sbjct  152  LRMLDLSKNAFTGEIPPNLFRYCETLRYVSLAENGF  187



>emb|CDY14823.1| BnaC04g48200D [Brassica napus]
Length=640

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 4/145 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            LN D L L+  KS V+ DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVENDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  615  QFLDLSGNSLSGPVSDSMLENLGSL  689
              LDLS N L+G + +S+ E LGSL
Sbjct  142  NHLDLSSNRLNGSLPESLTE-LGSL  165



>emb|CDY47962.1| BnaA04g24400D [Brassica napus]
Length=645

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            LN D L L+  KS V  DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  615  QFLDLSGNSLSGPVSDSMLENLGSL  689
              LDLS N L+G + +S+ E LGSL
Sbjct  142  NHLDLSSNRLNGSLPESLAE-LGSL  165



>ref|XP_009142052.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=642

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            LN D L L+  KS V  DP   +  WSE D +PC W+ V C   NGRV+ ++L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTKVMNHWSESDQTPCHWSGVAC--TNGRVTSLNLFGKSLSG  81

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
             I   L  L+ LN L LA NNFS  +  +L   TNL+ ++LS NS+SG +PD + ++ SL
Sbjct  82   YIPSELGLLDSLNRLDLAHNNFSKPVPVRLFEPTNLRYIDLSHNSLSGPIPDQIRHLKSL  141

Query  615  QFLDLSGNSLSGPVSDSMLENLGSL  689
              LDLS N L+G + +S+ E LGSL
Sbjct  142  NHLDLSSNRLNGSLPESLAE-LGSL  165



>ref|XP_008659447.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Zea mays]
 gb|AFW86332.1| hypothetical protein ZEAMMB73_446534 [Zea mays]
Length=199

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 91/162 (56%), Gaps = 7/162 (4%)
 Frame = +3

Query  234  AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  413
            +G A  +  N +V  L+V KS ++DP   L  W  +   PC W+F+ C P N  V+ ++ 
Sbjct  20   SGLAAPMDFNHEVQVLMVIKSLLKDPYGALRNWDRNSVDPCTWSFISCSPEN-LVTALEA  78

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
                LSG++   +  L  L  L L +NN  G I  ++G L  L+TL LS N + GTVP+S
Sbjct  79   PSKNLSGRLSPSIGNLTKLEKLQLQNNNIIGPIPAEIGKLAKLRTLVLSSNKLHGTVPNS  138

Query  594  LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            LG +  LQ++DLS N+LSGP+  +      S R L++AG+  
Sbjct  139  LGRLGRLQYIDLSYNNLSGPIPKT------SARTLNIAGNPL  174



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 93/180 (52%), Gaps = 27/180 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            L DDVL L+VFK+ V DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  26   LTDDVLALVVFKTDVSDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  85

Query  438  IGRG-------------------------LEKLEHLNVLSLASNNFSG-VISPqlglltn  539
            + R                          L  L  L  L L+SN  +  V +        
Sbjct  86   LPRALLRLDALLSLALPRNNLSGPVLPNLLTALPRLRSLDLSSNRLAAPVPAQLFAQCRA  145

Query  540  lqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++ ++L+ N +SG +P ++ + +SL  L+LS N L+GP+ D  L +L SLR L L+G+  
Sbjct  146  VRAISLAHNQLSGYIPPAVASCASLVSLNLSSNRLAGPIPDG-LWSLPSLRSLDLSGNEL  204


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +3

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G++  G+  +  L VL +++N   G + P++G    L+ L + +NS++G +P  +GN SS
Sbjct  397  GQLPAGIGGMRLLEVLDVSANRLEGTVPPEIGGTVALRDLRMGRNSLTGRIPSQIGNCSS  456

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            L  LD S N+L GP+  SM  NL SL+ ++L+
Sbjct  457  LIALDFSHNNLMGPIPSSM-GNLTSLQVVNLS  487



>ref|NP_001055909.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|AAT69645.1| unknown protein, contains LRR domain [Oryza sativa Japonica Group]
 dbj|BAF17823.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|EEE64195.1| hypothetical protein OsJ_19027 [Oryza sativa Japonica Group]
Length=216

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = +3

Query  276  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  455
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  456  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  635
            +L+ L  + +ASNN  G I P+ G L NL +L+L  N+ISG +P SLG + SL+F+ +  
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENLISLDLCNNTISGPIPPSLGKLKSLKFMRIDH  153

Query  636  NSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            N L+GP+ +  L  L +L  L+++ +  
Sbjct  154  NLLTGPIPNE-LAGLSNLMILNVSNNDL  180



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 87/181 (48%), Gaps = 50/181 (28%)
 Frame = +3

Query  264  DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  443
            DDVL L+VFK+GV DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG++ 
Sbjct  26   DDVLALVVFKTGVSDPSGRLATWTEDDDRPCSWPGVGCDARTGRVTSLSLPAASLSGRLP  85

Query  444  ----------------------------------RGLE----------------KLEHLN  473
                                              R L+                +  ++ 
Sbjct  86   PALLRLDALLSLALPRNNLSGPVLPNLLAALPRLRSLDLSSNRLAAPVPAQLFAQCRYIR  145

Query  474  VLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGP  653
             +SLA N  SG I P +    +L +LNLS N ++G +PD L ++ SL+ LDLSGN LSG 
Sbjct  146  AISLAHNQLSGYIPPAVTSCASLVSLNLSSNRLAGPIPDGLWSLPSLRSLDLSGNELSGS  205

Query  654  V  656
            V
Sbjct  206  V  206


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +3

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G++  G+  +  L VL +++N   G + P++G    L+ L + +NS++G +P  +GN SS
Sbjct  395  GQLPAGIGGMRLLEVLDVSANRLDGTVPPEIGGAVALRDLRMGRNSLTGGIPAQIGNCSS  454

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            L  LDLS NSL+GP+  +M  NL SL+ ++L+
Sbjct  455  LVALDLSHNSLTGPIPSTM-GNLTSLQVVNLS  485



>gb|AEW49518.1| putative LRR-RLK protein XIAO [Oryza sativa Japonica Group]
Length=1157

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 96/163 (59%), Gaps = 5/163 (3%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDL  413
            G     ++  ++  L++F+SG++DP + ++ W+    S PC+W  V C    GRV E+ L
Sbjct  26   GANAPPEVKAEIDALLMFRSGLRDPYAAMSGWNASSPSAPCSWRGVACAAGTGRVVELAL  85

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
              L LSG I   L  L +L  LSL SN+ SG I   L  +++L+ + L  NS+SG +P S
Sbjct  86   PKLRLSGAISPALSSLVYLEKLSLRSNSLSGTIPASLSRISSLRAVYLQYNSLSGPIPQS  145

Query  594  -LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             L N+++LQ  D+SGN LSGPV  S      SL++L L+ ++F
Sbjct  146  FLANLTNLQTFDVSGNLLSGPVPVSFPP---SLKYLDLSSNAF  185


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            VDL    L+G     L     L VL L+ N F+G + P +G LT LQ L L  N+ +GTV
Sbjct  325  VDLRANKLAGPFPSWLAGAGGLTVLDLSGNAFTGEVPPAVGQLTALQELRLGGNAFTGTV  384

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P  +G   +LQ LDL  N  SG V  + L  L  LR + L G+SF
Sbjct  385  PAEIGRCGALQVLDLEDNRFSGEVP-AALGGLRRLREVYLGGNSF  428


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 24/133 (18%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+ EV L G   SG+I   L  L  L  LS   N  +G +  +L +L NL  L+LS N +
Sbjct  417  RLREVYLGGNSFSGQIPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL  476

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM------------------------LENL  680
            +G +P S+GN+++LQ L+LSGNS SG +  ++                        L  L
Sbjct  477  AGEIPPSIGNLAALQSLNLSGNSFSGRIPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGL  536

Query  681  GSLRFLSLAGSSF  719
              L+++SLAG+SF
Sbjct  537  PQLQYVSLAGNSF  549



>emb|CAH66725.1| H0404F02.1 [Oryza sativa Indica Group]
Length=1157

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 96/163 (59%), Gaps = 5/163 (3%)
 Frame = +3

Query  237  GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDL  413
            G     ++  ++  L++F+SG++DP + ++ W+    S PC+W  V C    GRV E+ L
Sbjct  26   GANAPPEVKAEIDALLMFRSGLRDPYAAMSGWNASSPSAPCSWRGVACAAGTGRVVELAL  85

Query  414  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  593
              L LSG I   L  L +L  LSL SN+ SG I   L  +++L+ + L  NS+SG +P S
Sbjct  86   PKLRLSGAISPALSSLVYLEKLSLRSNSLSGTIPASLSRISSLRAVYLQYNSLSGPIPQS  145

Query  594  -LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             L N+++LQ  D+SGN LSGPV  S      SL++L L+ ++F
Sbjct  146  FLANLTNLQTFDVSGNLLSGPVPVSFPP---SLKYLDLSSNAF  185


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            VDL    L+G     L     L VL L+ N F+G + P +G LT LQ L L  N+ +GTV
Sbjct  325  VDLRANKLAGPFPSWLAGAGGLTVLDLSGNAFTGEVPPVVGQLTALQELRLGGNAFTGTV  384

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P  +G   +LQ LDL  N  SG V  + L  L  LR + L G+SF
Sbjct  385  PAEIGRCGALQVLDLEDNRFSGEVP-AALGGLRRLREVYLGGNSF  428


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 24/133 (18%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+ EV L G   SG+I   L  L  L  LS   N  +G +  +L +L NL  L+LS N +
Sbjct  417  RLREVYLGGNSFSGQIPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL  476

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM------------------------LENL  680
            +G +P S+GN+++LQ L+LSGNS SG +  ++                        L  L
Sbjct  477  AGEIPPSIGNLAALQSLNLSGNSFSGRIPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGL  536

Query  681  GSLRFLSLAGSSF  719
              L+++SLAG+SF
Sbjct  537  PQLQYVSLAGNSF  549



>gb|EEE61543.1| hypothetical protein OsJ_15867 [Oryza sativa Japonica Group]
Length=1116

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 95/157 (61%), Gaps = 5/157 (3%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  431
            ++  ++  L++F+SG++DP + ++ W+    S PC+W  V C    GRV E+ L  L LS
Sbjct  32   EVKAEIDALLMFRSGLRDPYAAMSGWNASSPSAPCSWRGVACAAGTGRVVELALPKLRLS  91

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  608
            G I   L  L +L  LSL SN+ SG I   L  +++L+ + L  NS+SG +P S L N++
Sbjct  92   GAISPALSSLVYLEKLSLRSNSLSGTIPASLSRISSLRAVYLQYNSLSGPIPQSFLANLT  151

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            +LQ  D+SGN LSGPV  S      SL++L L+ ++F
Sbjct  152  NLQTFDVSGNLLSGPVPVSFPP---SLKYLDLSSNAF  185


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            VDL    L+G     L     L VL L+ N F+G + P +G LT LQ L L  N+ +GTV
Sbjct  325  VDLRANKLAGPFPSWLAGAGGLTVLDLSGNAFTGEVPPAVGQLTALQELRLGGNAFTGTV  384

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            P  +G   +LQ LDL  N  SG V  + L  L  LR + L G+SF
Sbjct  385  PAEIGRCGALQVLDLEDNRFSGEVP-AALGGLRRLREVYLGGNSF  428


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 24/133 (18%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            R+ EV L G   SG+I   L  L  L  LS   N  +G +  +L +L NL  L+LS N +
Sbjct  417  RLREVYLGGNSFSGQIPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKL  476

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM------------------------LENL  680
            +G +P S+GN+++LQ L+LSGNS SG +  ++                        L  L
Sbjct  477  AGEIPPSIGNLAALQSLNLSGNSFSGRIPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGL  536

Query  681  GSLRFLSLAGSSF  719
              L+++SLAG+SF
Sbjct  537  PQLQYVSLAGNSF  549



>dbj|BAK02926.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1171

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  431
            ++  ++  L+ F++ ++DP + +A W     S PC+W  V C+ A+GRV E+ L  L L+
Sbjct  48   EVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWRGVACNAASGRVVELQLPRLRLA  107

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  608
            G +   L  L HL  LSL SN  +G I P L  L +L+ + L  N++SG +P S L N++
Sbjct  108  GPVSPALASLRHLQKLSLRSNALTGAIPPALARLASLRAVFLQDNALSGPIPPSFLANLT  167

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             L+  D+S N LSGPV  ++      L++L L+ ++F
Sbjct  168  GLETFDVSANLLSGPVPPALPPG---LKYLDLSSNAF  201


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL G  L+G I   L +L+ L  L L+ N  S  I P++  +++L TL L  N + G +
Sbjct  630  LDLSGNHLTGPIPSDLSRLDELEELDLSHNQLSSKIPPEISNISSLATLKLDDNHLVGEI  689

Query  585  PDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENL  680
            P SL N+S LQ LDLS NS++G  PVS + + +L
Sbjct  690  PASLANLSKLQALDLSSNSITGSIPVSLAQIPSL  723


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 1/105 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            ++  V L     SG +  G   L  L  L+++ N+F+G I    G + +LQ L+ S N I
Sbjct  554  QLQHVSLADNSFSGDVPEGFSSLWSLRHLNISVNSFAGSIPATYGYMASLQVLSASHNRI  613

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            SG VP  L N S+L  LDLSGN L+GP+  S L  L  L  L L+
Sbjct  614  SGEVPAELANCSNLTVLDLSGNHLTGPIP-SDLSRLDELEELDLS  657



>dbj|BAJ86449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1135

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = +3

Query  255  QLNDDVLGLIVFKSGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  431
            ++  ++  L+ F++ ++DP + +A W     S PC+W  V C+ A+GRV E+ L  L L+
Sbjct  12   EVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWRGVACNAASGRVVELQLPRLRLA  71

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS-LGNMS  608
            G +   L  L HL  LSL SN  +G I P L  L +L+ + L  N++SG +P S L N++
Sbjct  72   GPVSPALASLRHLQKLSLRSNALTGAIPPALARLASLRAVFLQDNALSGPIPPSFLANLT  131

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
             L+  D+S N LSGPV  ++      L++L L+ ++F
Sbjct  132  GLETFDVSANLLSGPVPPALPPG---LKYLDLSSNAF  165


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            +DL G  L+G I   L +L+ L  L L+ N  S  I P++  +++L TL L  N + G +
Sbjct  594  LDLSGNHLTGPIPSDLSRLDELEELDLSHNQLSSKIPPEISNISSLATLKLDDNHLVGEI  653

Query  585  PDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENL  680
            P SL N+S LQ LDLS NS++G  PVS + + +L
Sbjct  654  PASLANLSKLQALDLSSNSITGSIPVSLAQIPSL  687


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 1/105 (1%)
 Frame = +3

Query  393  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  572
            ++  V L     SG +  G   L  L  L+++ N+F+G I    G + +LQ L+ S N I
Sbjct  518  QLQHVSLADNSFSGDVPEGFSSLWSLRHLNISVNSFAGSIPATYGYMASLQVLSASHNRI  577

Query  573  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            SG VP  L N S+L  LDLSGN L+GP+  S L  L  L  L L+
Sbjct  578  SGEVPAELANCSNLTVLDLSGNHLTGPIP-SDLSRLDELEELDLS  621



>gb|EAY98521.1| hypothetical protein OsI_20433 [Oryza sativa Indica Group]
Length=216

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = +3

Query  276  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  455
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  456  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  635
            +L+ L  + +ASNN  G I P+ G L NL +L+L  N+ISG +P S+G + SL+F+ +  
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENLISLDLCNNTISGPIPPSVGKLKSLKFMRIDH  153

Query  636  NSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            N L+GP+ +  L  L +L  L+++ +  
Sbjct  154  NLLTGPIPNE-LAGLSNLMILNVSNNDL  180



>gb|KHG13399.1| hypothetical protein F383_10003 [Gossypium arboreum]
Length=785

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 95/160 (59%), Gaps = 12/160 (8%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCH-------PANGRVSE  404
            +L LN D + L+ FK  +  DP S L +W+ DD +PCAW  V C        P   RV+ 
Sbjct  23   TLALNTDGVLLLSFKHAILSDPLSVLQSWNRDDKTPCAWTGVTCTEIGLPGTPDRLRVTS  82

Query  405  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  584
            + L    L G I   L  ++HL  L L+SNNF+G++   +   T LQ L+LS N ISG++
Sbjct  83   LVLPNSHLHGSISEDLGHIQHLRHLDLSSNNFNGILPSSIFNSTELQVLSLSANLISGSL  142

Query  585  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSL  704
            P+++G ++SLQ L+LS N+L+G V     ENL +L+ LS+
Sbjct  143  PETIGALASLQLLNLSHNALAGKVP----ENLTALQNLSV  178



>ref|XP_004491185.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cicer 
arietinum]
Length=218

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 84/148 (57%), Gaps = 2/148 (1%)
 Frame = +3

Query  276  GLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  455
             L   K  + DP + L +W     SPC W  V C+  N RV+ VDL    LSG +   L 
Sbjct  33   ALYTLKRSLTDPDNVLQSWDPTLVSPCTWFHVTCNQDN-RVTRVDLGNSNLSGHLVPELG  91

Query  456  KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  635
            KLEHL  L L  NN  G I P+LG L +L +L+L  N+ISGTVP SLG + +L FL L+ 
Sbjct  92   KLEHLQYLELYKNNIQGTIPPELGNLRSLVSLDLYNNNISGTVPPSLGKLKNLVFLRLND  151

Query  636  NSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            N L+GP+   ++  + SL+ + ++ +  
Sbjct  152  NRLTGPIPRELIA-IPSLKVVDVSNNDL  178



>tpg|DAA57062.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=949

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 91/180 (51%), Gaps = 27/180 (15%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  437
            L DDVL L+VFK  + DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  27   LTDDVLALVVFKMDISDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  86

Query  438  IGRG-------------------------LEKLEHLNVLSLASNNFSG-VISPqlglltn  539
            +                            L  L  L  L L+SN  +  V +        
Sbjct  87   LPHALLRLDALLSLALPRNNLSGPVPPNLLTALPRLRALDLSSNRLAAPVPAQLFAQCRA  146

Query  540  lqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSF  719
            ++ ++L+ N +SG +P ++ + +SL  L+LS N L+GP+ D  L +L SLR L L+G+  
Sbjct  147  VRAISLAHNQLSGYIPPAVASCASLVSLNLSSNRLAGPIPDG-LWSLPSLRSLDLSGNEL  205


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +3

Query  432  GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  611
            G++  G+  L  L VL +++N   G + P++G    L+ L + +NS++G +P  +GN SS
Sbjct  398  GQLPAGIGGLRLLEVLDVSANRLEGTVPPEIGGAVALRDLRMGRNSLTGRIPAQIGNCSS  457

Query  612  LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            L  LD S N+L+ P+  +M  NL SL+ ++L+
Sbjct  458  LVALDFSHNNLTWPIPSTM-GNLTSLQVVNLS  488



>ref|XP_009343456.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FEI 2 [Pyrus x bretschneideri]
Length=605

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 84/153 (55%), Gaps = 1/153 (1%)
 Frame = +3

Query  249  SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  428
            SL L+ D L L+  KS + D  + L+ W + D+SPC W  + CHP + RVS ++L  + L
Sbjct  24   SLALSQDGLALLEIKSTLNDSRNILSDWQDSDESPCNWTGITCHPQDLRVSSINLPYVQL  83

Query  429  SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  608
             G I   + KL  L  L+L  N+  G I  ++     L+ L L  N + G +P  LGN+S
Sbjct  84   GGTISPSIGKLSRLQRLALHQNSLHGNIPNEITNCAELRALYLRANYLQGGIPSDLGNLS  143

Query  609  SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  707
            SL  LDLS N L G +  S +  L  L FL+L+
Sbjct  144  SLTILDLSSNLLRGAIPSS-IGRLSKLHFLNLS  175



>ref|NP_181758.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AAD23712.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59308.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC10101.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=646

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 84/145 (58%), Gaps = 4/145 (3%)
 Frame = +3

Query  258  LNDDVLGLIVFKSGV-QDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  434
            LN D L L+  KS V  DP   +  WSE D +PC W+ + C   NGRV+ + L G  LSG
Sbjct  24   LNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCHWSGIVC--TNGRVTTLVLFGKSLSG  81

Query  435  KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  614
             I   L  L  LN L LA NNFS  I  +L   T L+ ++LS NS+SG +P  + +M SL
Sbjct  82   YIPSELGLLNSLNRLDLAHNNFSKTIPVRLFEATKLRYIDLSHNSLSGPIPAQIKSMKSL  141

Query  615  QFLDLSGNSLSGPVSDSMLENLGSL  689
              LD S N L+G + +S+ E LGSL
Sbjct  142  NHLDFSSNHLNGSLPESLTE-LGSL  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425