BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043P13

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO46793.1|  hypothetical protein CISIN_1g012238mg                   334   5e-110   Citrus sinensis [apfelsine]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    336   2e-109   Nicotiana sylvestris
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             334   8e-109   Citrus clementina [clementine]
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   334   9e-109   Citrus sinensis [apfelsine]
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    330   9e-108   Nicotiana tomentosiformis
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    326   1e-105   Populus euphratica
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        326   1e-105   
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    325   4e-105   Solanum tuberosum [potatoes]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        323   1e-104   Populus trichocarpa [western balsam poplar]
gb|AFP86894.1|  aspartate aminotransferase                              319   4e-104   Ilex paraguariensis [Brazilian-tea]
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     322   6e-104   Solanum tuberosum [potatoes]
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    320   2e-103   Populus euphratica
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    318   1e-102   Solanum lycopersicum
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   313   2e-101   Citrus sinensis [apfelsine]
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             315   2e-101   Prunus persica
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    313   1e-100   Vitis vinifera
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    313   1e-100   Prunus mume [ume]
emb|CAN76227.1|  hypothetical protein VITISV_000267                     313   2e-100   Vitis vinifera
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    313   2e-100   Eucalyptus grandis [rose gum]
ref|XP_007011759.1|  Aspartate aminotransferase                         311   4e-100   
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    311   6e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010089944.1|  Aspartate aminotransferase                         311   7e-100   
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    311   1e-99    Malus domestica [apple tree]
gb|KHG09550.1|  Aspartate aminotransferase, chloroplastic -like p...    306   1e-99    Gossypium arboreum [tree cotton]
gb|KJB55010.1|  hypothetical protein B456_009G060500                    306   1e-99    Gossypium raimondii
ref|XP_002515455.1|  aspartate aminotransferase, putative               310   1e-99    Ricinus communis
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         310   2e-99    Jatropha curcas
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    310   3e-99    Gossypium arboreum [tree cotton]
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    309   7e-99    Cucumis sativus [cucumbers]
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    308   1e-98    Fragaria vesca subsp. vesca
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    307   2e-98    Cucumis melo [Oriental melon]
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    306   4e-98    Tarenaya hassleriana [spider flower]
gb|KJB55006.1|  hypothetical protein B456_009G060500                    306   6e-98    Gossypium raimondii
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    306   8e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB65890.1|  hypothetical protein B456_010G117400                    306   1e-97    Gossypium raimondii
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    306   1e-97    Cicer arietinum [garbanzo]
emb|CAA04697.1|  aspartate aminotransferase 2                           304   4e-97    Canavalia lineata
gb|AAB46611.1|  aspartate aminotransferase                              304   5e-97    Medicago sativa [alfalfa]
gb|KJB65891.1|  hypothetical protein B456_010G117400                    303   9e-97    Gossypium raimondii
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    301   1e-96    Cucumis melo [Oriental melon]
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    303   1e-96    
gb|KEH39860.1|  aspartate aminotransferase                              303   1e-96    Medicago truncatula
gb|KJB55007.1|  hypothetical protein B456_009G060500                    303   2e-96    Gossypium raimondii
emb|CDP18792.1|  unnamed protein product                                305   3e-96    Coffea canephora [robusta coffee]
prf||1908424A  Asp aminotransferase                                     302   3e-96 
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  302   3e-96    Canavalia lineata
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    301   3e-96    Lupinus angustifolius
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    299   1e-95    
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    300   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          300   1e-95    Amborella trichopoda
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             300   2e-95    
emb|CDY13467.1|  BnaA03g51850D                                          299   2e-95    Brassica napus [oilseed rape]
gb|KJB55009.1|  hypothetical protein B456_009G060500                    300   3e-95    Gossypium raimondii
emb|CDX72339.1|  BnaC07g43610D                                          299   3e-95    
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    300   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    298   4e-95    Brassica rapa
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    298   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             298   5e-95    Capsella rubella
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    298   6e-95    Camelina sativa [gold-of-pleasure]
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    298   8e-95    Phoenix dactylifera
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    298   9e-95    Brassica rapa
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    298   1e-94    Elaeis guineensis
emb|CDX75211.1|  BnaA01g04910D                                          298   1e-94    
gb|EPS60991.1|  aspartate aminotransferase                              289   1e-94    Genlisea aurea
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             297   2e-94    
gb|AAM67272.1|  aspartate aminotransferase                              296   2e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CAA56932.1|  aspartate aminotransferase                             296   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194927.1|  aspartate aminotransferase                            296   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             296   3e-94    
ref|NP_001031767.1|  aspartate aminotransferase                         296   4e-94    Arabidopsis thaliana [mouse-ear cress]
prf||2009357A  Asp aminotransferase                                     296   4e-94 
gb|AAC12674.1|  aspartate aminotransferase                              296   6e-94    Lotus corniculatus
emb|CDJ26231.1|  putative aspartate aminotransferase                    295   1e-93    Brassica oleracea
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    295   2e-93    Phaseolus vulgaris [French bean]
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    293   6e-93    Glycine max [soybeans]
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    293   6e-93    Glycine max [soybeans]
ref|NP_001237987.1|  aspartate aminotransferase                         293   7e-93    
gb|ACU24502.1|  unknown                                                 293   7e-93    Glycine max [soybeans]
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            293   7e-93    Glycine soja [wild soybean]
emb|CDX68807.1|  BnaC01g06460D                                          293   2e-92    
ref|NP_001048397.1|  Os02g0797500                                       291   5e-92    
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    290   6e-92    
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    290   1e-91    Glycine max [soybeans]
ref|NP_001190885.1|  aspartate aminotransferase                         289   1e-91    Arabidopsis thaliana [mouse-ear cress]
gb|ACR34530.1|  unknown                                                 290   2e-91    Zea mays [maize]
gb|AAO23563.1|  aspartate aminotransferase                              288   2e-91    Oryza sativa [red rice]
ref|NP_001149005.1|  aspartate aminotransferase                         289   2e-91    
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   289   3e-91    Panicum miliaceum [broom millet]
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                289   3e-91    Erythranthe guttata [common monkey flower]
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                287   1e-90    Erythranthe guttata [common monkey flower]
gb|ABK24563.1|  unknown                                                 287   2e-90    Picea sitchensis
gb|ACN40845.1|  unknown                                                 286   2e-90    Picea sitchensis
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    286   2e-90    Brachypodium distachyon [annual false brome]
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    285   8e-90    Setaria italica
dbj|BAJ92741.1|  predicted protein                                      285   9e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96638.1|  predicted protein                                      285   9e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16448.1|  unknown                                                 283   9e-90    Picea sitchensis
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               281   7e-88    
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               280   9e-88    Triticum urartu
emb|CAN64661.1|  hypothetical protein VITISV_034785                     278   1e-87    Vitis vinifera
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             273   8e-86    
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             271   5e-85    
gb|KJB55008.1|  hypothetical protein B456_009G060500                    270   1e-84    Gossypium raimondii
ref|XP_001785888.1|  predicted protein                                  260   4e-80    
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    241   2e-73    
gb|ACG59771.1|  chloroplast aspartate aminotransferase                  225   1e-67    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    221   3e-65    Phoenix dactylifera
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    222   5e-65    
ref|XP_005642879.1|  aspartate aminotransferase                         220   9e-65    Coccomyxa subellipsoidea C-169
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             215   5e-63    Chlorella variabilis
ref|XP_006495466.1|  PREDICTED: aspartate aminotransferase, chlor...    197   6e-60    Citrus sinensis [apfelsine]
ref|XP_001700039.1|  aspartate aminotransferase                         203   1e-58    Chlamydomonas reinhardtii
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    202   5e-58    
ref|XP_003064597.1|  aspartate amino transferase                        197   2e-56    Micromonas pusilla CCMP1545
ref|XP_002950644.1|  aspartate aminotransferase                         196   7e-56    Volvox carteri f. nagariensis
ref|XP_002501168.1|  aspartate aminotransferase                         194   2e-55    Micromonas commoda
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial       191   2e-54    Auxenochlorella protothecoides
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     191   1e-53    Eucalyptus grandis [rose gum]
gb|ABN48559.1|  chloroplast aspartate aminotransferase                  175   3e-51    Brassica juncea [brown mustard]
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...    173   3e-47    Vitis vinifera
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640          174   4e-47    Amborella trichopoda
ref|XP_005152326.1|  PREDICTED: aspartate aminotransferase, mitoc...    172   5e-47    Melopsittacus undulatus
emb|CAN70394.1|  hypothetical protein VITISV_020521                     172   7e-47    Vitis vinifera
ref|XP_003970037.1|  PREDICTED: aspartate aminotransferase, mitoc...    172   1e-46    Takifugu rubripes [tiger puffer]
ref|XP_008175935.1|  PREDICTED: aspartate aminotransferase, mitoc...    172   1e-46    Chrysemys picta bellii
ref|XP_003442303.1|  PREDICTED: aspartate aminotransferase, mitoc...    172   1e-46    Oreochromis niloticus
ref|XP_006780104.1|  PREDICTED: aspartate aminotransferase, mitoc...    171   2e-46    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004543093.1|  PREDICTED: aspartate aminotransferase, mitoc...    171   2e-46    Maylandia zebra
ref|XP_003227907.1|  PREDICTED: aspartate aminotransferase, mitoc...    171   3e-46    Anolis carolinensis [Carolina anole]
gb|KFO71408.1|  hypothetical protein N303_10396                         170   3e-46    Cuculus canorus
gb|KFP90495.1|  hypothetical protein N311_04899                         170   4e-46    Apaloderma vittatum
gb|KFP38914.1|  hypothetical protein N324_09434                         170   4e-46    Chlamydotis macqueenii
gb|KFV95661.1|  hypothetical protein N327_00168                         167   6e-46    Fulmarus glacialis
ref|XP_005814426.1|  PREDICTED: aspartate aminotransferase, mitoc...    170   6e-46    Xiphophorus maculatus
ref|XP_001176672.2|  PREDICTED: aspartate aminotransferase, mitoc...    170   6e-46    
ref|XP_006109334.1|  PREDICTED: aspartate aminotransferase, mitoc...    163   6e-46    
ref|XP_010878037.1|  PREDICTED: aspartate aminotransferase, mitoc...    170   7e-46    Esox lucius
ref|XP_009569498.1|  PREDICTED: aspartate aminotransferase, mitoc...    169   8e-46    Cuculus canorus
ref|XP_008292179.1|  PREDICTED: aspartate aminotransferase, mitoc...    169   9e-46    Stegastes partitus
ref|XP_009870982.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    169   1e-45    Apaloderma vittatum
ref|XP_010582297.1|  PREDICTED: aspartate aminotransferase, mitoc...    169   1e-45    Haliaeetus leucocephalus
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic                 169   1e-45    
ref|XP_009583475.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   1e-45    Fulmarus glacialis
ref|XP_008308463.1|  PREDICTED: aspartate aminotransferase, mitoc...    169   1e-45    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010127976.1|  PREDICTED: aspartate aminotransferase, mitoc...    168   1e-45    Chlamydotis macqueenii
gb|KFP19653.1|  hypothetical protein Z169_06078                         168   1e-45    Egretta garzetta
ref|XP_006110233.1|  PREDICTED: aspartate aminotransferase, mitoc...    169   1e-45    
gb|KFZ50221.1|  hypothetical protein N321_06413                         168   1e-45    Antrostomus carolinensis
gb|KFQ16652.1|  hypothetical protein N330_09915                         168   2e-45    Leptosomus discolor
ref|XP_006020296.1|  PREDICTED: aspartate aminotransferase, mitoc...    169   2e-45    
ref|XP_003758636.1|  PREDICTED: aspartate aminotransferase, mitoc...    168   2e-45    
tpg|DAA57531.1|  TPA: hypothetical protein ZEAMMB73_000065              165   2e-45    
gb|KFV01058.1|  hypothetical protein N339_06116                         168   2e-45    Pterocles gutturalis
gb|KFP55374.1|  hypothetical protein N322_09365                         168   2e-45    Cariama cristata
gb|KFP71016.1|  hypothetical protein N310_05849                         168   2e-45    Acanthisitta chloris
gb|KFO97280.1|  hypothetical protein N300_07039                         168   2e-45    Calypte anna
gb|KFR02997.1|  hypothetical protein Y956_09274                         168   2e-45    Nipponia nippon
emb|CBI20886.3|  unnamed protein product                                168   2e-45    Vitis vinifera
gb|EMS51413.1|  Aspartate aminotransferase, cytoplasmic                 169   2e-45    Triticum urartu
gb|KGL91867.1|  hypothetical protein N301_16701                         168   2e-45    Charadrius vociferus
gb|KFQ68668.1|  hypothetical protein N335_07592                         168   2e-45    Phaethon lepturus
ref|XP_007549969.1|  PREDICTED: aspartate aminotransferase, mitoc...    168   2e-45    Poecilia formosa
gb|KFW71608.1|  hypothetical protein AS28_11098                         168   2e-45    Pygoscelis adeliae
gb|KFV53116.1|  hypothetical protein N328_06671                         167   2e-45    Gavia stellata
gb|KFP56730.1|  hypothetical protein N323_06988                         167   2e-45    Cathartes aura
gb|KFV00678.1|  hypothetical protein N340_11396                         167   3e-45    Tauraco erythrolophus
ref|XP_007762781.1|  hypothetical protein CONPUDRAFT_78940              168   3e-45    Coniophora puteana RWD-64-598 SS2
ref|XP_004317705.1|  PREDICTED: aspartate aminotransferase, mitoc...    168   3e-45    
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...    169   3e-45    Vitis vinifera
gb|EMP28841.1|  Aspartate aminotransferase                              167   3e-45    Chelonia mydas [green seaturtle]
emb|CDM84293.1|  unnamed protein product                                169   3e-45    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004340638.1|  aspartate aminotransferase, cytoplasmic, put...    168   3e-45    Acanthamoeba castellanii str. Neff
ref|XP_007438961.1|  PREDICTED: aspartate aminotransferase, mitoc...    168   3e-45    Python bivittatus
gb|EFB22248.1|  hypothetical protein PANDA_000063                       167   3e-45    Ailuropoda melanoleuca
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...    169   3e-45    
ref|XP_005229254.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   4e-45    
gb|KFQ73258.1|  hypothetical protein N337_00339                         167   4e-45    Phoenicopterus ruber ruber
ref|XP_009958443.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   4e-45    Leptosomus discolor
gb|EOA96948.1|  Aspartate aminotransferase, mitochondrial               167   4e-45    Anas platyrhynchos [duck]
gb|KIJ68385.1|  hypothetical protein HYDPIDRAFT_173129                  167   4e-45    Hydnomerulius pinastri MD-312
gb|KFV92257.1|  hypothetical protein N326_05957                         167   4e-45    Eurypyga helias
ref|XP_009641563.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   4e-45    Egretta garzetta
ref|XP_010164289.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   4e-45    Antrostomus carolinensis
ref|XP_009078129.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   5e-45    Acanthisitta chloris
ref|XP_006863643.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   5e-45    Chrysochloris asiatica
ref|XP_009697580.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   5e-45    Cariama cristata
ref|XP_009468749.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   6e-45    Nipponia nippon
gb|KFV54532.1|  hypothetical protein N341_00606                         167   6e-45    Tyto alba [Schleiereule]
gb|KFQ63469.1|  hypothetical protein N334_09493                         167   6e-45    Pelecanus crispus
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...    167   6e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010080711.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   6e-45    Pterocles gutturalis
ref|XP_009881551.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   6e-45    Charadrius vociferus
ref|XP_008503619.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   6e-45    Calypte anna
gb|KFO63074.1|  hypothetical protein N302_07001                         167   6e-45    Corvus brachyrhynchos
ref|XP_008175936.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   6e-45    Chrysemys picta bellii
ref|XP_009980094.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   6e-45    Tauraco erythrolophus
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115             167   7e-45    Trametes versicolor FP-101664 SS1
ref|XP_009328640.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   7e-45    Pygoscelis adeliae
ref|XP_010860133.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   7e-45    Bison bison bison
gb|KIJ21699.1|  aspartate transaminase                                  167   7e-45    Paxillus involutus ATCC 200175
ref|XP_009924468.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   7e-45    Haliaeetus albicilla
ref|NP_777231.1|  aspartate aminotransferase, mitochondrial             167   7e-45    Bos taurus [bovine]
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...    167   7e-45    Solanum lycopersicum
gb|KFM02723.1|  hypothetical protein AS27_01862                         166   7e-45    Aptenodytes forsteri
ref|XP_010292847.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   7e-45    Phaethon lepturus
ref|XP_002912325.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   7e-45    Ailuropoda melanoleuca
ref|XP_009809693.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   7e-45    Gavia stellata
pdb|1AKA|A  Chain A, Structural Basis For The Catalytic Activity ...    166   7e-45    Gallus gallus [bantam]
ref|XP_007067232.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   7e-45    
ref|XP_005899976.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   7e-45    Bos mutus
pdb|7AAT|A  Chain A, X-Ray Structure Refinement And Comparison Of...    166   7e-45    Gallus gallus [bantam]
ref|XP_005490808.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   7e-45    
ref|XP_005025720.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   8e-45    
emb|CAA45023.1|  aspartate aminotransferase                             167   8e-45    Panicum miliaceum [broom millet]
gb|KFW90670.1|  hypothetical protein N336_10326                         166   8e-45    Phalacrocorax carbo [common cormorant]
gb|KFQ35253.1|  hypothetical protein N331_07571                         166   8e-45    Merops nubicus
ref|XP_008401656.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   8e-45    Poecilia reticulata
gb|KFU92658.1|  hypothetical protein M959_01402                         166   9e-45    Chaetura pelagica
gb|KFV73576.1|  hypothetical protein N308_13552                         166   9e-45    Struthio camelus australis
ref|XP_005981403.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   9e-45    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004350746.1|  aspartate aminotransferase                         166   9e-45    Cavenderia fasciculata
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                   167   9e-45    Phlebiopsis gigantea 11061_1 CR5-6
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                  167   9e-45    Paxillus rubicundulus Ve08.2h10
ref|XP_003209725.2|  PREDICTED: aspartate aminotransferase, mitoc...    166   9e-45    
gb|KIM66148.1|  hypothetical protein SCLCIDRAFT_1211371                 167   1e-44    Scleroderma citrinum Foug A
ref|XP_008700791.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   1e-44    Ursus maritimus [white bear]
ref|XP_006052520.1|  PREDICTED: aspartate aminotransferase, mitoc...    167   1e-44    Bubalus bubalis [domestic water buffalo]
dbj|BAJ97930.1|  predicted protein                                      164   1e-44    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010147321.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   1e-44    Eurypyga helias
ref|NP_001044317.1|  Os01g0760600                                       167   1e-44    
ref|XP_005692154.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   1e-44    
ref|XP_004067248.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   1e-44    Oryzias latipes [Japanese rice fish]
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...    167   1e-44    Solanum tuberosum [potatoes]
ref|XP_001771002.1|  predicted protein                                  166   1e-44    
gb|KFQ42654.1|  hypothetical protein N333_09691                         166   1e-44    Nestor notabilis
ref|XP_003282681.2|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-44    
gb|KDO79734.1|  hypothetical protein CISIN_1g0188201mg                  163   1e-44    Citrus sinensis [apfelsine]
ref|XP_009088934.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   1e-44    Serinus canaria [canary]
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...    167   1e-44    Oryza brachyantha
ref|XP_009126373.1|  PREDICTED: aspartate aminotransferase, cytop...    166   1e-44    Brassica rapa
gb|KDP34208.1|  hypothetical protein JCGZ_07779                         167   1e-44    Jatropha curcas
ref|XP_009967572.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   1e-44    Tyto alba [Schleiereule]
ref|XP_009485645.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   1e-44    Pelecanus crispus
ref|XP_006450637.1|  hypothetical protein CICLE_v10008274mg             164   2e-44    
ref|XP_010394985.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    
ref|XP_009289063.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    
gb|KDP33689.1|  hypothetical protein JCGZ_07260                         166   2e-44    Jatropha curcas
ref|XP_002324997.1|  aspartate aminotransferase family protein          166   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_004265006.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   2e-44    Orcinus orca [Orca]
ref|XP_008636972.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    
ref|XP_011043495.1|  PREDICTED: aspartate aminotransferase, cytop...    165   2e-44    Populus euphratica
gb|KFO92044.1|  hypothetical protein N320_04667                         165   2e-44    Buceros rhinoceros silvestris
ref|XP_009502368.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    Phalacrocorax carbo [common cormorant]
ref|XP_001731601.1|  hypothetical protein MGL_0869                      166   2e-44    Malassezia globosa CBS 7966
ref|XP_011078312.1|  PREDICTED: aspartate aminotransferase, cytop...    165   2e-44    Sesamum indicum [beniseed]
ref|XP_011048396.1|  PREDICTED: aspartate aminotransferase, cytop...    165   2e-44    Populus euphratica
ref|XP_009999988.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    Chaetura pelagica
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...    166   2e-44    Nicotiana sylvestris
ref|XP_009677969.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    Struthio camelus australis
ref|XP_005422803.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    Geospiza fortis
ref|XP_008944416.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    Merops nubicus
ref|XP_005052542.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   2e-44    Ficedula albicollis
ref|XP_004015091.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   2e-44    Ovis aries [domestic sheep]
ref|XP_009120876.1|  PREDICTED: aspartate aminotransferase, cytop...    165   2e-44    Brassica rapa
ref|XP_005526350.1|  PREDICTED: aspartate aminotransferase, mitoc...    166   2e-44    Pseudopodoces humilis [Tibetan ground-jay]
emb|CDX92520.1|  BnaA10g15590D                                          165   2e-44    
ref|XP_007012061.1|  Aspartate aminotransferase 3                       166   2e-44    
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...    166   3e-44    Nicotiana tomentosiformis
gb|AAB91426.1|  aspartate aminotransferase precursor                    166   3e-44    Mus musculus [mouse]
prf||0308236A  aminotransferase,Asp                                     165   3e-44 
ref|XP_004744353.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   3e-44    Mustela putorius furo [black ferret]
emb|CDY42276.1|  BnaC02g08820D                                          165   3e-44    Brassica napus [oilseed rape]
sp|P28734.1|AATC_DAUCA  RecName: Full=Aspartate aminotransferase,...    165   3e-44    Daucus carota [carrots]
ref|XP_004395809.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   3e-44    Odobenus rosmarus divergens
emb|CDY44925.1|  BnaA02g04300D                                          165   4e-44    Brassica napus [oilseed rape]
ref|XP_006450635.1|  hypothetical protein CICLE_v10008274mg             164   4e-44    
ref|XP_008067406.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   4e-44    Carlito syrichta
ref|XP_010013669.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   4e-44    Nestor notabilis
ref|XP_010739613.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   4e-44    Larimichthys crocea [croceine croaker]
ref|XP_007468385.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   4e-44    
ref|XP_004339901.1|  aspartate aminotransferase, putative               165   4e-44    
ref|NP_001273953.1|  aspartate aminotransferase, mitochondrial          165   4e-44    
pdb|3PD6|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...    164   4e-44    
pdb|3HLM|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...    164   4e-44    
gb|AEX09183.1|  putative aspartate aminotransferase 2                   165   4e-44    
gb|KJB07521.1|  hypothetical protein B456_001G028100                    165   5e-44    
ref|XP_010138136.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   5e-44    
ref|XP_003998142.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   5e-44    
ref|XP_003509628.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   5e-44    
gb|ABR16105.1|  unknown                                                 164   6e-44    
ref|XP_010254083.1|  PREDICTED: aspartate aminotransferase, cytop...    165   6e-44    
ref|XP_007637330.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   6e-44    
gb|KFO04448.1|  hypothetical protein N312_06091                         164   6e-44    
ref|XP_002711597.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   6e-44    
gb|EYU29270.1|  hypothetical protein MIMGU_mgv1a006139mg                165   7e-44    
ref|XP_007945851.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   7e-44    
emb|CDY65959.1|  BnaC09g54080D                                          164   7e-44    
ref|XP_005318543.1|  PREDICTED: aspartate aminotransferase, mitoc...    161   7e-44    
ref|XP_007477592.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   7e-44    
ref|XP_004663500.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   7e-44    
gb|KHG23914.1|  Aspartate aminotransferase, chloroplastic -like p...    165   7e-44    
ref|NP_999093.1|  aspartate aminotransferase, mitochondrial precu...    164   8e-44    
ref|NP_034455.1|  aspartate aminotransferase, mitochondrial             164   8e-44    
ref|XP_007090444.1|  PREDICTED: aspartate aminotransferase, mitoc...    165   9e-44    
gb|AFK40370.1|  unknown                                                 164   9e-44    
ref|XP_009395718.1|  PREDICTED: aspartate aminotransferase, cytop...    164   9e-44    
sp|P28011.2|AAT1_MEDSA  RecName: Full=Aspartate aminotransferase ...    164   9e-44    
ref|XP_007198093.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
ref|XP_005078702.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
ref|XP_006099282.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
ref|XP_003569862.1|  PREDICTED: aspartate aminotransferase, cytop...    165   1e-43    
gb|KEH36022.1|  aspartate aminotransferase                              164   1e-43    
ref|XP_005873554.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
ref|XP_007112903.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
ref|XP_008138091.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
ref|XP_005345603.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
emb|CAA43779.1|  aspartate aminotransferase                             164   1e-43    
gb|ACN40894.1|  unknown                                                 164   1e-43    
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg             164   1e-43    
ref|XP_004583963.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
ref|NP_002071.2|  aspartate aminotransferase, mitochondrial isofo...    164   1e-43    
ref|XP_004057786.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
prf||0410468A  aminotransferase,Asp                                     163   1e-43 
dbj|BAD96991.1|  aspartate aminotransferase 2 precursor variant         164   1e-43    
ref|XP_523381.2|  PREDICTED: aspartate aminotransferase, mitochon...    164   1e-43    
ref|XP_003823746.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   1e-43    
gb|AAH00525.1|  Glutamic-oxaloacetic transaminase 2, mitochondria...    164   1e-43    
ref|XP_010493028.1|  PREDICTED: aspartate aminotransferase, cytop...    163   1e-43    
gb|EZP39195.1|  Aspartate aminotransferase AspC                         163   1e-43    
ref|NP_001141224.1|  uncharacterized protein LOC100273311               164   2e-43    
ref|XP_007112902.1|  PREDICTED: aspartate aminotransferase, mitoc...    163   2e-43    
ref|XP_010298153.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   2e-43    
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...    164   2e-43    
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                   163   2e-43    
ref|XP_003792641.1|  PREDICTED: aspartate aminotransferase, mitoc...    164   2e-43    
ref|XP_004483033.1|  PREDICTED: aspartate aminotransferase, mitoc...    163   2e-43    
gb|ELK38479.1|  Aspartate aminotransferase, mitochondrial               162   2e-43    
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242              163   2e-43    
gb|KEH36021.1|  aspartate aminotransferase                              163   2e-43    
gb|KEH36020.1|  aspartate aminotransferase                              164   2e-43    
gb|KIM24154.1|  hypothetical protein M408DRAFT_76285                    163   2e-43    
ref|XP_002871893.1|  hypothetical protein ARALYDRAFT_909992             163   2e-43    
ref|XP_006732870.1|  PREDICTED: aspartate aminotransferase, mitoc...    163   2e-43    
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...    164   2e-43    
gb|EPQ12242.1|  Aspartate aminotransferase, mitochondrial               163   2e-43    
ref|XP_004881984.1|  PREDICTED: aspartate aminotransferase, mitoc...    163   2e-43    
dbj|GAM22566.1|  hypothetical protein SAMD00019534_057410               163   2e-43    
ref|XP_002680594.1|  aspartate aminotransferase                         164   2e-43    
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                   163   2e-43    
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475             163   2e-43    
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                   163   2e-43    
ref|XP_006271773.1|  PREDICTED: aspartate aminotransferase, mitoc...    163   3e-43    
ref|NP_990854.1|  aspartate aminotransferase, mitochondrial precu...    163   3e-43    
ref|XP_005504845.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   3e-43    
gb|EFA75395.1|  aspartate aminotransferase                              166   3e-43    
ref|XP_004970037.1|  PREDICTED: aspartate aminotransferase, cytop...    163   3e-43    
ref|XP_002516566.1|  aspartate aminotransferase, putative               163   3e-43    
ref|NP_956283.1|  aspartate aminotransferase 2                          162   3e-43    
ref|XP_006641457.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   3e-43    
ref|NP_001270119.1|  aspartate aminotransferase, mitochondrial          162   3e-43    
ref|XP_003472097.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   3e-43    
ref|XP_001103601.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   3e-43    
ref|XP_010693429.1|  PREDICTED: aspartate aminotransferase, cytop...    163   4e-43    
gb|ACI34022.1|  Aspartate aminotransferase, mitochondrial precursor     162   4e-43    
ref|XP_004371581.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   4e-43    
ref|XP_011019648.1|  PREDICTED: aspartate aminotransferase, cytop...    163   4e-43    
ref|XP_006878782.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   4e-43    
ref|XP_006148520.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   4e-43    
gb|EJT99836.1|  aspartate aminotransferase                              162   4e-43    
ref|XP_004690563.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   4e-43    
emb|CAH92240.1|  hypothetical protein                                   162   4e-43    
ref|XP_006451184.1|  hypothetical protein CICLE_v10008489mg             162   4e-43    
ref|XP_009249048.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   4e-43    
ref|NP_001124888.1|  aspartate aminotransferase, mitochondrial          162   4e-43    
gb|KIM85250.1|  hypothetical protein PILCRDRAFT_5589                    162   4e-43    
ref|XP_006977858.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   4e-43    
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                   162   4e-43    
ref|XP_002308618.1|  aspartate transaminase family protein              162   4e-43    
emb|CDP16161.1|  unnamed protein product                                162   5e-43    
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517                 162   5e-43    
emb|CCM01943.1|  predicted protein                                      162   5e-43    
gb|KGL84885.1|  hypothetical protein N309_05764                         161   5e-43    
ref|XP_002761002.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   5e-43    
ref|XP_002514283.1|  aspartate aminotransferase, putative               161   6e-43    
ref|XP_006863642.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   6e-43    
ref|NP_037309.1|  aspartate aminotransferase, mitochondrial             162   7e-43    
gb|KIM48153.1|  hypothetical protein M413DRAFT_439876                   162   7e-43    
ref|XP_011354974.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   7e-43    
emb|CBQ68007.1|  probable aspartate aminotransferase, mitochondri...    162   7e-43    
ref|XP_010329683.1|  PREDICTED: aspartate aminotransferase, mitoc...    162   8e-43    
ref|XP_008789337.1|  PREDICTED: aspartate aminotransferase, cytop...    162   8e-43    
ref|XP_011090162.1|  PREDICTED: aspartate aminotransferase, cytop...    162   8e-43    
ref|XP_009762342.1|  PREDICTED: aspartate aminotransferase, cytop...    161   9e-43    
ref|XP_010376502.1|  PREDICTED: aspartate aminotransferase, mitoc...    161   9e-43    
ref|XP_006400515.1|  hypothetical protein EUTSA_v10013703mg             161   9e-43    
ref|XP_009410920.1|  PREDICTED: aspartate aminotransferase, cytop...    162   1e-42    
ref|XP_004501184.1|  PREDICTED: aspartate aminotransferase 1-like       162   1e-42    
ref|XP_007390433.1|  hypothetical protein PHACADRAFT_134034             161   1e-42    
ref|XP_009617506.1|  PREDICTED: aspartate aminotransferase, cytop...    160   1e-42    
ref|XP_004431730.1|  PREDICTED: aspartate aminotransferase, mitoc...    161   1e-42    
ref|XP_007670159.1|  PREDICTED: aspartate aminotransferase, mitoc...    161   1e-42    
ref|XP_010594999.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    161   1e-42    
ref|XP_010983999.1|  PREDICTED: aspartate aminotransferase, mitoc...    161   1e-42    
ref|XP_010420761.1|  PREDICTED: aspartate aminotransferase, cytop...    160   1e-42    
ref|XP_646849.1|  aspartate aminotransferase                            161   1e-42    
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                   161   1e-42    
gb|KJB64946.1|  hypothetical protein B456_010G072900                    159   1e-42    
ref|XP_004600685.1|  PREDICTED: aspartate aminotransferase, mitoc...    161   1e-42    
ref|XP_010965547.1|  PREDICTED: aspartate aminotransferase, mitoc...    161   1e-42    
prf||1003180A  aminotransferase,Asp                                     160   1e-42 
ref|XP_010224070.1|  PREDICTED: aspartate aminotransferase, mitoc...    160   1e-42    
ref|XP_006193091.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    161   1e-42    
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15               160   1e-42    
ref|XP_002954714.1|  aspartate aminotransferase                         161   2e-42    
gb|KFC68496.1|  Aspartate aminotransferase AspC                         160   2e-42    
gb|AEE61384.1|  unknown                                                 160   2e-42    
ref|XP_007013138.1|  Aspartate aminotransferase, cytoplasmic            160   2e-42    
gb|EYU32934.1|  hypothetical protein MIMGU_mgv1a0079831mg               158   2e-42    
ref|WP_036212399.1|  aromatic amino acid aminotransferase               160   2e-42    
ref|XP_006214550.1|  PREDICTED: aspartate aminotransferase, mitoc...    160   2e-42    
emb|CCO28282.1|  aspartate aminotransferase                             154   2e-42    
gb|EHH60442.1|  Aspartate aminotransferase, mitochondrial               160   2e-42    
ref|XP_007852807.1|  aspartate aminotransferase                         160   2e-42    
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644             160   2e-42    
ref|XP_008361035.1|  PREDICTED: aspartate aminotransferase, cytop...    161   2e-42    
dbj|GAC99339.1|  potential aspartate aminotransferase                   160   2e-42    
gb|KCW81535.1|  hypothetical protein EUGRSUZ_C02894                     161   2e-42    
gb|EPY74624.1|  Aspartate aminotransferase, mitochondrial precurs...    161   2e-42    
ref|XP_008352022.1|  PREDICTED: aspartate aminotransferase, cytop...    161   2e-42    
ref|WP_036249231.1|  aromatic amino acid aminotransferase               160   2e-42    
ref|XP_008220042.1|  PREDICTED: aspartate aminotransferase, cytop...    161   2e-42    
ref|XP_007222958.1|  hypothetical protein PRUPE_ppa005315mg             161   2e-42    
ref|XP_011386419.1|  putative aspartate aminotransferase                160   3e-42    
emb|CEL53865.1|  aspartate aminotransferase                             160   3e-42    
ref|XP_003293126.1|  aspartate aminotransferase                         160   3e-42    
gb|KIK28496.1|  hypothetical protein PISMIDRAFT_673506                  160   3e-42    
dbj|BAE39800.1|  unnamed protein product                                160   3e-42    
ref|WP_036168796.1|  aromatic amino acid aminotransferase               159   3e-42    
emb|CDP03316.1|  unnamed protein product                                160   3e-42    
emb|CDI51517.1|  probable aspartate aminotransferase, mitochondri...    160   3e-42    
gb|KJB64945.1|  hypothetical protein B456_010G072900                    159   3e-42    
emb|CDG84060.1|  aminotransferase class I and II family protein         159   3e-42    
sp|P08907.1|AATM_HORSE  RecName: Full=Aspartate aminotransferase,...    159   3e-42    
gb|ERE79836.1|  putative sodium-coupled neutral amino acid transp...    164   3e-42    
gb|KJB64944.1|  hypothetical protein B456_010G072900                    159   3e-42    
ref|XP_010454237.1|  PREDICTED: aspartate aminotransferase, cytop...    159   3e-42    
ref|XP_006352160.1|  PREDICTED: aspartate aminotransferase, cytop...    159   4e-42    
gb|AEB54629.1|  aspartate aminotransferase                              155   4e-42    
ref|XP_008378104.1|  PREDICTED: aspartate aminotransferase, cytop...    159   4e-42    
ref|XP_007879119.1|  hypothetical protein PFL1_03411                    160   4e-42    
gb|EST06526.1|  aspartate aminotransferase                              160   4e-42    
gb|EMS22273.1|  L-aspartate:2-oxoglutarate aminotransferase             159   4e-42    
ref|XP_010920378.1|  PREDICTED: aspartate aminotransferase, cytop...    160   4e-42    
ref|XP_002126101.1|  PREDICTED: aspartate aminotransferase, mitoc...    159   4e-42    
ref|XP_006817148.1|  PREDICTED: aspartate aminotransferase, mitoc...    160   4e-42    
gb|EGF32845.1|  Aromatic-amino-acid aminotransferase                    157   5e-42    
gb|EPT04274.1|  hypothetical protein FOMPIDRAFT_1021952                 159   5e-42    
ref|WP_034789162.1|  aromatic amino acid aminotransferase               159   5e-42    
ref|WP_019140639.1|  aspartate aminotransferase                         159   5e-42    
ref|XP_010615470.1|  PREDICTED: aspartate aminotransferase, mitoc...    159   5e-42    
dbj|GAA98712.1|  hypothetical protein E5Q_05400                         159   5e-42    
ref|WP_035827865.1|  aromatic amino acid aminotransferase               159   5e-42    
ref|XP_001495474.1|  PREDICTED: aspartate aminotransferase, mitoc...    159   5e-42    
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635              159   5e-42    
ref|XP_006909787.1|  PREDICTED: aspartate aminotransferase, mitoc...    160   5e-42    
ref|XP_009367910.1|  PREDICTED: aspartate aminotransferase, cytop...    160   5e-42    
ref|WP_034752132.1|  aromatic amino acid aminotransferase               159   6e-42    
ref|WP_028104419.1|  aromatic amino acid aminotransferase               159   6e-42    
gb|KCW80241.1|  hypothetical protein EUGRSUZ_C01585                     156   6e-42    
gb|KHG24168.1|  Aspartate aminotransferase, cytoplasmic                 159   6e-42    
ref|WP_005666272.1|  hypothetical protein                               159   6e-42    
dbj|BAC56407.1|  similar to aspartate aminotransferase                  152   6e-42    
ref|XP_008832465.1|  PREDICTED: aspartate aminotransferase, mitoc...    159   6e-42    
emb|CCF47934.1|  probable aspartate aminotransferase, mitochondri...    159   6e-42    
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828             159   7e-42    
ref|WP_027867125.1|  aromatic amino acid aminotransferase               159   7e-42    
ref|XP_005388565.1|  PREDICTED: aspartate aminotransferase, mitoc...    160   7e-42    
ref|WP_038500080.1|  aromatic amino acid aminotransferase               158   7e-42    
gb|AAA37265.1|  mitochondrial aspartate aminotransferase                159   8e-42    
gb|AEI84595.1|  mitochondrial aspartate transaminase                    158   8e-42    
ref|XP_010049084.1|  PREDICTED: aspartate aminotransferase, cytop...    161   8e-42    
gb|KGF78543.1|  aromatic amino acid aminotransferase                    158   9e-42    
ref|WP_025511365.1|  aromatic amino acid aminotransferase               158   9e-42    
gb|AGC92244.1|  putative aspartate aminotransferase isoform 2           158   9e-42    
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                   159   1e-41    
ref|WP_029496550.1|  aromatic amino acid aminotransferase               158   1e-41    
ref|XP_007137184.1|  hypothetical protein PHAVU_009G106800g             158   1e-41    
gb|KFK26196.1|  hypothetical protein AALP_AA8G215200                    158   1e-41    
ref|XP_002989786.1|  hypothetical protein SELMODRAFT_184818             158   1e-41    
dbj|BAF83536.1|  unnamed protein product                                159   1e-41    
gb|KEP52891.1|  aspartate aminotransferase                              158   1e-41    
gb|AAC50015.1|  aspartate aminotransferase cytosolic isozyme AAT2       158   1e-41    
emb|CAA63894.1|  aspartate aminotransferase                             158   1e-41    
ref|XP_006287876.1|  hypothetical protein CARUB_v10001103mg             158   1e-41    
ref|XP_007882640.1|  PREDICTED: aspartate aminotransferase, mitoc...    158   1e-41    
gb|AEX09182.1|  putative aspartate aminotransferase 1                   158   1e-41    
gb|EFW21573.1|  aspartate aminotransferase                              158   1e-41    
ref|XP_003065764.1|  aspartate aminotransferase, mitochondrial pr...    158   2e-41    
gb|AAA50160.1|  aspartate aminotransferase P1                           158   2e-41    
ref|XP_007359882.1|  PLP-dependent transferase                          158   2e-41    



>gb|KDO46793.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=363

 Score =   334 bits (856),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  121  EYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  180

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  LISSPTWGNHKNIFNDARVPWSEYRYYD  208



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 187/211 (89%), Gaps = 3/211 (1%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  328
            M ST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M   VNVS
Sbjct  1    MVSTMFSLASATPSASFSLQDNLKSKLKLGTTSQSAFFGKDFVKAKSNGRTTMTVAVNVS  60

Query  329  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  508
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERG  120

Query  509  ENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  688
            +NKEYLPIEGLAAFNKVTAELLFGADN VIQQ+RVAT+QGLSGTGSLR+AAALIERYFPG
Sbjct  121  DNKEYLPIEGLAAFNKVTAELLFGADNPVIQQQRVATIQGLSGTGSLRIAAALIERYFPG  180

Query  689  SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SKVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  211



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   334 bits (856),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  121  EYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  180

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  LISSPTWGNHKNIFNDARVPWSEYRYYD  208



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   334 bits (856),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  121  EYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  180

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  LISSPTWGNHKNIFNDARVPWSEYRYYD  208



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   330 bits (847),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 189/211 (90%), Gaps = 3/211 (1%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  328
            MAST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M  +VNVS
Sbjct  1    MASTMFSLASAAPSASFSLQDNLKSKLKLGTTSQSAFFGKDFAKAKSNGRTTMAVSVNVS  60

Query  329  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  508
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLMLERG  120

Query  509  ENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  688
            +NKEYLPIEGLAAFNKVTAELLFGADN VIQQ+RVAT+QGLSGTGSLR+AAALIERYFPG
Sbjct  121  DNKEYLPIEGLAAFNKVTAELLFGADNPVIQQQRVATIQGLSGTGSLRIAAALIERYFPG  180

Query  689  SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SKVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  211



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 185/215 (86%), Gaps = 7/215 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF-------GNATKSHGRMRMVAT  316
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF        N  KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKTRLGSGSVSTLFNKEKGNPSNKKKSFGRISMTVA  60

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVIEQQRVATVQGLSGTGSLRLAAALIER  180

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG++VLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  YFPGAQVLISSPTWGNHKNIFNDARVPWSEYRYYD  215



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 186/215 (87%), Gaps = 7/215 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  316
            MAST+ +LAS +PS SLS+Q+ LK K +L      TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASTTPSASLSMQEILKGKARLGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
            VNVSRFEGI+MAPPDPILGVSEAF+ADTD  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADTDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  180

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG++VLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  YFPGAQVLISSPTWGNHKNIFNDARVPWSEYRYYD  215



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 187/216 (87%), Gaps = 5/216 (2%)
 Frame = +2

Query  146  SPITMASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVA  313
            S   MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+GR  M  
Sbjct  4    SSFAMASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGRTTMAV  62

Query  314  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  493
             VNVSRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL
Sbjct  63   AVNVSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENL  122

Query  494  MLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIE  673
            +L+RGENKEYLPIEGLAAFNKVTAELLFG DN V+QQ+RVAT+QGLSGTGSLR+AAALIE
Sbjct  123  ILERGENKEYLPIEGLAAFNKVTAELLFGKDNPVLQQQRVATIQGLSGTGSLRIAAALIE  182

Query  674  RYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            RYFPGSK+LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  183  RYFPGSKILISSPTWGNHKNIFNDARVPWSEYRYYD  218



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 187/215 (87%), Gaps = 7/215 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GNAT---KSHGRMRMVAT  316
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF    GN +   KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKMRLGSSSVSTLFNKEKGNPSIKKKSFGRISMTVA  60

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RGENKEYL IEGLAAFNKVTAELLFGADN+VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLAIEGLAAFNKVTAELLFGADNQVIEQQRVATVQGLSGTGSLRLAAALIER  180

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG++VLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  YFPGAQVLISSPTWGNHKNIFNDARVPWSEYRYYD  215



>gb|AFP86894.1| aspartate aminotransferase, partial [Ilex paraguariensis]
Length=368

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 166/195 (85%), Gaps = 7/195 (4%)
 Frame = +2

Query  215  QDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVATVNVSRFEGISMAPPDPILG  373
            QD LK K KL      +  G         TK+ GR+ M   V VSRFE I+MAPPDPILG
Sbjct  21   QDTLKTKLKLTSSNHTSFLGKGKSVPFTNTKTFGRITMAVAVKVSRFESITMAPPDPILG  80

Query  374  VSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFN  553
            VSEAF+ADT+EMKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFN
Sbjct  81   VSEAFRADTNEMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFN  140

Query  554  KVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKN  733
            KVTAELLFGADN VIQQ+RVATVQGLSGTGSLRLAAALIERYFPG+KVLISSPTWGNHKN
Sbjct  141  KVTAELLFGADNPVIQQQRVATVQGLSGTGSLRLAAALIERYFPGAKVLISSPTWGNHKN  200

Query  734  IFNDARVPWSEYRYY  778
            IFNDA VPWSEYRYY
Sbjct  201  IFNDAGVPWSEYRYY  215



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 186/212 (88%), Gaps = 5/212 (2%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVATVNV  325
            MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+G+  M   VNV
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGQTTMAVAVNV  59

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+R
Sbjct  60   SRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILER  119

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
            GENKEYLPIEGLAAFNKVTAELLFG DN V+QQ+RVAT+QGLSGTGSLR+AAALIERYFP
Sbjct  120  GENKEYLPIEGLAAFNKVTAELLFGKDNPVLQQQRVATIQGLSGTGSLRIAAALIERYFP  179

Query  686  GSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSK+LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  180  GSKILISSPTWGNHKNIFNDARVPWSEYRYYD  211



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 185/215 (86%), Gaps = 7/215 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  316
            MAST+ +LASA+PS SLS+Q+ LK K +       TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASATPSASLSMQEILKGKARPGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  180

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG++VLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  YFPGAQVLISSPTWGNHKNIFNDARVPWSEYRYYD  215



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 183/211 (87%), Gaps = 3/211 (1%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  328
            MAST+F+LAS +PS S+SLQD LK K K+    Q    G      KS+GR  M   VNVS
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKIGTSSQRAFPGKDFMKAKSNGRTTMAVAVNVS  60

Query  329  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  508
            RFEGI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+RG
Sbjct  61   RFEGITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILERG  120

Query  509  ENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  688
            ENKEYLPIEGLAAFNKVTAELLFG DN V+QQ+RVAT+QGLSGTGSLR+AAALIERYFP 
Sbjct  121  ENKEYLPIEGLAAFNKVTAELLFGKDNPVLQQQRVATIQGLSGTGSLRIAAALIERYFPY  180

Query  689  SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SK+LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  181  SKILISSPTWGNHKNIFNDARVPWSEYRYYD  211



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            ENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAA
Sbjct  61   ENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAA  120

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  121  LIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  159



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 186/214 (87%), Gaps = 7/214 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKL-REY-----GQCTLFGNATKSHGRMRMVATV  319
            MAST+ +LAS SPS SLS  +  K K KL R +      +  LF   T+S GR+ MVA V
Sbjct  1    MASTMLSLASVSPSASLSTHETPKGKVKLGRSFLSLNKERNNLFAK-TESFGRISMVAAV  59

Query  320  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  499
            NVS+FEG++MAPPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPYVLDVVKKAENLM+
Sbjct  60   NVSKFEGVTMAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPYVLDVVKKAENLMI  119

Query  500  QRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERY  679
            +RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q++VATVQGLSGTGSLRLAAALIERY
Sbjct  120  ERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQKVATVQGLSGTGSLRLAAALIERY  179

Query  680  FPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            FPG+KVLISSPTWGNHKNIFND+RVPWSEYRYYD
Sbjct  180  FPGAKVLISSPTWGNHKNIFNDSRVPWSEYRYYD  213



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGA N VI+Q+RVATVQGLSGT
Sbjct  105  VLNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGAGNPVIEQQRVATVQGLSGT  164

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  165  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  211



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            T+S GR+ MVA VNVS+FEG+++APPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPY
Sbjct  47   TESFGRISMVAAVNVSKFEGVTLAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPY  106

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VLDVVKKAENLM++RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q++VATVQGLSGT
Sbjct  107  VLDVVKKAENLMIERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQKVATVQGLSGT  166

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFND+RVPWSEYRYYD
Sbjct  167  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDSRVPWSEYRYYD  213



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGA N VI+Q+RVATVQGLSGT
Sbjct  105  VLNVVKKAENLMLKRGENKEYLPIEGLAAFNKVTAELLFGAGNPVIEQQRVATVQGLSGT  164

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  165  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  211



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            TK  GR+ M   VNVSRFEGI+MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPY
Sbjct  45   TKHFGRVSMSVAVNVSRFEGITMAPPDPILGVSEAFKADTDERKLNLGVGAYRTEELQPY  104

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VL VVK AENLML+RGENKEYLPIEGLA FNK TAELLFGADN VI+Q+RVATVQGLSGT
Sbjct  105  VLKVVKTAENLMLERGENKEYLPIEGLATFNKATAELLFGADNPVIKQQRVATVQGLSGT  164

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  165  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  211



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            TKS GR+ MV T NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  47   TKSFGRISMVITSNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  106

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VL+VVKKA+ L+L+RGEN+EYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGT
Sbjct  107  VLNVVKKADKLLLERGENREYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGT  166

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  167  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  213



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   311 bits (798),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 164/180 (91%), Gaps = 3/180 (2%)
 Frame = +2

Query  242  LREYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNL  421
            L+  G  +L    ++S GR+ M   VNVSRFEG++MAPPDPILGVSEAF+ADT++ KLNL
Sbjct  43   LKAKGNSSL---KSQSFGRISMTVAVNVSRFEGVTMAPPDPILGVSEAFRADTNDAKLNL  99

Query  422  GVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQ  601
            GVGAYRTEELQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN VI+
Sbjct  100  GVGAYRTEELQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNPVIR  159

Query  602  QKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            + RVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  160  EGRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDAKVPWSEYRYYD  219



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 172/211 (82%), Gaps = 23/211 (11%)
 Frame = +2

Query  215  QDKLKAKPKLREYG------QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGV  376
            Q+ LK K KLR  G      +   F N  KS GR+ MVA VN SRF+GI+MAPPDPILGV
Sbjct  22   QESLKGKLKLRSSGLSFTKEKINPFANG-KSFGRVSMVAAVNASRFDGIAMAPPDPILGV  80

Query  377  SEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE------------  520
            SEAFKADT+ +KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENKE            
Sbjct  81   SEAFKADTNALKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENKEVIHVFERVDDLK  140

Query  521  ----YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  688
                YLPIEGLAAFNKVTAELLFGADN VI++++VATVQGLSGTGSLRLAAALIERYFPG
Sbjct  141  LFLNYLPIEGLAAFNKVTAELLFGADNPVIKEQKVATVQGLSGTGSLRLAAALIERYFPG  200

Query  689  SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  201  AKVLISSPTWGNHKNIFNDARVPWSEYRYYD  231



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSEAFKA T+E KLNLGVGAYRTE+LQPY
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSEAFKASTNESKLNLGVGAYRTEDLQPY  106

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VLDVVKKAENLM++RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+R+ATVQGLSGT
Sbjct  107  VLDVVKKAENLMIERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQRLATVQGLSGT  166

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLA A IERYFPG+KVLISSPTWGNHKNIFND+RVPWSEYRYYD
Sbjct  167  GSLRLAGAFIERYFPGAKVLISSPTWGNHKNIFNDSRVPWSEYRYYD  213



>gb|KHG09550.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=332

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS GR+ MV   NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYV
Sbjct  44   KSFGRVSMVVASNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYV  103

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            LDVVKKA+ L+L++GEN+EYLPIEGLAAFNKVTAELLFG DN VI+Q+RVATVQGLSGTG
Sbjct  104  LDVVKKADKLLLEKGENREYLPIEGLAAFNKVTAELLFGVDNPVIRQQRVATVQGLSGTG  163

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDAR PWSEYRYYD
Sbjct  164  SLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARAPWSEYRYYD  209



>gb|KJB55010.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=339

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 179/215 (83%), Gaps = 9/215 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  316
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  178

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFP  +VLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  179  YFPRGEVLISSPTWGNHKNIFNDAKVPWSEYRYYD  213



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 177/215 (82%), Gaps = 9/215 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  316
            MAS++F+LA AS S S+   D LK K +L      T F          TKS GR+ M A 
Sbjct  1    MASSMFSLAGASLSPSM--HDTLKEKVRLGSGSIGTWFTKDKVHSFMKTKSSGRISMTAA  58

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
            VN+SRFEGI+MA PDPILGVSEAF+AD D  KLNLGVGAYRTEEL PYVLDVVKKAENLM
Sbjct  59   VNISRFEGITMALPDPILGVSEAFRADNDAKKLNLGVGAYRTEELHPYVLDVVKKAENLM  118

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVINQQRVATVQGLSGTGSLRLAAALIER  178

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YF G+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  179  YFLGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  213



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 181/215 (84%), Gaps = 7/215 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVAT  316
            MAS++ +LAS SPS SLS+ + LK K +       T F          TKS GR+ M   
Sbjct  1    MASSMLSLASTSPSASLSVHETLKGKVRHGTGSLTTWFNKEKANRFRNTKSPGRISMAIA  60

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
            VNVSRFEGI+MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL PYVL+VVKKAENLM
Sbjct  61   VNVSRFEGITMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELHPYVLNVVKKAENLM  120

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RGE KEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGEYKEYLPIEGLAAFNKVTAELLFGADNPVIEQQRVATVQGLSGTGSLRLAAALIER  180

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG+KVLISSPTWGNHKNIFNDARV WSEYRYYD
Sbjct  181  YFPGAKVLISSPTWGNHKNIFNDARVAWSEYRYYD  215



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 180/215 (84%), Gaps = 9/215 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  316
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F           KS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKIKSFGRISMVVA  58

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
             NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL+PYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELEPYVLDVVKKADKLL  118

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  178

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG +VLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  179  YFPGGEVLISSPTWGNHKNIFNDAKVPWSEYRYYD  213



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   309 bits (791),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
             KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPY
Sbjct  47   AKSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPY  106

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VLDVVKK E LML+RG+NKEYLPIEGLAAFNK TAELLFGADN VI+Q+RVAT+QGLSGT
Sbjct  107  VLDVVKKVEALMLERGDNKEYLPIEGLAAFNKATAELLFGADNPVIKQQRVATIQGLSGT  166

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  167  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  213



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = +2

Query  215  QDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKA  394
             D  K K KL    +  LF N T+S GR+ MVA V  SRF+G++MAPPDPILGVSEAFKA
Sbjct  15   HDTHKGKIKLGSLERSNLFLN-TQSAGRVSMVAAVKTSRFDGVTMAPPDPILGVSEAFKA  73

Query  395  DTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELL  574
             T+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL
Sbjct  74   STNLMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELL  133

Query  575  FGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARV  754
            FGADN VI++++VATVQGLSGTGSLRLAAA IERYFPG+K LISSPTWGNHKNIFNDA V
Sbjct  134  FGADNPVIKEQKVATVQGLSGTGSLRLAAAFIERYFPGAKALISSPTWGNHKNIFNDAGV  193

Query  755  PWSEYRYYD  781
            PWSEYRYYD
Sbjct  194  PWSEYRYYD  202



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
             KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPY
Sbjct  48   AKSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPY  107

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VLDVVKK E+LML+RG+NKEYLPIEGLAAFNK TAELLFGA+N VI+Q+RVAT+QGLSGT
Sbjct  108  VLDVVKKVESLMLERGDNKEYLPIEGLAAFNKATAELLFGANNPVIKQQRVATIQGLSGT  167

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  168  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  214



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAST F+L SAS        DK     KL   G    F   TKS GR+ M   V  SRF+
Sbjct  1    MASTTFSLVSASVFPREISVDK----QKLGNSGSNAFF--KTKSFGRVTMSIAVKTSRFD  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTEEL PYVL VVKKAENLML+RGENK
Sbjct  55   GITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEELHPYVLSVVKKAENLMLERGENK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNKVTAELLFGA++ VI ++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKVTAELLFGANSAVINEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  175  LISSPTWGNHKNIFNDARVPWSEYRYYD  202



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 179/215 (83%), Gaps = 9/215 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  316
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  178

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFP  +VLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  179  YFPRGEVLISSPTWGNHKNIFNDAKVPWSEYRYYD  213



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            +S  R+ MVATVN SRF+G+SMAP DPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  43   QSFSRVSMVATVNASRFDGVSMAPADPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  102

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN V++++RVATVQ LSGTG
Sbjct  103  LNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNPVLKEQRVATVQSLSGTG  162

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLA A IERYFPG+KVLISSP+WGNHKNIFNDARVPWSEYRYYD
Sbjct  163  SLRLAGAFIERYFPGAKVLISSPSWGNHKNIFNDARVPWSEYRYYD  208



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
             KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  43   AKSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPY  102

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VLDVVKKA+ L+L++GEN EYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGT
Sbjct  103  VLDVVKKADKLLLEKGENLEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGT  162

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  163  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  209



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = +2

Query  269  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  448
            F N ++S GR+ M   VNVSRFEGI MAPPDPILGVSEAFKADT  +KLNLGVGAYRTEE
Sbjct  47   FSN-SRSSGRISMAVAVNVSRFEGIPMAPPDPILGVSEAFKADTSNVKLNLGVGAYRTEE  105

Query  449  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQG  628
            LQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQG
Sbjct  106  LQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQG  165

Query  629  LSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LSGTGSLRL AALIERYFPG+KVLIS+PTWGNHKNIFNDARVPWSEYRYYD
Sbjct  166  LSGTGSLRLGAALIERYFPGAKVLISNPTWGNHKNIFNDARVPWSEYRYYD  216



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 174/215 (81%), Gaps = 8/215 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  316
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
             NVSRFEGI MAPPDPILGVSEAF+AD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFRADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RG+NKEY+PIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA+IER
Sbjct  120  LERGQNKEYVPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAAVIER  179

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  180  YFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  214



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT+++KLNLGVGAYRTEELQPYV
Sbjct  39   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTNDVKLNLGVGAYRTEELQPYV  98

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTG
Sbjct  99   LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTG  158

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRL AALIERYFPG+KVLIS+PTWGNHKNIFNDARVPWSEYRYYD
Sbjct  159  SLRLGAALIERYFPGAKVLISNPTWGNHKNIFNDARVPWSEYRYYD  204



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
             KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  43   AKSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPY  102

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VLDVVKK   L+L++GEN EYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGT
Sbjct  103  VLDVVKKVNKLLLEKGENLEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGT  162

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  163  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  209



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPYVLDVVKK 
Sbjct  1    MVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPYVLDVVKKV  60

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            E+LML+RG+NKEYLPIEGLAAFNK TAELLFGA+N VI+Q+RVAT+QGLSGTGSLRLAAA
Sbjct  61   ESLMLERGDNKEYLPIEGLAAFNKATAELLFGANNPVIKQQRVATIQGLSGTGSLRLAAA  120

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  121  LIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  159



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +2

Query  257  QCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  427
            Q TLFG      KS  R  + + V VSRF  I+MAPPDPILGVSEAF+ADT EMKLNLGV
Sbjct  23   QSTLFGKDYIRAKSFTRKSVTSAVEVSRFGDITMAPPDPILGVSEAFRADTHEMKLNLGV  82

Query  428  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQK  607
            GAYRTE+LQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELL GA N+VIQQ+
Sbjct  83   GAYRTEDLQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLLGAQNDVIQQQ  142

Query  608  RVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            RVATVQGLSGTGSLRLAAALIERYF GSKVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  143  RVATVQGLSGTGSLRLAAALIERYFSGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  200



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTG
Sbjct  109  LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTG  168

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRL AALIERYFPG+KVLIS+PTWGNHKNIFNDARVPWSEYRYYD
Sbjct  169  SLRLGAALIERYFPGAKVLISNPTWGNHKNIFNDARVPWSEYRYYD  214



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 180/217 (83%), Gaps = 9/217 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQD--KLKAKPKLREYGQCTLFGN-------ATKSHGRMRMV  310
            MAS+VF+LASA+PS SLS  D  K+ ++ KL        F          TKS GR+ MV
Sbjct  1    MASSVFSLASATPSASLSSHDIEKISSQGKLNLRNTSLCFKKEKNNPFMKTKSFGRISMV  60

Query  311  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  490
               NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ 
Sbjct  61   VASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADK  120

Query  491  LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALI  670
            L+L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALI
Sbjct  121  LLLEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALI  180

Query  671  ERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            ERYFP  +VLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  181  ERYFPRGEVLISSPTWGNHKNIFNDAKVPWSEYRYYD  217



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 164/186 (88%), Gaps = 5/186 (3%)
 Frame = +2

Query  233  KPKLREYGQCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTD  403
            KPKL    Q ++FG     T+S  R  M   +NVSRFE I+MAPPDPILGVSEAF+ADT+
Sbjct  115  KPKL--LNQASVFGKRFVNTESFTRTTMAVALNVSRFESITMAPPDPILGVSEAFRADTN  172

Query  404  EMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGA  583
            EMKLNLGVGAYRTE+LQPYVL+VVKKAE LML+RGENKEYLPIEGLA+FNKVTAELL GA
Sbjct  173  EMKLNLGVGAYRTEDLQPYVLNVVKKAEKLMLERGENKEYLPIEGLASFNKVTAELLLGA  232

Query  584  DNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWS  763
            DN +I Q+RVATVQGLSGTGSLRLAAALIERYFPG+KVLISSP+WGNHKNIFNDARVPWS
Sbjct  233  DNPLILQQRVATVQGLSGTGSLRLAAALIERYFPGAKVLISSPSWGNHKNIFNDARVPWS  292

Query  764  EYRYYD  781
            EYRYYD
Sbjct  293  EYRYYD  298



>prf||1908424A Asp aminotransferase
Length=465

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTG
Sbjct  109  LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTG  168

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRL AALIERYFPG+KVLIS+PTWGNH+NIFNDARVPWSEYRYYD
Sbjct  169  SLRLGAALIERYFPGAKVLISNPTWGNHRNIFNDARVPWSEYRYYD  214



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 172/215 (80%), Gaps = 8/215 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  316
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  317  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  496
             NVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  497  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  676
            L+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSG  SLRL AALIER
Sbjct  120  LERGQNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGLVSLRLGAALIER  179

Query  677  YFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            YFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  180  YFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  214



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = +2

Query  218  DKLKAKPKLREYG--QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFK  391
            DKLK       +   Q   F NA KS  R+ MVA VNVSRFEGI MAPPDPILGVSEAF+
Sbjct  15   DKLKVGGNSLRFSKEQSNTFSNA-KSSCRISMVAAVNVSRFEGIPMAPPDPILGVSEAFR  73

Query  392  ADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAEL  571
            ADT + KLNLGVGAYRTEELQPYVL VV KAENLML+RG+NKEYL IEGLAAFNK TAEL
Sbjct  74   ADTSDAKLNLGVGAYRTEELQPYVLKVVNKAENLMLERGQNKEYLAIEGLAAFNKATAEL  133

Query  572  LFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDAR  751
            L GADN  I+Q+RVATVQGLSGTGSLRL AALIERYFPG+KVLIS+PTWGNHKNIFNDAR
Sbjct  134  LLGADNPAIKQQRVATVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNHKNIFNDAR  193

Query  752  VPWSEYRYYD  781
            VPWSEYRYYD
Sbjct  194  VPWSEYRYYD  203



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +2

Query  296  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  475
            R+ M  +VNVSRFEG++MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEELQPYVL+VV
Sbjct  13   RVSMTVSVNVSRFEGVTMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELQPYVLNVV  72

Query  476  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  655
            KKAE LML+RGENKEYLPIEGLAAFNKVTAELLFGADN VIQ+ RVAT+QGLSGTGSLRL
Sbjct  73   KKAEKLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVIQEGRVATIQGLSGTGSLRL  132

Query  656  AAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            AAA I+RYFP +K LISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  133  AAAFIQRYFPDAKALISSPTWGNHKNIFNDARVPWSEYRYYD  174



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L S S       +DKLK    L   G         KS  R+ M   V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREISKDKLK----LGTSGSNPFL--KAKSFSRVTMTVAVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            +ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  VISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            ++ G + M   VNVSRFEG++MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  53   QNSGGVTMTVAVNVSRFEGVTMAPPDPILGVSEAFKADTNSMKLNLGVGAYRTEELQPYV  112

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFN+ TAELL GADN VI+Q+RVATVQGLSGTG
Sbjct  113  LNVVKKAENLMLERGDNKEYLPIEGLAAFNRATAELLLGADNPVIKQERVATVQGLSGTG  172

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  173  SLRLAAAFIQRYFPDAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  218



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 173/208 (83%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  LISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            TKS GR+ MV   NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  79   TKSFGRISMVVASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  138

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VLDVVKKA+ L+L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGT
Sbjct  139  VLDVVKKADKLLLEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGT  198

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFP  +VLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  199  GSLRLAAALIERYFPRGEVLISSPTWGNHKNIFNDAKVPWSEYRYYD  245



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 173/208 (83%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  LISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 182/235 (77%), Gaps = 12/235 (5%)
 Frame = +2

Query  95   CIAETSPSV-----FLFLQNSPSP-ITMASTVFTlasaspsvslslQDKLKAKPKLREYG  256
            C A   PS+     F   +  P+P ++MAS++ +L S S       +DKLK    L   G
Sbjct  16   CPALRDPSICRSDRFETARFLPNPALSMASSMLSLGSTSLLPREISKDKLK----LGTSG  71

Query  257  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  436
                     KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAY
Sbjct  72   SNPFL--KAKSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAY  129

Query  437  RTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVA  616
            RTEELQPYVL+VVKKAENLML+RG+NKEYLPIEGL AFNK TAELLFGA + VI+++RVA
Sbjct  130  RTEELQPYVLNVVKKAENLMLERGDNKEYLPIEGLTAFNKATAELLFGAGHPVIKEQRVA  189

Query  617  TVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            T+QGLSGTGSLRLAAALIERYFPG+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  190  TIQGLSGTGSLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  244



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 172/208 (83%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  LISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSISRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L S S       +DKLK    L   G         KS  R+ M   V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREISKDKLK----LGTSGSNPFL--KAKSFSRVTMAVAVTPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTGSLR+AAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRVAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            +ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  VISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 170/208 (82%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L S S       +DKLK    L   G         KS  R+ M   V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREISKDKLK----LGTSGSNPFL--KAKSFSRVTMTVAVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGL AFNK TAELLFGA + VI+++RVAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLTAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            +ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  VISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            K+ GR+ +   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVSLAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VV+KAENLML+RGENKEYLPIEGLAAFNKVTA+LLFGA+N VIQQ RVATVQ LSGTG
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNKVTADLLFGANNPVIQQGRVATVQSLSGTG  157

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  158  SLRLAAAFIQRYFPDAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  203



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KVLIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VV+KAENLML+RGENKEYLPIEGLAAFNKVTA+LLFGA+N V+Q+ +VATVQ LSGTG
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNKVTADLLFGANNIVVQEGKVATVQSLSGTG  157

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  158  SLRLAAAFIQRYFPDAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  203



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KVLIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>gb|EPS60991.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=200

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            +S  R  MV    VSRF  +S+APPDPILGVSEAFKADT ++KLNLGVGAYRTE+LQPYV
Sbjct  19   RSFNRASMVIASGVSRFNEVSLAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEDLQPYV  78

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELLFGADN+VIQQ+RVATVQGLSGTG
Sbjct  79   LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLFGADNDVIQQQRVATVQGLSGTG  138

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRL A  I+RYFPGS VL+SSPTWGNHKNIF+DA VPWSEYRYYD
Sbjct  139  SLRLGAVFIQRYFPGSTVLLSSPTWGNHKNIFSDAGVPWSEYRYYD  184



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L S S       +DKLK    L   G         KS  R+ M   V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREVNKDKLK----LGTSGSNPFL--KAKSFSRVTMTVAVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  LISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L S S       +DKLK    L   G         KS  R+ M   V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREVNKDKLK----LGTSGSNPFL--KAKSFSRVTMTVAVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  175  LISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  202



>prf||2009357A Asp aminotransferase
Length=463

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RGENKEYL IEGLAAFNK TAELL GADN  I+Q RVATVQGLSGTG
Sbjct  109  LNVVKKAENLMLERGENKEYLFIEGLAAFNKATAELLLGADNPAIKQGRVATVQGLSGTG  168

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRL AALIERYFPG+KVLIS+PTWGNH+NIFNDARVPWSEYRYYD
Sbjct  169  SLRLGAALIERYFPGAKVLISNPTWGNHRNIFNDARVPWSEYRYYD  214



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  293  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  472
            GR+ M   VN SRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+V
Sbjct  44   GRISMAVAVNASRFEGIPMAPPDPILGVSEAFKADKCDLKLNLGVGAYRTEELQPYVLNV  103

Query  473  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  652
            VKKAENLML RGENKEYLPIEG AAFNK TAELL GADN  I+++RVATVQGLSGTGSLR
Sbjct  104  VKKAENLMLNRGENKEYLPIEGWAAFNKATAELLLGADNPAIKEQRVATVQGLSGTGSLR  163

Query  653  LAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             AAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  164  HAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  206



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            K   R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KCFSRVTMSVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  644  SLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SLRLAAALIERYFPG+KVLIS+PTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNHKNIFNDAKVPWSEYRYYD  202



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 161/188 (86%), Gaps = 6/188 (3%)
 Frame = +2

Query  227  KAKPKLREYGQCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKAD  397
            K KPK+   G    F  +    +S GR+  VA VN SRFEGI MAPPDPILGVSEAFKAD
Sbjct  26   KGKPKIG--GNALRFNKSFPNARSSGRVMAVA-VNGSRFEGIPMAPPDPILGVSEAFKAD  82

Query  398  TDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLF  577
            T ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NKEYL IEGLAAFNK TAELL 
Sbjct  83   TSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNKEYLSIEGLAAFNKATAELLL  142

Query  578  GADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVP  757
            GADN  I+Q+RVATVQGLSGTGSLRLAAALIERYF G+KVLISSPTWGNHKNIFNDARVP
Sbjct  143  GADNPAIKQQRVATVQGLSGTGSLRLAAALIERYFAGAKVLISSPTWGNHKNIFNDARVP  202

Query  758  WSEYRYYD  781
            WSEYRYYD
Sbjct  203  WSEYRYYD  210



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIERYFPG+KVLIS+PTWGNHKNIFNDA VPWSEYRYYD
Sbjct  174  LIERYFPGAKVLISAPTWGNHKNIFNDASVPWSEYRYYD  212



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIERYFPG+KVLIS+PTWGNHKNIFNDA VPWSEYRYYD
Sbjct  174  LIERYFPGAKVLISAPTWGNHKNIFNDASVPWSEYRYYD  212



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIERYFPG+KVLIS+PTWGNHKNIFNDA VPWSEYRYYD
Sbjct  174  LIERYFPGAKVLISAPTWGNHKNIFNDASVPWSEYRYYD  212



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIERYFPG+KVLIS+PTWGNHKNIFNDA VPWSEYRYYD
Sbjct  174  LIERYFPGAKVLISAPTWGNHKNIFNDASVPWSEYRYYD  212



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LIERYFPG+KVLIS+PTWGNHKNIFNDA VPWSEYRYYD
Sbjct  174  LIERYFPGAKVLISAPTWGNHKNIFNDASVPWSEYRYYD  212



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 172/214 (80%), Gaps = 16/214 (7%)
 Frame = +2

Query  155  TMASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMRMVATV  319
            +MAS++ +L S S       +DKLK     + P L+            K   R+ M   V
Sbjct  51   SMASSMLSLGSTSLLPREINKDKLKLGTSGSNPFLK-----------AKCFSRVTMSVAV  99

Query  320  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  499
              SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML
Sbjct  100  KPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLML  159

Query  500  QRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERY  679
            +RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERY
Sbjct  160  ERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERY  219

Query  680  FPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            FPG+KVLIS+PTWGNHKNIF DA+VPWSEYRYYD
Sbjct  220  FPGAKVLISAPTWGNHKNIFKDAKVPWSEYRYYD  253



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +2

Query  260  CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYR  439
            C L G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYR
Sbjct  35   CRL-GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYR  93

Query  440  TEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVAT  619
            TEELQPYVL+VVKKAE LML++GENKEYLPIEGLAAFNK TAELLFGADN V++Q RVAT
Sbjct  94   TEELQPYVLNVVKKAETLMLEKGENKEYLPIEGLAAFNKATAELLFGADNPVLKQGRVAT  153

Query  620  VQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            +Q LSGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  154  LQSLSGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKNIFNDAKVPWSEYRYYD  207



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   290 bits (741),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  269  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  448
             G   K+ GR+ M   V+VSRFE + MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEE
Sbjct  1    MGITRKNFGRVMMALAVDVSRFEIVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEE  60

Query  449  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQG  628
            LQPYVL+VVKKAE LML++GENKEYLPIEGLAAFNK TAELLFGADN V++Q RVAT+Q 
Sbjct  61   LQPYVLNVVKKAETLMLEKGENKEYLPIEGLAAFNKATAELLFGADNPVLKQGRVATLQS  120

Query  629  LSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LSGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  121  LSGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  171



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLRE----YGQCTLFGNATKSHGRMRMVATVNV  325
            MAS+V + AS S S S SL    K KP +R+    + +     ++++S GR+ M   VNV
Sbjct  1    MASSVLSAASHSVSPSCSLSTTHKGKPMIRDNTLGFHRGPNSFSSSRSRGRISMAVAVNV  60

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            SRFEGI MAPPDPILGVSEAFK D  ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  61   SRFEGIPMAPPDPILGVSEAFKVDNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  120

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
            G+NKEYLPIEG AAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AALIERYFP
Sbjct  121  GDNKEYLPIEGSAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAALIERYFP  180

Query  686  GSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            G+KVLIS+PTWGNHKNIFNDA VPWSEYRYYD
Sbjct  181  GAKVLISAPTWGNHKNIFNDASVPWSEYRYYD  212



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  46   SRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  105

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
            G+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTGSLRLAAALIERYFP
Sbjct  106  GDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFP  165

Query  686  GSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            G+KV+ISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  166  GAKVVISSPTWGNHKNIFNDAKVPWSEYRYYD  197



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  272  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  451
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  452  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAFNK TAELL GADN VI Q  VAT+Q L
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLLGADNPVINQGLVATLQSL  158

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  159  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  208



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  293  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  472
            GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYRTEELQPYVL+V
Sbjct  1    GRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYRTEELQPYVLNV  60

Query  473  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  652
            VKKAE LML++GENKEYLPIEGLAAFNK TAELLFGADN V++Q RVAT+Q LSGTGSLR
Sbjct  61   VKKAETLMLEKGENKEYLPIEGLAAFNKATAELLFGADNPVLKQGRVATLQSLSGTGSLR  120

Query  653  LAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LAAA I+RYFP +KVLISSPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  121  LAAAFIQRYFPEAKVLISSPTWGNHKNIFNDAKVPWSEYRYYD  163



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  272  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  451
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  452  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAFNK TAELL GADN VI Q  VAT+Q L
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLLGADNPVINQGLVATLQSL  158

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  159  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  208



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  272  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  451
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYRTEEL
Sbjct  37   GITRKNFGRVLMALAVDVSRFEGVPMAPPDPILGVSEAFKADKNDLKLNLGVGAYRTEEL  96

Query  452  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAFNK TAELL GADN VI+Q  VAT+Q L
Sbjct  97   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLLGADNPVIKQGLVATLQSL  156

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  157  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  206



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 152/178 (85%), Gaps = 3/178 (2%)
 Frame = +2

Query  257  QCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  427
            Q T  GN    +KS  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLGV
Sbjct  34   QMTFLGNDHINSKSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLGV  93

Query  428  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQK  607
            GAYRTE+LQPYVL+VVKKAE LML+  ENKEYLPIEGLAAFNK TAELLFG +N VI Q+
Sbjct  94   GAYRTEDLQPYVLNVVKKAETLMLEWAENKEYLPIEGLAAFNKATAELLFGTENPVILQQ  153

Query  608  RVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            RVATVQGLSGTGSLRLAAALIERYFP SKVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  154  RVATVQGLSGTGSLRLAAALIERYFPSSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  211



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +2

Query  257  QCTLFGN----ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLG  424
            Q T  GN    + +S  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLG
Sbjct  34   QMTFLGNDHINSKQSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLG  93

Query  425  VGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQ  604
            VGAYRTE+LQPYVL+VVKKAE LML+  ENKEYLPIEGLAAFNK TAELLFG +N VI Q
Sbjct  94   VGAYRTEDLQPYVLNVVKKAETLMLEWAENKEYLPIEGLAAFNKATAELLFGTENPVILQ  153

Query  605  KRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            +RVATVQGLSGTGSLRLAAALIERYFP SKVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  154  QRVATVQGLSGTGSLRLAAALIERYFPSSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  212



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  296  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  475
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  52   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  111

Query  476  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  655
            KKAEN+ML++GENKEYLPIEGLAAFNK T ELL GADN+  +Q RVATVQGLSGTGSLRL
Sbjct  112  KKAENMMLEKGENKEYLPIEGLAAFNKATVELLLGADNDATKQGRVATVQGLSGTGSLRL  171

Query  656  AAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            AAA I+RYFPG +VLISSPTWGNHKNIFNDA VPWSEYRYYD
Sbjct  172  AAAFIQRYFPGVQVLISSPTWGNHKNIFNDAGVPWSEYRYYD  213



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  296  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  475
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  41   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  100

Query  476  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  655
            KKAEN+ML++GENKEYLPIEGLAAFNK T ELL GADN+  +Q RVATVQGLSGTGSLRL
Sbjct  101  KKAENMMLEKGENKEYLPIEGLAAFNKATVELLLGADNDATKQGRVATVQGLSGTGSLRL  160

Query  656  AAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            AAA I+RYFPG +VLISSPTWGNHKNIFNDA VPWSEYRYYD
Sbjct  161  AAAFIQRYFPGVQVLISSPTWGNHKNIFNDAGVPWSEYRYYD  202



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  272  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  451
            G A K+ GR+ M   V+ SRFEG+ MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL
Sbjct  35   GIARKNFGRVVMALAVDTSRFEGVPMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEEL  94

Query  452  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            QP VL+VVKKAENLML++GENKEYLPIEGLAAFNK TA+LL GADN VI+Q +VAT+Q L
Sbjct  95   QPSVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATADLLLGADNPVIKQGQVATLQSL  154

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  155  SGTGSLRLAAAFIQRYFPDAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  204



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  272  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  451
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEEL
Sbjct  38   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSDLKLNLGVGAYRTEEL  97

Query  452  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            QPYVL+VVKKAENLML++GE KEYLPIEGLAAFNK TAELL GADN VI+Q  VAT+Q L
Sbjct  98   QPYVLNVVKKAENLMLEKGEYKEYLPIEGLAAFNKATAELLLGADNPVIKQGLVATLQSL  157

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  158  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  207



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   285 bits (729),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  272  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  451
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  452  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            QP VL+VVKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN VI+Q RVAT+Q L
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADNPVIKQGRVATLQSL  156

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  157  SGTGSLRLAAAFIQRYFPDAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  206



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   285 bits (729),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  272  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  451
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  452  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            QP VL+VVKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN VI+Q RVAT+Q L
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADNPVIKQGRVATLQSL  156

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  157  SGTGSLRLAAAFIQRYFPDAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  206



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M    NVSRFEG+ MAPPDPILGVSEAFKADTD++KLNLGVGAYRTE+L+PYVL+VVKKA
Sbjct  1    MAVATNVSRFEGVKMAPPDPILGVSEAFKADTDDLKLNLGVGAYRTEDLRPYVLNVVKKA  60

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            EN+ML++GENKEYLPIEGLAAF K T ELL GADN+V +Q RVATVQGLSGTGSLRL AA
Sbjct  61   ENMMLEKGENKEYLPIEGLAAFIKATVELLLGADNDVTKQGRVATVQGLSGTGSLRLGAA  120

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             I+RYFPG++VLISSPTWGNHKNIFNDA VPWSEYRYYD
Sbjct  121  FIQRYFPGTQVLISSPTWGNHKNIFNDAGVPWSEYRYYD  159



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  293  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  472
            G + M   V+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQP VL+V
Sbjct  70   GHITMALAVDASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEELQPAVLNV  129

Query  473  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  652
            VKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN VI+Q RVAT+Q LSGTGSLR
Sbjct  130  VKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADNPVIKQGRVATLQSLSGTGSLR  189

Query  653  LAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            LAAA I+RYFP +KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  190  LAAAFIQRYFPDAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  232



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 156/194 (80%), Gaps = 8/194 (4%)
 Frame = +2

Query  221  KLKAKPKLREYGQCTLFGNATKSHGRMR-------MVATVNVSRFEGISMAPPDPILGVS  379
            +L+  P +R +   ++F     S  R R       M   V+ SRFEG+ MAPPDPILGVS
Sbjct  25   RLRMTP-IRTFPSNSIFQRPFSSASRDRVNTSHITMAVAVDASRFEGVPMAPPDPILGVS  83

Query  380  EAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKV  559
            EAFKADT ++KLNLGVGAYRTEELQP VL+VVKKAE LML++GENKEYLPIEG AAFNK 
Sbjct  84   EAFKADTSDLKLNLGVGAYRTEELQPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKA  143

Query  560  TAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIF  739
            TA+LL GADN VI+Q RVAT+Q LSGTGSLRLAAA I+RYFP +KVLISSPTWGNHKNIF
Sbjct  144  TADLLLGADNPVIKQGRVATLQSLSGTGSLRLAAAFIQRYFPDAKVLISSPTWGNHKNIF  203

Query  740  NDARVPWSEYRYYD  781
            NDARVPWSEYRYYD
Sbjct  204  NDARVPWSEYRYYD  217



>emb|CAN64661.1| hypothetical protein VITISV_034785 [Vitis vinifera]
Length=420

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 144/167 (86%), Gaps = 13/167 (8%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  23   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  82

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VL+VVKK             YLPIEGLAAFNKVTAELLFGA N VI+Q+RVATVQGLSGT
Sbjct  83   VLNVVKK-------------YLPIEGLAAFNKVTAELLFGAGNPVIEQQRVATVQGLSGT  129

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            GSLRLAAALIERYFPG+KVLISSPTWGNHKNIFNDARVPWSEYRYYD
Sbjct  130  GSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYD  176



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            E LML+RGENKEYLPIEGLAAFNK TAELL GADN VI+  ++ATVQGLSGTGSLRL AA
Sbjct  61   EQLMLERGENKEYLPIEGLAAFNKATAELLLGADNPVIKNGQIATVQGLSGTGSLRLGAA  120

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             I RYFPG KVLISSPTWGNHKNI +DA VPWSEYRY+D
Sbjct  121  FIARYFPGVKVLISSPTWGNHKNILSDAGVPWSEYRYFD  159



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            E LML+RGENKEYLPIEGLAAFNK TAELL GADN VI+  ++ATVQGLSGTGSLRL AA
Sbjct  61   EQLMLERGENKEYLPIEGLAAFNKATAELLLGADNPVIKNGQIATVQGLSGTGSLRLGAA  120

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             I RYFPG KVLISSPTWGNHKNI +D  VPWSEYRY+D
Sbjct  121  FIARYFPGVKVLISSPTWGNHKNILSDVGVPWSEYRYFD  159



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+L++GEN+EYL
Sbjct  1    MAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLLLEKGENREYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLIS  706
            PIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIERYFP  +VLIS
Sbjct  61   PIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIERYFPRGEVLIS  120

Query  707  SPTWGNHKNIFNDARVPWSEYRYYD  781
            SPTWGNHKNIFNDA+VPWSEYRYYD
Sbjct  121  SPTWGNHKNIFNDAKVPWSEYRYYD  145



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            M    +VSRFE ++MAP DPILGVSEAFK D  E KLNLGVGAYRTE+LQPYVL+VVKKA
Sbjct  52   MSVATDVSRFESVTMAPADPILGVSEAFKKDNSEKKLNLGVGAYRTEDLQPYVLEVVKKA  111

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            E  ML+ G+NKEYLPIEGLAAFNK TAELL GADN  I++ RVATVQGLSGTGSLRL AA
Sbjct  112  EKKMLEGGDNKEYLPIEGLAAFNKATAELLLGADNAAIKENRVATVQGLSGTGSLRLGAA  171

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             I+RYFPG  V ISSPTWGNHKNIFNDA VPW EYRY+D
Sbjct  172  FIQRYFPGITVYISSPTWGNHKNIFNDAGVPWKEYRYFD  210



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = +2

Query  332  FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGE  511
               I M   +P + +S+AF AD  EMKL+LG+GAYRTE+LQPYVL+VVKKAE LML+R E
Sbjct  6    LSSIGMGAEEPSVELSKAFGADRYEMKLDLGLGAYRTEDLQPYVLNVVKKAEKLMLERCE  65

Query  512  NKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGS  691
            NKEYLPIEGLAAFNK TAELLFGAD+ VIQQ+RVATVQG+SGTGSLRLAAALI R+FP S
Sbjct  66   NKEYLPIEGLAAFNKATAELLFGADSPVIQQQRVATVQGISGTGSLRLAAALIHRHFPAS  125

Query  692  KVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            K+LISSPTWGNH NI NDA++PWSEYRYYD
Sbjct  126  KILISSPTWGNHPNILNDAQLPWSEYRYYD  155



>gb|ACG59771.1| chloroplast aspartate aminotransferase [Triticum aestivum]
Length=368

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  410  KLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADN  589
            KLNLGVGAYRTEELQP VL+VVKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN
Sbjct  1    KLNLGVGAYRTEELQPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADN  60

Query  590  EVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEY  769
             VI+Q RVAT+Q LSGTGSLRLAAA I+RYFP SKVLISSPTWGNHKNIFNDARVPWSEY
Sbjct  61   PVIKQGRVATLQSLSGTGSLRLAAAFIQRYFPDSKVLISSPTWGNHKNIFNDARVPWSEY  120

Query  770  RYYD  781
            RYYD
Sbjct  121  RYYD  124



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 138/187 (74%), Gaps = 8/187 (4%)
 Frame = +2

Query  242  LREYGQCTLFGNAT-------KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADT  400
            +RE+ +    G  T       K+ G    V   N SRFEG++  PPDP   + EAF+ADT
Sbjct  17   IREHPKSIRVGKRTGSLLFKAKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADT  76

Query  401  DEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFG  580
             + K+NL V AYR E LQP+VL+VVKKAE LML++GE+KEYLP++GLA FNKVTAELLFG
Sbjct  77   SDTKVNLWVRAYRVE-LQPFVLNVVKKAEKLMLEKGEDKEYLPMDGLAEFNKVTAELLFG  135

Query  581  ADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPW  760
            A+N V+Q+ RVATVQ LSGTG+L LAAA I   FP +K LISSPTW NHK IF+DA+VP+
Sbjct  136  ANNPVVQEGRVATVQTLSGTGALHLAAAFIHGNFPSAKALISSPTWSNHKTIFDDAKVPY  195

Query  761  SEYRYYD  781
            SEYRYYD
Sbjct  196  SEYRYYD  202



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 138/187 (74%), Gaps = 8/187 (4%)
 Frame = +2

Query  242  LREYGQCTLFGNAT-------KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADT  400
            +RE+ +    G  T       K+ G    V   N SRFEG++  PPDP   + EAF+ADT
Sbjct  17   IREHPKSIRVGKRTGSLLFKAKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADT  76

Query  401  DEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFG  580
             + K+NL V AYR E LQP+VL+VVKKAE LML++GE+KEYLP++GLA FNKVTAELLFG
Sbjct  77   SDTKVNLWVRAYRVE-LQPFVLNVVKKAEKLMLEKGEDKEYLPMDGLAEFNKVTAELLFG  135

Query  581  ADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPW  760
            A+N V+Q+ RVATVQ LSGTG+L LAAA I   FP +K LISSPTW NHK IF+DA+VP+
Sbjct  136  ANNPVVQEGRVATVQTLSGTGALHLAAAFIHGNFPSAKALISSPTWSNHKTIFDDAKVPY  195

Query  761  SEYRYYD  781
            SEYRYYD
Sbjct  196  SEYRYYD  202



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +2

Query  308  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  487
            V T   SR   + + PPDPILGVSEAFK DT+++KLNLGVGAYRTEEL+PYVL+VVKKAE
Sbjct  47   VDTKKQSRLAFVDLQPPDPILGVSEAFKRDTNDLKLNLGVGAYRTEELKPYVLNVVKKAE  106

Query  488  NLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  667
             +ML+  ENKEYLPI+GL AFNK TAELL G D+  I++ R+AT+Q LSGTGSLR+AA  
Sbjct  107  KIMLESEENKEYLPIQGLEAFNKATAELLLGQDHPAIKEGRIATLQSLSGTGSLRVAADF  166

Query  668  IERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            I ++ PG+   +S+PTWGNHKNIF DA V W  YRY+D
Sbjct  167  IAKFLPGTTAYLSNPTWGNHKNIFADAGVEWKWYRYFD  204



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = +2

Query  320  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  499
              SR + +  APPDPILGVSEAFK DT   KLNLGVGAYRTEELQPYVL VV+KAE  ML
Sbjct  39   TASRLDAVEQAPPDPILGVSEAFKKDTSPDKLNLGVGAYRTEELQPYVLKVVRKAEERML  98

Query  500  QRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERY  679
             + ENKEYLPIEGLA+F + T ELL GAD+  IQ+ RVA +Q LSGTGSLR+ A  I ++
Sbjct  99   AKDENKEYLPIEGLASFRQATVELLLGADSPAIQEGRVAVLQSLSGTGSLRVGAEFIAKF  158

Query  680  FPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             PG+   IS PTWGNHKNIF DA V W EY Y+D
Sbjct  159  MPGTVAYISRPTWGNHKNIFADAGVEWREYSYFD  192



>ref|XP_006495466.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Citrus 
sinensis]
Length=113

 Score =   197 bits (500),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQG  628
            ENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN V++++RV++  G
Sbjct  61   ENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVLKEQRVSSDSG  108



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            SRF  ++ APPDPILGVSEAFKA TD  KLNLGVGAYR E+L+P VL VVKKAE+ +  R
Sbjct  28   SRFADVAQAPPDPILGVSEAFKASTDPNKLNLGVGAYRDEQLKPVVLSVVKKAESKIFSR  87

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
             ENKEYL IEGL AF K T +LL G D+  I++ RVA VQ LSGTGSLR+ AA I R+  
Sbjct  88   NENKEYLTIEGLDAFRKATVDLLLGGDHPAIKEGRVAVVQSLSGTGSLRVGAAFIARFMK  147

Query  686  GSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            G+ V +S+PTWGNH+NIF D  V W  YRY+D
Sbjct  148  GATVYLSNPTWGNHRNIFGDEGVEWKYYRYFD  179



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 123/171 (72%), Gaps = 26/171 (15%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  643
            L+VV+KAENLML+RGENKEYLPIEGLAAFNKVTA+LLFGA+N V+Q+ +           
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNKVTADLLFGANNIVVQEGK-----------  146

Query  644  SLR-----LAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            S R      + ++  + F G K            NI +   VPWSEYRYYD
Sbjct  147  SFRDWITSFSCSIYTKIFSGCKSF----------NIISHMGVPWSEYRYYD  187



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = +2

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            G+  +PPDPILGVS AF+A  D  KLNLGVGAYRTEELQPYVL+VV++AE  M+  G +K
Sbjct  14   GVEPSPPDPILGVSVAFRACDDPNKLNLGVGAYRTEELQPYVLEVVREAERRMIAAGHDK  73

Query  518  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  697
            EYLP++GLA F   TAELL G  +  I +KRVAT+Q LSGTGSLR+ AA I ++ PG  V
Sbjct  74   EYLPMQGLAEFCGATAELLLGKGHPAIAEKRVATIQSLSGTGSLRVGAAFIAKFLPGKAV  133

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             + SPTWGNHKNI  D+ V W EY YYD
Sbjct  134  YLPSPTWGNHKNILADSGVEWREYAYYD  161



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 115/163 (71%), Gaps = 1/163 (1%)
 Frame = +2

Query  296  RMRMVATVN-VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  472
            R R+   V  +SRF  ++ APPDPILGVSEAF+A T   KLNLGVGAYR E+L+P VL V
Sbjct  27   RSRLALQVRCMSRFADVAQAPPDPILGVSEAFRASTSPSKLNLGVGAYRDEDLKPVVLSV  86

Query  473  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  652
            VKKAE  +  R ENKEYL IEG   F K T +LL GA +  I++ RVA +Q LSGTGSLR
Sbjct  87   VKKAEAKIFSRNENKEYLSIEGFEPFRKATVDLLLGAGHPAIKEGRVAVIQSLSGTGSLR  146

Query  653  LAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            + AA I R+  G+ V IS+PTWGNH+NIF D  V W  YRY+D
Sbjct  147  VGAAFIARFLKGATVYISNPTWGNHRNIFGDEGVKWEYYRYFD  189



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +2

Query  299  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  478
            M   A    S   G+  AP DPILGVS AF+  T+  KLNLGVGAYRTE+L+PYVLDVV+
Sbjct  1    MSTRAAAGPSFLSGVEQAPADPILGVSVAFRESTNPNKLNLGVGAYRTEDLKPYVLDVVR  60

Query  479  KAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLA  658
            +AE  M++   +KEYLP++GLA FN+ T +LL G  +  + + RVATVQ LSGTGSLR+ 
Sbjct  61   QAEKRMIEADYDKEYLPMQGLAEFNEATRKLLLGEGSAAVAESRVATVQSLSGTGSLRVG  120

Query  659  AALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            AA I ++ PG+ V + +PTWGNHKNIF DA V W EYRYYD
Sbjct  121  AAFIGKFMPGAVVYLPNPTWGNHKNIFADAGVEWREYRYYD  161



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  365  ILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLA  544
            ILGVSEAFK +T   KLNLGVGAYRTEELQPYVL VV KAE  ML+RG+NKEYL IEGL 
Sbjct  23   ILGVSEAFKRETSTDKLNLGVGAYRTEELQPYVLRVVGKAEKRMLERGDNKEYLSIEGLP  82

Query  545  AFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGN  724
             F   T ELL GAD+  +++ RVAT+Q LSGTGSLR+AAA + ++ PG  V +S PTWGN
Sbjct  83   EFRAATVELLLGADSAAVKEGRVATLQSLSGTGSLRVAAAFLAKFLPGVTVYLSRPTWGN  142

Query  725  HKNIFNDARVPWSEYRYYD  781
            HKNIF DA V W EY Y++
Sbjct  143  HKNIFGDAGVEWREYAYFN  161



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  284  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  463
            K  GR+ M   VNVSRFEGI++APPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  104  KHFGRVSMTVAVNVSRFEGITIAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  163

Query  464  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKR  610
            L VV+KAENLML+RGENKEYLPIEGLAAFNK TAELLFGADN VI+Q+R
Sbjct  164  LKVVEKAENLMLERGENKEYLPIEGLAAFNKATAELLFGADNPVIKQQR  212



>gb|ABN48559.1| chloroplast aspartate aminotransferase [Brassica juncea]
Length=135

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +2

Query  158  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  337
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  338  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  517
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  518  EYLPIEGLAAFNKVTAELLFG  580
            EYLPIEGLAAFNK TAELLFG
Sbjct  115  EYLPIEGLAAFNKATAELLFG  135



>ref|XP_002284313.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
 emb|CBI28052.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F  I  AP DPILGV+ A+  DT  +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  9    SVFSNIVRAPEDPILGVTVAYNKDTSPIKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  68

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQGLSGTGSLR+ A  + R++
Sbjct  69   PSRVKEYLPIVGLAEFNKLSAKLIFGADSPAIQENRVATVQGLSGTGSLRIGAEFLARHY  128

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  IF  A +    YRYYD
Sbjct  129  YQHTIYIPVPTWGNHPKIFTIAGLSVKTYRYYD  161



>ref|XP_006833326.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
 gb|ERM98604.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
Length=452

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S FE I+ AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VVK+AE L++  
Sbjct  50   SVFESINQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVKQAEQLLIND  109

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            G   KEYLPI GLA FNK++A L+ GAD+  I +KRVATVQGLSGTGSLR+ A  + R++
Sbjct  110  GSRVKEYLPITGLADFNKLSATLILGADSPAILEKRVATVQGLSGTGSLRVGAEFLTRHY  169

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  170  YNRTIYIPLPTWGNHPKVFTIAGLSVKTYRYYD  202



>ref|XP_005152326.1| PREDICTED: aspartate aminotransferase, mitochondrial [Melopsittacus 
undulatus]
Length=423

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 112/163 (69%), Gaps = 1/163 (1%)
 Frame = +2

Query  296  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  475
            R+   AT   S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V
Sbjct  14   RLVAAATRASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCV  73

Query  476  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  655
            +KAE ++  +  +KEYLPI GLA F + +AEL  G ++EV++  R  TVQG+SGTGSLR+
Sbjct  74   RKAEAMIASKKMDKEYLPIGGLADFTRASAELALGENSEVLKSGRYVTVQGISGTGSLRI  133

Query  656  AAALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             A  ++R+F  S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  134  GANFLQRFFKSSREVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  176



>emb|CAN70394.1| hypothetical protein VITISV_020521 [Vitis vinifera]
Length=411

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F  I  AP DPILGV+ A+  DT  +KLNLGVGAYRTEE +P VL VV++AE L++  
Sbjct  9    SVFSNIVRAPEDPILGVTVAYNKDTSPIKLNLGVGAYRTEEGKPLVLKVVRRAEQLLVND  68

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQGLSGTGSLR+ A  + R++
Sbjct  69   PSRVKEYLPIVGLAEFNKLSAKLIFGADSPAIQENRVATVQGLSGTGSLRIGAEFLARHY  128

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  IF  A +    YRYYD
Sbjct  129  YQHTIYIPVPTWGNHPKIFTIAGLSVKTYRYYD  161



>ref|XP_003970037.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Takifugu 
rubripes]
Length=428

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + S G   + AT N S + G+ M PPDPILGV+EAFK D++  K+NLGVGAYR +
Sbjct  12   CLGNISPSMG---VFATRNSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE L+  +  +KEYLPI GL  F+K  A L  GADNEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGEFSKACATLALGADNEVLKSGRSITVQ  128

Query  626  GLSGTGSLRLAAALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+ A  + R+   S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  129  TISGTGSLRIGANFLSRFHGASRDVFLPKPSWGNHTPIFRDAGMQLKAYRYYD  181



>ref|XP_008175935.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X1 [Chrysemys picta bellii]
Length=429

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 1/173 (1%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
            L   A + H  +  VA    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  10   LLSAAAQRHLCLAPVAARASSWWSHVEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDD  69

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
              +P+VL+ V+KAE  +  +  +KEYLPI GLA FNK +AEL  G  NEVI+  R  TVQ
Sbjct  70   NGKPFVLNSVRKAEAQIAAKKMDKEYLPIAGLAEFNKASAELALGDTNEVIKSGRYVTVQ  129

Query  626  GLSGTGSLRLAAALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+ A+ ++R+F  S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  130  TISGTGSLRVGASFLQRFFKYSRDVYLPKPSWGNHTPIFRDAGMQLQAYRYYD  182



>ref|XP_003442303.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Oreochromis 
niloticus]
Length=428

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE ++  +  +KEYLPI GLA F+K  A+L  G +NEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLALGPENEVLKSSRSVTVQ  128

Query  626  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+ A  + R+ PG   V +  P+WGNH  IF DA +    YRYY+
Sbjct  129  TISGTGSLRIGANFLARFHPGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYYE  181



>ref|XP_006780104.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Neolamprologus 
brichardi]
Length=428

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE ++  +  +KEYLPI GLA F+K  A+L  G +NEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLALGPENEVLKSSRSVTVQ  128

Query  626  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+ A  + R+ PG   V +  P+WGNH  IF DA +    YRYY+
Sbjct  129  TISGTGSLRIGANFLARFHPGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYYE  181



>ref|XP_004543093.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Maylandia 
zebra]
 ref|XP_005741732.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Pundamilia 
nyererei]
 ref|XP_005915269.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Haplochromis 
burtoni]
Length=428

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE ++  +  +KEYLPI GLA F+K  A+L  G +NEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLALGPENEVLKSSRSVTVQ  128

Query  626  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+ A  + R+ PG   V +  P+WGNH  IF DA +    YRYY+
Sbjct  129  TISGTGSLRIGANFLARFHPGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYYE  181



>ref|XP_003227907.1| PREDICTED: aspartate aminotransferase, mitochondrial [Anolis 
carolinensis]
Length=424

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = +2

Query  296  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  475
            R+   A    S +  + M PPDPILGV+EAFK DT   K+NLGVGAYR +  +PYVL+ V
Sbjct  15   RLASCAARASSWWAQVEMGPPDPILGVTEAFKRDTSAKKMNLGVGAYRDDNGKPYVLNCV  74

Query  476  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  655
            +KAE  +  +  +KEYLPI GLA F K +AEL  G  NEVIQ  R  TVQ +SGTGSLR+
Sbjct  75   RKAEAQIAAKKMDKEYLPIAGLAEFTKASAELALGESNEVIQSGRYVTVQTISGTGSLRV  134

Query  656  AAALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             A  ++R+F  S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  135  GANFLQRFFKSSRDVYLPKPSWGNHTPIFRDAGMQLQSYRYYD  177



>gb|KFO71408.1| hypothetical protein N303_10396, partial [Cuculus canorus]
Length=401

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFP90495.1| hypothetical protein N311_04899, partial [Apaloderma vittatum]
Length=405

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  ASRDVYLPKPSWGNHTPIFRDAGMQLQSYRYYD  154



>gb|KFP38914.1| hypothetical protein N324_09434, partial [Chlamydotis macqueenii]
Length=401

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G +NE  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENNEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFV95661.1| hypothetical protein N327_00168, partial [Fulmarus glacialis]
Length=310

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_005814426.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Xiphophorus 
maculatus]
Length=428

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 112/173 (65%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + + G +   ++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPALGAL---SSRNSSWWAGVQMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE LM  +  +KEYLPI GL  F K  A+L  GADNEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEALMASKQLDKEYLPIGGLGEFTKACAQLALGADNEVLKSGRSITVQ  128

Query  626  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+    + R+  G   V +  P+WGNH  IF DA +    YRYYD
Sbjct  129  TISGTGSLRIGGNYLARFHTGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYYD  181



>ref|XP_001176672.2| PREDICTED: aspartate aminotransferase, mitochondrial-like isoform 
2 [Strongylocentrotus purpuratus]
Length=431

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = +2

Query  308  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  487
             A+   S ++G+ M PPDPILGVSEAFK DT+  K+NLGVGAYR +E +P+VL  VK+ E
Sbjct  26   TASAKSSLWDGVEMGPPDPILGVSEAFKRDTNTNKINLGVGAYRDDEGKPFVLQSVKQVE  85

Query  488  NLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  667
            + +     +KEYLPI GLA F K  A+L FG D+   Q+ R  TVQ +SGTGSLR+  + 
Sbjct  86   DKVRNMSLDKEYLPITGLADFAKGAAKLAFGQDSHTSQEGRNVTVQTISGTGSLRVGGSF  145

Query  668  IERYFPGSKVL-ISSPTWGNHKNIFNDARVPWSEYRYYD  781
            ++++FPG+KV+ + SP+WGNH  IF  A +  + YRYYD
Sbjct  146  LQKFFPGNKVVYLPSPSWGNHTPIFKHAGLDVASYRYYD  184



>ref|XP_006109334.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial 
[Myotis lucifugus]
Length=177

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  ++KAE  +  +
Sbjct  9    SWWAHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSIRKAEAQIAAK  68

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F K +AEL  G ++EV++  R  TVQ +SGTG+LR+ A+ ++R+F 
Sbjct  69   NLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRYVTVQTISGTGALRIGASFLQRFFK  128

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  PTWGNH  IF DA +    YRYYD
Sbjct  129  FSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYD  161



>ref|XP_010878037.1| PREDICTED: aspartate aminotransferase, mitochondrial [Esox lucius]
Length=428

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = +2

Query  308  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  487
            V+T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VLD V+KAE
Sbjct  23   VSTRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLDCVRKAE  82

Query  488  NLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  667
             L+  +  +KEYL I GL  F K  A+L  GAD+EV++  R  TVQ +SGTGSLR+ A  
Sbjct  83   ALISSKQLDKEYLAIGGLGDFTKSCAQLALGADSEVLKSGRNITVQTISGTGSLRIGANF  142

Query  668  IERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            + R+   S+ V + +P+WGNH  IF DA +    YRYYD
Sbjct  143  LSRFHSASRDVYLPTPSWGNHTPIFRDAGMQLKAYRYYD  181



>ref|XP_009569498.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cuculus 
canorus]
Length=393

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_008292179.1| PREDICTED: aspartate aminotransferase, mitochondrial [Stegastes 
partitus]
Length=428

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 114/173 (66%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE L+  +  +KEYLPI GL  F K  A+L  G DNEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGDFTKACAQLALGNDNEVLKSGRNITVQ  128

Query  626  GLSGTGSLRLAAALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+ A  + R+  G + V +  P+WGNH  IF DA +    YRYYD
Sbjct  129  TISGTGSLRIGANFLSRFHGGPRDVYLPKPSWGNHTPIFRDAGMQLKAYRYYD  181



>ref|XP_009870982.1| PREDICTED: LOW QUALITY PROTEIN: aspartate aminotransferase, mitochondrial 
[Apaloderma vittatum]
Length=390

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLQSYRYYD  146



>ref|XP_010582297.1| PREDICTED: aspartate aminotransferase, mitochondrial [Haliaeetus 
leucocephalus]
Length=421

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 108/161 (67%), Gaps = 1/161 (1%)
 Frame = +2

Query  302  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  481
            R  A    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+K
Sbjct  14   RFAAARASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRK  73

Query  482  AENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAA  661
            AE ++  +  +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A
Sbjct  74   AEAMIASKKMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGA  133

Query  662  ALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
              ++R+F  S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  134  NFLQRFFKSSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  174



>gb|EMT25743.1| Aspartate aminotransferase, cytoplasmic [Aegilops tauschii]
Length=407

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F GI+  P DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++Q 
Sbjct  5    SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPMVLNVVRRAEQMLIQN  64

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  65   ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  124

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  125  HERTIYIPQPTWGNHPKVFTLAGLTARSYRYYD  157



>ref|XP_009583475.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Fulmarus glacialis]
Length=301

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_008308463.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cynoglossus 
semilaevis]
Length=428

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 119/176 (68%), Gaps = 6/176 (3%)
 Frame = +2

Query  257  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  436
            QC   GN + + G   ++++ + S + G+ M PPDPILGV+EAFK D++  K+NLGVGAY
Sbjct  11   QC--LGNISPALG---VLSSRHSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAY  65

Query  437  RTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVA  616
            R ++ +P+VL  V+KAE L+  +  +KEYLPI GL  FNK  A+L  GA+NEV++  R  
Sbjct  66   RDDQGKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGEFNKACAQLALGAENEVLKSGRNI  125

Query  617  TVQGLSGTGSLRLAAALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            TVQ +SGTGSLR+ A  + R+  G++ V +  P+WGNH  IF DA +    YRYYD
Sbjct  126  TVQTISGTGSLRIGANFLSRFHGGARDVYLPKPSWGNHTPIFRDAGMQLKAYRYYD  181



>ref|XP_010127976.1| PREDICTED: aspartate aminotransferase, mitochondrial [Chlamydotis 
macqueenii]
Length=393

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G +NE  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENNEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>gb|KFP19653.1| hypothetical protein Z169_06078, partial [Egretta garzetta]
Length=401

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_006110233.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Pelodiscus 
sinensis]
Length=423

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +  +KE
Sbjct  29   VEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNSVRKAEAQIAAKKMDKE  88

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+ A+ ++R+F  S+ V
Sbjct  89   YLPIAGLAEFNKASAELALGDTNEVIKNGRYVTVQTISGTGSLRVGASFLQRFFKYSRDV  148

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  P+WGNH  IF DA +    YRYYD
Sbjct  149  YLPKPSWGNHTPIFRDAGMQLHAYRYYD  176



>gb|KFZ50221.1| hypothetical protein N321_06413, partial [Caprimulgus carolinensis]
Length=401

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFQ16652.1| hypothetical protein N330_09915, partial [Leptosomus discolor]
Length=401

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_006020296.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Alligator sinensis]
Length=418

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +  +KE
Sbjct  24   VEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNCVRKAEAQIAAKKMDKE  83

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA FNK +AEL  G  +EVI+  R  TVQ +SGTGSLR+ A  ++R+F  S+ V
Sbjct  84   YLPIAGLAEFNKASAELALGETSEVIKNGRYVTVQSISGTGSLRIGANFLQRFFKSSRDV  143

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  P+WGNH  IF DA +    YRYYD
Sbjct  144  YLPKPSWGNHTPIFRDAGLQLQAYRYYD  171



>ref|XP_003758636.1| PREDICTED: aspartate aminotransferase, mitochondrial [Sarcophilus 
harrisii]
Length=402

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  3    SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAGK  62

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F K +AEL  G DNEV++ KR  TVQ +SGTG+LR+ A+ ++R+F 
Sbjct  63   NMDKEYLPIGGLAEFCKASAELALGEDNEVLKNKRYVTVQTISGTGALRVGASFLQRFFK  122

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +  + YRYYD
Sbjct  123  FSRDVYLPKPSWGNHTPIFRDAGMQLNGYRYYD  155



>tpg|DAA57531.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=281

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 112/170 (66%), Gaps = 1/170 (1%)
 Frame = +2

Query  275  NATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQ  454
            +AT +      +A+   S F  +  AP DPILGV+ A+  D   +K+NLGVGAYRTEE +
Sbjct  40   SATSTLESFPTMASQGSSVFAALEQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGK  99

Query  455  PYVLDVVKKAENLMLQRGEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  631
            P VL+VV++AE +++      KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ L
Sbjct  100  PLVLNVVRRAEQMLINNPSRVKEYLPITGLAEFNKLSAKLIFGADSPAIQENRVATVQCL  159

Query  632  SGTGSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            SGTGSLR+    + R++    + I  PTWGNH  +F  + +    YRYYD
Sbjct  160  SGTGSLRVGGEFLARHYHERTIYIPQPTWGNHPKVFTLSGLNVRSYRYYD  209



>gb|KFV01058.1| hypothetical protein N339_06116, partial [Pterocles gutturalis]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEATIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  PTWGNH  IF DA +    YRYYD
Sbjct  122  ASRDVYLPKPTWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFP55374.1| hypothetical protein N322_09365, partial [Cariama cristata]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFP71016.1| hypothetical protein N310_05849, partial [Acanthisitta chloris]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  ASRDVYLPKPSWGNHTPIFRDAGMQLQAYRYYD  154



>gb|KFO97280.1| hypothetical protein N300_07039, partial [Calypte anna]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKNGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFR02997.1| hypothetical protein Y956_09274, partial [Nipponia nippon]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  ASRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>emb|CBI20886.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F+ +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  20   SVFDHVVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  79

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            R   KEYLPI GLA FNK++A+L+FGAD+  IQ KRV TVQ LSGTGSLR+ A  + R+ 
Sbjct  80   RSRVKEYLPIVGLAEFNKLSAKLMFGADSPAIQVKRVTTVQCLSGTGSLRVGAEFLARHH  139

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  IF  A +    YRYYD
Sbjct  140  HQRTIYIPQPTWGNHGKIFTLAGLSVKTYRYYD  172



>gb|EMS51413.1| Aspartate aminotransferase, cytoplasmic [Triticum urartu]
Length=439

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F GI+  P DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++Q 
Sbjct  5    SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLIQN  64

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  65   ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  124

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  125  HERTIYIPQPTWGNHPKVFTLAGLTARSYRYYD  157



>gb|KGL91867.1| hypothetical protein N301_16701, partial [Charadrius vociferus]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGMQLQAYRYYD  154



>gb|KFQ68668.1| hypothetical protein N335_07592, partial [Phaethon lepturus]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_007549969.1| PREDICTED: aspartate aminotransferase, mitochondrial [Poecilia 
formosa]
Length=428

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 111/173 (64%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + + G +   ++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPALGAL---SSRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE LM  +  +KEYLPI G   F K  A+L  GADNEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEALMASKQLDKEYLPIGGFGEFTKACAQLALGADNEVLKSGRSVTVQ  128

Query  626  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+    + R+  G   V +  P+WGNH  IF DA +    YRYYD
Sbjct  129  TISGTGSLRIGGNYLARFHTGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYYD  181



>gb|KFW71608.1| hypothetical protein AS28_11098, partial [Pygoscelis adeliae]
Length=401

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFV53116.1| hypothetical protein N328_06671, partial [Gavia stellata]
Length=401

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGMQLQAYRYYD  154



>gb|KFP56730.1| hypothetical protein N323_06988, partial [Cathartes aura]
Length=401

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFV00678.1| hypothetical protein N340_11396, partial [Tauraco erythrolophus]
Length=401

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_007762781.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW86661.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
Length=410

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = +2

Query  323  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  502
            +S +  +   PPDPILG++EAFKADTD  K+NLGVGAYR E  +PYVL+ VKKAE ++  
Sbjct  6    LSTWSAVPAGPPDPILGITEAFKADTDSRKINLGVGAYRDENGKPYVLNAVKKAEEIITA  65

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
               +KEYLPI GLA+F K  A+L +GA++  + Q  VA  Q +SGTG+LR+  A + R++
Sbjct  66   AKLDKEYLPITGLASFTKNAAKLAYGAESVPLNQNAVAVTQAISGTGALRIGGAFLARHY  125

Query  683  PGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            PG+K + + +P+WGNHK +F D+ +   +YRY+D
Sbjct  126  PGAKAIYLPTPSWGNHKPLFMDSGLEVRQYRYFD  159



>ref|XP_004317705.1| PREDICTED: aspartate aminotransferase, mitochondrial [Tursiops 
truncatus]
Length=430

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL VV+KAE  +  R  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPVVRKAEAQIAARNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G  NEV++  R  TVQ +SGTG+LR+ A  ++R+F  S+ V
Sbjct  96   YLPIGGLAEFCKASAELALGESNEVLKSGRYITVQTISGTGALRIGANFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  156  FLPKPTWGNHTPIFRDAGMQLHSYRYYD  183



>ref|XP_002284136.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
Length=450

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F+ +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  48   SVFDHVVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  107

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            R   KEYLPI GLA FNK++A+L+FGAD+  IQ KRV TVQ LSGTGSLR+ A  + R+ 
Sbjct  108  RSRVKEYLPIVGLAEFNKLSAKLMFGADSPAIQVKRVTTVQCLSGTGSLRVGAEFLARHH  167

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  IF  A +    YRYYD
Sbjct  168  HQRTIYIPQPTWGNHGKIFTLAGLSVKTYRYYD  200



>gb|EMP28841.1| Aspartate aminotransferase [Chelonia mydas]
Length=388

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  13   SWWSHVEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNSVRKAEAQIAAK  72

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+  + ++R+F 
Sbjct  73   KMDKEYLPIAGLAEFNKASAELALGDTNEVIKNGRYVTVQTISGTGSLRVGGSFLQRFFK  132

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  133  YSRDVYLPKPSWGNHTPIFRDAGMQLHAYRYYD  165



>emb|CDM84293.1| unnamed protein product [Triticum aestivum]
Length=454

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F GI+  P DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VVK+AE +++  
Sbjct  52   SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVKRAEQMLIHN  111

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  112  ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  171

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  172  HERTIYIPQPTWGNHPKVFTLAGLTARSYRYYD  204



>ref|XP_004340638.1| aspartate aminotransferase, cytoplasmic, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR18599.1| aspartate aminotransferase, cytoplasmic, putative [Acanthamoeba 
castellanii str. Neff]
Length=440

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 115/183 (63%), Gaps = 12/183 (7%)
 Frame = +2

Query  245  REYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLG  424
            R    C +  N   S+ +M             + +AP DPILG++ A+KAD    KLNLG
Sbjct  14   RIVNSCIVSPNECSSNKKMSQY-------ISNVPVAPEDPILGINVAYKADPSTDKLNLG  66

Query  425  VGAYRTEELQPYVLDVVKKAENLMLQR-GENKEYLPIEGLAAFNKVTAELLFGADNEVIQ  601
            VGAYRTEE  P VL+VV+K E L+      NKEYLPIEGL  F   TA+L+FGAD+  + 
Sbjct  67   VGAYRTEEGLPLVLNVVRKVEQLVANDVSLNKEYLPIEGLPDFTAHTAKLIFGADSPALA  126

Query  602  QKRVATVQGLSGTGSLRLAAALIERYFPG---SKVLISSPTWGNHKNIFNDARVP-WSEY  769
            +KRVATVQ LSGTG+LR+ A  + R+ PG   + V IS PTWGNH NIF DA +P   +Y
Sbjct  127  EKRVATVQALSGTGALRIGAEFLARFAPGGAATPVYISDPTWGNHTNIFKDAHMPDVRKY  186

Query  770  RYY  778
            RYY
Sbjct  187  RYY  189



>ref|XP_007438961.1| PREDICTED: aspartate aminotransferase, mitochondrial [Python 
bivittatus]
Length=424

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = +2

Query  296  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  475
            R+  +A    S +  + M  PDPILGV+EAFK DT   K+NLGVGAYR +  +PYVL+ V
Sbjct  15   RVAALAVRASSWWTHVEMGLPDPILGVTEAFKRDTSAKKMNLGVGAYRDDNGKPYVLNCV  74

Query  476  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  655
            ++AE  +  +  +KEYLPI GLA FNK +AEL  G  NEVIQ  R  TVQ +SGTGSLR+
Sbjct  75   RRAEAQIASKKMDKEYLPIAGLADFNKASAELALGETNEVIQSGRYVTVQTISGTGSLRV  134

Query  656  AAALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             A  ++R+F  S  V +  P+WGNH  IF DA +    YRYYD
Sbjct  135  GANFLQRFFTASHDVFLPKPSWGNHTPIFRDAGLQLQSYRYYD  177



>gb|EFB22248.1| hypothetical protein PANDA_000063 [Ailuropoda melanoleuca]
Length=401

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  2    SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F K +AEL  G +NEV++  R ATVQ +SGTG+LR+ A+ ++R+F 
Sbjct  62   NLDKEYLPIAGLAEFCKASAELALGENNEVLKSSRYATVQTISGTGALRIGASFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  FSRDVFLPKPSWGNHTPIFRDAGMQLHGYRYYD  154



>ref|XP_010250350.1| PREDICTED: aspartate aminotransferase, cytoplasmic, partial [Nelumbo 
nucifera]
Length=458

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F  I+ AP DPILGV+ A+  D+  +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  56   SVFANIAKAPEDPILGVTVAYNKDSSPIKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  115

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+ A  + +++
Sbjct  116  PSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGAEFLAKHY  175

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
              + + I  PTWGNH  +F  A +    YRYYD
Sbjct  176  HQNSIYIPQPTWGNHPKVFTMAGLSPKYYRYYD  208



>ref|XP_005229254.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco peregrinus]
 ref|XP_005440356.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco cherrug]
Length=393

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>gb|KFQ73258.1| hypothetical protein N337_00339, partial [Phoenicopterus ruber 
ruber]
Length=401

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIVGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQGYRYYD  154



>ref|XP_009958443.1| PREDICTED: aspartate aminotransferase, mitochondrial [Leptosomus 
discolor]
Length=393

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>gb|EOA96948.1| Aspartate aminotransferase, mitochondrial, partial [Anas platyrhynchos]
Length=402

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  3    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  62

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  63   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  122

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  123  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  155



>gb|KIJ68385.1| hypothetical protein HYDPIDRAFT_173129 [Hydnomerulius pinastri 
MD-312]
Length=424

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = +2

Query  323  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  502
            +S +  +   PPDPILG+SEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGISEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEAKMAL  79

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
               +KEYLPI GLA+F +  A+L +GAD+E ++Q  +A  Q +SGTG+LR+  A + R++
Sbjct  80   AKLDKEYLPITGLASFAQNAAKLAYGADSEPLKQNAIAVTQSISGTGALRIGGAFMARHY  139

Query  683  PGSKVL-ISSPTWGNHKNIFNDARVPWSEYRYYD  781
            PG+K++ + +PTWGNH  +F D+ +    YRY+D
Sbjct  140  PGAKIIYLPTPTWGNHIPLFKDSGLEVRHYRYFD  173



>gb|KFV92257.1| hypothetical protein N326_05957, partial [Eurypyga helias]
Length=401

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_009641563.1| PREDICTED: aspartate aminotransferase, mitochondrial [Egretta 
garzetta]
Length=393

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_010164289.1| PREDICTED: aspartate aminotransferase, mitochondrial [Caprimulgus 
carolinensis]
Length=393

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_009078129.1| PREDICTED: aspartate aminotransferase, mitochondrial [Acanthisitta 
chloris]
Length=393

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLQAYRYYD  146



>ref|XP_006863643.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X2 [Chrysochloris asiatica]
Length=415

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 111/161 (69%), Gaps = 1/161 (1%)
 Frame = +2

Query  302  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  481
            R+++ +  +   G++M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+K
Sbjct  8    RLLSGITAAFHPGLAMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRK  67

Query  482  AENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAA  661
            AE  +  +  +KEYLPI GLA F K +AEL  G ++EV +  R  TVQ +SGTG+LR+ A
Sbjct  68   AEAQIAAKNMDKEYLPIGGLAEFCKSSAELALGENSEVFKSGRYVTVQTISGTGALRIGA  127

Query  662  ALIERYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            + ++R+F  S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  128  SFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLHGYRYYD  168



>ref|XP_009697580.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cariama 
cristata]
Length=393

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_009468749.1| PREDICTED: aspartate aminotransferase, mitochondrial [Nipponia 
nippon]
Length=393

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>gb|KFV54532.1| hypothetical protein N341_00606, partial [Tyto alba]
Length=401

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +P+VL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPFVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFQ63469.1| hypothetical protein N334_09493, partial [Pelecanus crispus]
Length=401

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAVIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S  V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSHDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>sp|P37833.1|AATC_ORYSJ RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Oryza sativa Japonica Group]
 dbj|BAA03504.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAB61211.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC78585.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|ABL74572.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|EAY75902.1| hypothetical protein OsI_03821 [Oryza sativa Indica Group]
 gb|EAZ13614.1| hypothetical protein OsJ_03530 [Oryza sativa Japonica Group]
Length=407

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F G++ AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  5    SVFAGLAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLINN  64

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  65   PSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  124

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  125  HERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYD  157



>ref|XP_010080711.1| PREDICTED: aspartate aminotransferase, mitochondrial [Pterocles 
gutturalis]
Length=393

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEATIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              PTWGNH  IF DA +    YRYYD
Sbjct  121  PKPTWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_009881551.1| PREDICTED: aspartate aminotransferase, mitochondrial [Charadrius 
vociferus]
Length=393

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLQAYRYYD  146



>ref|XP_008503619.1| PREDICTED: aspartate aminotransferase, mitochondrial [Calypte 
anna]
Length=393

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKNGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>gb|KFO63074.1| hypothetical protein N302_07001, partial [Corvus brachyrhynchos]
Length=401

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  ASRDVYLPKPSWGNHTPIFRDAGMQLQAYRYYD  154



>ref|XP_008175936.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X2 [Chrysemys picta bellii]
Length=393

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 104/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +P+VL+ V+KAE  +  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPFVLNSVRKAEAQIAAKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+ A+ ++R+F  S+ V +
Sbjct  61   PIAGLAEFNKASAELALGDTNEVIKSGRYVTVQTISGTGSLRVGASFLQRFFKYSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLQAYRYYD  146



>ref|XP_009980094.1| PREDICTED: aspartate aminotransferase, mitochondrial [Tauraco 
erythrolophus]
Length=393

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_008033064.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
 gb|EIW64721.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
Length=425

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 109/157 (69%), Gaps = 1/157 (1%)
 Frame = +2

Query  314  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  493
            T ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE +
Sbjct  19   TGSLSAWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEEI  78

Query  494  MLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIE  673
            ++Q+  +KEYLPI GL  F +  A+L +GAD+  +  K VA  Q +SGTG+LR+  A + 
Sbjct  79   LVQQNPDKEYLPITGLPEFTQAAAKLAYGADSAPLLAKSVAATQSISGTGALRIGGAFLG  138

Query  674  RYFPGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            R++P SK + + +P+WGNH  IF D+ +    YRY+D
Sbjct  139  RFYPHSKTIYLPNPSWGNHTPIFRDSGLEVKTYRYFD  175



>ref|XP_009328640.1| PREDICTED: aspartate aminotransferase, mitochondrial [Pygoscelis 
adeliae]
Length=393

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_010860133.1| PREDICTED: aspartate aminotransferase, mitochondrial [Bison bison 
bison]
Length=430

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R  TVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  156  FLPKPTWGNHTPIFRDAGMQLQSYRYYD  183



>gb|KIJ21699.1| aspartate transaminase [Paxillus involutus ATCC 200175]
Length=424

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 108/154 (70%), Gaps = 1/154 (1%)
 Frame = +2

Query  323  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  502
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDESGKPYVLNAVKKAEEKMAS  79

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
               +KEYLPI GLA+F +  A+L +GAD+  + Q  +A  Q +SGTG+LR+  A + R++
Sbjct  80   AKLDKEYLPITGLASFTQNAAKLAYGADSAPLNQHAIAVTQTISGTGALRIGGAFVARHY  139

Query  683  PGSKVL-ISSPTWGNHKNIFNDARVPWSEYRYYD  781
            PGSK++ + +PTWGNH  +F D+ +   +YRY+D
Sbjct  140  PGSKIIYLPNPTWGNHIPLFKDSGLEVRQYRYFD  173



>ref|XP_009924468.1| PREDICTED: aspartate aminotransferase, mitochondrial [Haliaeetus 
albicilla]
Length=393

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|NP_777231.1| aspartate aminotransferase, mitochondrial [Bos taurus]
 sp|P12344.2|AATM_BOVIN RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; 
AltName: Full=Fatty acid-binding protein; Short=FABP-1; 
AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: 
Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine 
aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate 
transaminase 4; AltName: Full=Kynurenine--oxoglutarate 
transaminase IV; AltName: Full=Plasma membrane-associated 
fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase 
A; Flags: Precursor [Bos taurus]
 emb|CAA80960.1| aspartate aminotransferase [Bos taurus]
 gb|AAI02304.1| Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate 
aminotransferase 2) [Bos taurus]
 gb|ABQ12926.1| aspartate aminotransferase 2 precursor [Bos taurus]
 tpg|DAA20016.1| TPA: aspartate aminotransferase, mitochondrial [Bos taurus]
Length=430

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R  TVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  156  FLPKPTWGNHTPIFRDAGMQLQSYRYYD  183



>ref|XP_004245266.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=452

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F  I  AP DPILGV+ A+  DT  MKLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  50   SVFSHIVRAPEDPILGVTVAYNKDTSPMKLNLGVGAYRTEEGKPLVLNVVRQAEQLLVND  109

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            R   KEYLPI GLA FNK++A+L+ GAD+  IQ+ RV TVQ LSGTGSLR+    + +++
Sbjct  110  RSRIKEYLPITGLADFNKLSAKLILGADSPAIQENRVTTVQCLSGTGSLRVGGEFLAQHY  169

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  IF  A +    YRYYD
Sbjct  170  HQRTIYIPQPTWGNHTKIFALAGLSVKSYRYYD  202



>gb|KFM02723.1| hypothetical protein AS27_01862, partial [Aptenodytes forsteri]
Length=401

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTQASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S  V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSHDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_010292847.1| PREDICTED: aspartate aminotransferase, mitochondrial [Phaethon 
lepturus]
Length=393

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_002912325.1| PREDICTED: aspartate aminotransferase, mitochondrial [Ailuropoda 
melanoleuca]
Length=430

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R ATVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSSRYATVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  P+WGNH  IF DA +    YRYYD
Sbjct  156  FLPKPSWGNHTPIFRDAGMQLHGYRYYD  183



>ref|XP_009809693.1| PREDICTED: aspartate aminotransferase, mitochondrial [Gavia stellata]
Length=393

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLQAYRYYD  146



>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKA|B Chain B, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKB|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKC|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate- 
Binding Lysine Residue
Length=401

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  FSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_007067232.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Chelonia 
mydas]
Length=393

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNSVRKAEAQIAAKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+  + ++R+F  S+ V +
Sbjct  61   PIAGLAEFNKASAELALGDTNEVIKNGRYVTVQTISGTGSLRVGGSFLQRFFKYSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLHAYRYYD  146



>ref|XP_005899976.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X1 [Bos mutus]
 gb|ELR53419.1| Aspartate aminotransferase, mitochondrial [Bos mutus]
Length=430

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R  TVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  156  FLPKPTWGNHTPIFRDAGMQLQSYRYYD  183



>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|7AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|A Chain A, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|B Chain B, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|1TAR|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAR|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1OXO|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1OXO|B Chain B, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1IVR|A Chain A, Structure Of Aspartate Aminotransferase
 pdb|1AMA|A Chain A, Domain Closure In Mitochondrial Aspartate Aminotransferase
 pdb|1MAP|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1MAQ|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1OXP|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Closed Conformation
Length=401

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  FSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_005490808.1| PREDICTED: aspartate aminotransferase, mitochondrial [Zonotrichia 
albicollis]
Length=422

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  23   SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  82

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  83   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  142

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  143  ASRDVYLPKPSWGNHTPIFRDAGMQLQAYRYYD  175



>ref|XP_005025720.1| PREDICTED: aspartate aminotransferase, mitochondrial [Anas platyrhynchos]
Length=427

 Score =   167 bits (423),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  +KE
Sbjct  33   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKE  92

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V
Sbjct  93   YLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDV  152

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  P+WGNH  IF DA +    YRYYD
Sbjct  153  YLPKPSWGNHTPIFRDAGLQLQAYRYYD  180



>emb|CAA45023.1| aspartate aminotransferase [Panicum miliaceum]
 dbj|BAA04992.1| aspartate aminotransferase [Panicum miliaceum]
Length=409

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = +2

Query  308  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  487
            +A+   S F GI+ AP DPILGV+ AF  D   +K+NLGVGAYRTEE +P VL+VV++AE
Sbjct  1    MASQVASVFAGIAQAPEDPILGVTVAFNKDPSPVKINLGVGAYRTEEGKPLVLNVVRRAE  60

Query  488  NLMLQRGEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
             +++      KEYLPI GLA +NK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+   
Sbjct  61   QMLINDPSRVKEYLPITGLAEYNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGE  120

Query  665  LIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             + +++    + I  PTWGNH  +F  A +    YRYYD
Sbjct  121  FLAKHYHERTIYIPVPTWGNHPKVFTLAGLTVRSYRYYD  159



>gb|KFW90670.1| hypothetical protein N336_10326, partial [Phalacrocorax carbo]
Length=401

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 104/153 (68%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GL  F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLVDFTRASAELALGENSEAFKSSRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFQ35253.1| hypothetical protein N331_07571, partial [Merops nubicus]
Length=401

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 104/153 (68%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE L+  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEALIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F +  AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRAAAELALGENSEPFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQGYRYYD  154



>ref|XP_008401656.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Poecilia reticulata]
Length=427

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 105/160 (66%), Gaps = 1/160 (1%)
 Frame = +2

Query  305  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  484
            +V  +  S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VL  V+KA
Sbjct  21   IVLVLCSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLSCVRKA  80

Query  485  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  664
            E LM  +  +KEYLPI G   F K  A+L  GADNEV++  R  TVQ +SGTGSLR+   
Sbjct  81   EALMTSKQLDKEYLPIGGFGEFTKACAQLALGADNEVLKSGRSVTVQTISGTGSLRIGGN  140

Query  665  LIERYFPG-SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             + R+  G   V +  P+WGNH  IF DA +    YRYYD
Sbjct  141  YLARFHTGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYYD  180



>gb|KFU92658.1| hypothetical protein M959_01402, partial [Chaetura pelagica]
Length=401

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 104/153 (68%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++   
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASN  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  ASRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>gb|KFV73576.1| hypothetical protein N308_13552, partial [Struthio camelus australis]
Length=401

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAQIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYYD
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYD  154



>ref|XP_005981403.1| PREDICTED: aspartate aminotransferase, mitochondrial [Pantholops 
hodgsonii]
Length=430

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R  TVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIGGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  156  FLPKPTWGNHTPIFRDAGMQLQSYRYYD  183



>ref|XP_004350746.1| aspartate aminotransferase [Dictyostelium fasciculatum]
 gb|EGG14038.1| aspartate aminotransferase [Dictyostelium fasciculatum]
Length=415

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 106/167 (63%), Gaps = 0/167 (0%)
 Frame = +2

Query  281  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  460
            T+S  R+   +TV   R+  +   P DPILGV+ AF  DT   K+NLGVGAYR +  +PY
Sbjct  2    TRSMNRLYSTSTVGSKRWSHVQKGPEDPILGVTVAFNKDTSPSKINLGVGAYRDDNNKPY  61

Query  461  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  640
            VL+ VKKAE  + +   + EY PI G+A+FN   A L  G DN  I++K++ TVQ +SGT
Sbjct  62   VLEAVKKAEKKIFEANVDHEYAPIVGVASFNNAAAVLALGEDNSYIKEKKITTVQTISGT  121

Query  641  GSLRLAAALIERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            G+LR+AA    R+ PG    + +PTWGNH  IF D++VP   Y YY+
Sbjct  122  GALRVAAEFFGRFLPGVTAYVPNPTWGNHNVIFADSKVPVKSYSYYN  168



>gb|KIP12008.1| hypothetical protein PHLGIDRAFT_27620 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=425

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 104/154 (68%), Gaps = 1/154 (1%)
 Frame = +2

Query  323  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  502
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAEN++  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDEHGKPYVLNSVKKAENIIAS  81

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
               +KEYLPI GLA F K   +L +G D+  +Q   VA  Q +SGTG+LR+  A + R++
Sbjct  82   SNPDKEYLPITGLADFTKAAVKLAYGTDSAPLQANSVAVTQSISGTGALRIGGAFLGRFY  141

Query  683  PGSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            P SK + + +P+WGNH  IF D+ +    YRY+D
Sbjct  142  PHSKTIYLPTPSWGNHTPIFRDSGLEVKTYRYFD  175



>gb|KIK94907.1| hypothetical protein PAXRUDRAFT_827518 [Paxillus rubicundulus 
Ve08.2h10]
Length=424

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +2

Query  323  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  502
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDSRKINLGVGAYRDENGKPYVLNAVKKAEEKMAS  79

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
               +KEYLPI GL +F +  A+L +GAD+  + Q  +A  Q +SGTG+LR+  A + R++
Sbjct  80   AKLDKEYLPITGLGSFTQNAAKLAYGADSAPLNQHAIAVTQSISGTGALRIGGAFVARHY  139

Query  683  PGSKVL-ISSPTWGNHKNIFNDARVPWSEYRYYD  781
            PGSK++ + +PTWGNH  +F D+ +   +YRY+D
Sbjct  140  PGSKIIYLPNPTWGNHIPLFKDSGLEVRQYRYFD  173



>ref|XP_003209725.2| PREDICTED: aspartate aminotransferase, mitochondrial [Meleagris 
gallopavo]
Length=393

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKFSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>gb|KIM66148.1| hypothetical protein SCLCIDRAFT_1211371 [Scleroderma citrinum 
Foug A]
Length=424

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 115/172 (67%), Gaps = 3/172 (2%)
 Frame = +2

Query  269  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  448
             G A +S    R VA+V  S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E 
Sbjct  4    IGAARRSPALFRNVASV--STWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDEN  61

Query  449  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQG  628
             +PYVL+ VKKAE  M     +KEYL I GLA+F +  A+L +G D+E+++Q  +A  Q 
Sbjct  62   GKPYVLNAVKKAEEKMAAAQLDKEYLGITGLASFTQNAAKLAYGVDSELLKQNAIAVTQS  121

Query  629  LSGTGSLRLAAALIERYFPGSKVL-ISSPTWGNHKNIFNDARVPWSEYRYYD  781
            +SGTG+LR+  A I R++P +KV+ + +PTWGNH  +F D+ +    YRY+D
Sbjct  122  ISGTGALRIGGAFIARHYPHAKVIYLPTPTWGNHIPLFKDSGLEVRRYRYFD  173



>ref|XP_008700791.1| PREDICTED: aspartate aminotransferase, mitochondrial [Ursus maritimus]
Length=430

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R ATVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSGRYATVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  P+WGNH  IF DA +    YRYYD
Sbjct  156  FLPKPSWGNHTPIFRDAGMQLHGYRYYD  183



>ref|XP_006052520.1| PREDICTED: aspartate aminotransferase, mitochondrial [Bubalus 
bubalis]
Length=430

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT   K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTSSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R  TVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  156  FLPKPTWGNHTPIFRDAGMQLQSYRYYD  183



>dbj|BAJ97930.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F GI+  P DPILGV+ A+  D   +K+NLGVGA+RTEE +P VL+VV++AE +++  
Sbjct  57   SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAHRTEEGKPLVLNVVRRAEQMLIHN  116

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  117  ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  176

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  177  HERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYD  209



>ref|XP_010147321.1| PREDICTED: aspartate aminotransferase, mitochondrial [Eurypyga 
helias]
Length=393

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|NP_001044317.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAD87343.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06231.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAG96155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F G++ AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  58   SVFAGLAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLINN  117

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  118  PSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  177

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  178  HERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYD  210



>ref|XP_005692154.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Capra hircus]
Length=414

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  20   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSSVRKAEAQIAAKNLDKE  79

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G +NEV++  R  TVQ +SGTG+LR+ A  ++R+F  S+ V
Sbjct  80   YLPIGGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGANFLQRFFKFSRDV  139

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  140  FLPKPTWGNHTPIFRDAGMQLQSYRYYD  167



>ref|XP_004067248.1| PREDICTED: aspartate aminotransferase, mitochondrial [Oryzias 
latipes]
Length=428

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +2

Query  266  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  445
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDD  68

Query  446  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  625
            + +P+VL  V+KAE+L+  +  +KEYL I GL  F K  A+L  GAD+EV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAESLIAAKQLDKEYLAIGGLGEFTKACAQLALGADSEVLKSGRSITVQ  128

Query  626  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +SGTGSLR+    + R+  G   V +  P+WGNH  IF DA +    YRYYD
Sbjct  129  TISGTGSLRIGGNFLARFHAGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYYD  181



>ref|XP_006366212.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Solanum 
tuberosum]
Length=453

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F  I  AP DPILGV+ A+  DT  +KLNLGVGAYRTEE +P VL+VV+KAE L++  
Sbjct  51   SVFSHIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVND  110

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            R   KEYLPI GLA FNK++A+L+ GAD+  IQ+ RV TVQ LSGTGSLR+    + +++
Sbjct  111  RSRIKEYLPIVGLADFNKLSAKLILGADSPAIQENRVTTVQCLSGTGSLRVGGEFLAQHY  170

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  IF  A +    YRYYD
Sbjct  171  HQRTIYIPQPTWGNHPKIFTLAGLSVKSYRYYD  203



>ref|XP_001771002.1| predicted protein [Physcomitrella patens]
 gb|EDQ64157.1| predicted protein [Physcomitrella patens]
Length=409

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN-LMLQ  502
            S FE +  AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE  L+  
Sbjct  4    SVFEHVQQAPEDPILGVTVAYNKDPSPLKVNLGVGAYRTEEGKPLVLNVVRRAEQQLVAD  63

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            R  NKEY PI G++ FNK++A+L+ GA++  I + RVATVQ LSGTG+LR+ A  I R++
Sbjct  64   RSRNKEYQPITGISQFNKLSAKLILGANSPAIAENRVATVQALSGTGALRVGAEFISRHY  123

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + + +PTWGNH  IF    VP   YRYYD
Sbjct  124  AKPIIFLPNPTWGNHNKIFPLGGVPQKPYRYYD  156



>gb|KFQ42654.1| hypothetical protein N333_09691, partial [Nestor notabilis]
Length=401

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCVRKAEAMIASK  61

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIVGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  P+WGNH  IF DA +    YRYY+
Sbjct  122  SSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYE  154



>ref|XP_003282681.2| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Nomascus leucogenys]
Length=309

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  1    SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAK  60

Query  506  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  685
              +KEYLPI GLA F K +AEL  G ++EV++  R  TVQ +SGTG+LR+ A+ ++R+F 
Sbjct  61   NLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFK  120

Query  686  GSK-VLISSPTWGNHKNIFNDARVPWSEYRYYD  781
             S+ V +  PTWGNH  IF DA +    YRYYD
Sbjct  121  FSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYD  153



>gb|KDO79734.1| hypothetical protein CISIN_1g0188201mg, partial [Citrus sinensis]
Length=309

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  311  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  490
            A  N S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE 
Sbjct  42   ANQNDSVFSHVVRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQ  101

Query  491  -LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  667
             L+  R   KEYLPI GLA FNK++A+L+ GAD+  I++ RV TVQ LSGTGSLR+ A  
Sbjct  102  QLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEF  161

Query  668  IERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            + R++    + I  PTWGNH  +F  A +    YRYYD
Sbjct  162  LARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYD  199



>ref|XP_009088934.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X1 [Serinus canaria]
Length=423

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KE
Sbjct  29   VEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKE  88

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V
Sbjct  89   YLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDV  148

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  P+WGNH  IF DA +    YRYYD
Sbjct  149  YLPKPSWGNHTPIFRDAGMQLQAYRYYD  176



>ref|XP_006644742.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Oryza 
brachyantha]
Length=458

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F G++ AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV+ AE +++  
Sbjct  56   SVFAGLTQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRHAEQMLINN  115

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  116  PSRVKEYLPITGLAEFNKLSAKLIFGADSPAIQESRVATVQCLSGTGSLRVGGEFLARHY  175

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  176  HERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYD  208



>ref|XP_009126373.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Brassica rapa]
Length=405

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F  +  AP DPILGV+ A+  D    KLNLGVGAYRTEE +P VLDVV+KAE  ++  
Sbjct  3    SVFSNVVRAPEDPILGVTVAYNNDPSPAKLNLGVGAYRTEEGKPLVLDVVRKAEQQLVND  62

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEY+PI GLA FNK++A+L+ GAD+  IQ+ RVAT+Q LSGTGSLR+ A  +++++
Sbjct  63   PSRVKEYIPIAGLADFNKLSAKLILGADSPAIQESRVATIQCLSGTGSLRVGAEFLKKHY  122

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
              S + I  PTWGNH  +FN A +    YRYYD
Sbjct  123  HQSVIFIPKPTWGNHPKVFNLAGLSVEYYRYYD  155



>gb|KDP34208.1| hypothetical protein JCGZ_07779 [Jatropha curcas]
Length=454

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN-LMLQ  502
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE  L+  
Sbjct  52   SVFSHVDRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQQLVND  111

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            R   KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  112  RSRVKEYLPITGLADFNKLSAKLIFGADSNAIQENRVTTVQCLSGTGSLRVGAEFLARHY  171

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  172  HQRIIYIPQPTWGNHPKVFTLAGLSVKTYRYYD  204



>ref|XP_009967572.1| PREDICTED: aspartate aminotransferase, mitochondrial [Tyto alba]
Length=393

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +P+VL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPFVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_009485645.1| PREDICTED: aspartate aminotransferase, mitochondrial [Pelecanus 
crispus]
Length=393

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAVIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S  V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSHDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>ref|XP_006450637.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63877.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=350

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +2

Query  311  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  490
            A  N S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE 
Sbjct  42   ANQNDSVFSHVVRAPEDPILGVTVAYNKDPSPLKLNLGVGAYRTEEGKPLVLNVVRKAEQ  101

Query  491  -LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  667
             L+  R   KEYLPI GLA FNK++A+L+ GAD+  I++ RV TVQ LSGTGSLR+ A  
Sbjct  102  QLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEF  161

Query  668  IERYFPGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
            + R++    + I  PTWGNH  +F  A +    YRYYD
Sbjct  162  LARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYD  199



>ref|XP_010394985.1| PREDICTED: aspartate aminotransferase, mitochondrial [Corvus 
cornix cornix]
Length=393

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLQAYRYYD  146



>ref|XP_009289063.1| PREDICTED: aspartate aminotransferase, mitochondrial [Aptenodytes 
forsteri]
Length=393

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S  V +
Sbjct  61   PIGGLADFTQASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSHDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGLQLQAYRYYD  146



>gb|KDP33689.1| hypothetical protein JCGZ_07260 [Jatropha curcas]
Length=407

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  502
            S F  I  AP DPILGV+ A+  DT   KLNLGVGAYRTEE +P VL+VV+KAE +++  
Sbjct  5    SVFSNIVRAPEDPILGVTVAYNKDTSPNKLNLGVGAYRTEEGKPLVLNVVRKAEQILVND  64

Query  503  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
            +   KEYLPI GLA FNK++A+L+ GAD+  IQ+ R+ TVQGLSGTGSLR+    + R++
Sbjct  65   QSRVKEYLPIVGLADFNKLSAKLILGADSPAIQENRITTVQGLSGTGSLRVGGEFLARHY  124

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I  PTWGNH  +F  A +    YRYYD
Sbjct  125  HQLTIYIPQPTWGNHTKVFTLAGLSVKTYRYYD  157



>ref|XP_002324997.1| aspartate aminotransferase family protein [Populus trichocarpa]
 gb|ABK95824.1| unknown [Populus trichocarpa]
 gb|EEF03562.1| aspartate aminotransferase family protein [Populus trichocarpa]
Length=407

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +2

Query  326  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  505
            S F  I  AP DPILGV+ A+  D+   KLNLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  5    SVFANIVRAPEDPILGVTVAYNKDSSPHKLNLGVGAYRTEEGKPLVLNVVRRAEQMLVND  64

Query  506  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  682
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  65   SSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQCLSGTGSLRVGAEFLARHY  124

Query  683  PGSKVLISSPTWGNHKNIFNDARVPWSEYRYYD  781
                + I +PTWGNH  IF  A +    YRYYD
Sbjct  125  HQLVIYIPNPTWGNHTKIFGLAGLSVKAYRYYD  157



>ref|XP_004265006.1| PREDICTED: aspartate aminotransferase, mitochondrial [Orcinus 
orca]
Length=430

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +2

Query  341  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  520
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  R  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAARNLDKE  95

Query  521  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  697
            YLPI GLA F K +AEL  G  NEV++  R  TVQ +SGTG+LR+ A  ++R+F  S+ V
Sbjct  96   YLPIGGLAEFCKASAELALGESNEVLKSGRYITVQTISGTGALRIGANFLQRFFKFSRDV  155

Query  698  LISSPTWGNHKNIFNDARVPWSEYRYYD  781
             +  PTWGNH  IF DA +    YRYYD
Sbjct  156  FLPKPTWGNHTPIFRDAGMQLHSYRYYD  183



>ref|XP_008636972.1| PREDICTED: aspartate aminotransferase, mitochondrial [Corvus 
brachyrhynchos]
Length=393

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  347  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  526
            M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  527  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  703
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  704  SSPTWGNHKNIFNDARVPWSEYRYYD  781
              P+WGNH  IF DA +    YRYYD
Sbjct  121  PKPSWGNHTPIFRDAGMQLQAYRYYD  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150