BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043L18

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGB85109.1|  ADP-glucose pyrophosphorylase large subunit 1           311   1e-99   Ipomoea batatas [batate]
dbj|BAF47746.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1A    311   2e-99   Ipomoea batatas [batate]
gb|AFL55396.1|  ADP-glucose pyrophosphorylase large subunit 1           307   7e-98   Ipomoea batatas [batate]
gb|AAC21562.1|  ADP-glucose pyrophosphorylase large subunit             304   8e-97   Ipomoea batatas [batate]
gb|AGB85110.1|  ADP-glucose pyrophosphorylase large subunit 2           266   4e-82   Ipomoea batatas [batate]
dbj|BAF47747.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1B    264   3e-81   Ipomoea batatas [batate]
gb|AFL55397.1|  ADP-glucose pyrophosphorylase large subunit 2           261   2e-80   Ipomoea batatas [batate]
emb|CAB55495.1|  ADP-glucose pyrophosphorylase                          256   1e-78   Ipomoea batatas [batate]
emb|CDO97030.1|  unnamed protein product                                246   2e-74   Coffea canephora [robusta coffee]
ref|XP_011088418.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    245   4e-74   
ref|XP_006365120.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    239   7e-72   Solanum tuberosum [potatoes]
gb|ABC26921.1|  ADPglucose pyrophosphorylase large subunit              239   1e-71   Solanum lycopersicum
ref|XP_011015433.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    238   5e-71   Populus euphratica
ref|XP_011048155.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    237   8e-71   Populus euphratica
ref|XP_002283855.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   3e-70   Vitis vinifera
ref|XP_002313036.1|  ADP-glucose pyrophosphorylase large subunit ...    235   3e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010690849.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    234   7e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009621409.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    234   8e-70   Nicotiana tomentosiformis
ref|NP_001233918.1|  ADP-glucose pyrophosphorylase large subunit        234   8e-70   
ref|XP_009763056.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    233   4e-69   Nicotiana sylvestris
gb|AAC49941.1|  ADP-glucose pyrophosphorylase large subunit 1           232   8e-69   Solanum lycopersicum
ref|XP_011037496.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    230   3e-68   Populus euphratica
gb|AAF66436.1|AF249917_1  ADP-glucose pyrophosphorylase large sub...    230   4e-68   Perilla frutescens [beefsteak-mint]
gb|EYU37810.1|  hypothetical protein MIMGU_mgv1a004455mg                226   1e-66   Erythranthe guttata [common monkey flower]
gb|KCW55369.1|  hypothetical protein EUGRSUZ_I01281                     224   1e-66   Eucalyptus grandis [rose gum]
gb|ABC26923.1|  ADPglucose pyrophosphorylase large subunit              225   2e-66   Solanum habrochaites
ref|XP_010028607.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    224   5e-66   Eucalyptus grandis [rose gum]
emb|CBI37674.3|  unnamed protein product                                222   2e-65   Vitis vinifera
gb|AAD56405.1|AF184345_1  ADP-glucose pyrophosphorylase large sub...    221   6e-65   Solanum habrochaites
ref|XP_002306116.2|  ADP-glucose pyrophosphorylase large subunit ...    220   2e-64   
gb|KDP41770.1|  hypothetical protein JCGZ_26788                         219   4e-64   Jatropha curcas
gb|AGS94412.1|  ADP-glucose pyrophosphorylase large subunit 4           219   5e-64   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006423322.1|  hypothetical protein CICLE_v10028195mg             218   1e-63   Citrus clementina [clementine]
ref|NP_001275823.1|  glucose-1-phosphate adenylyltransferase larg...    217   3e-63   Citrus sinensis [apfelsine]
ref|XP_008236919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    216   5e-63   Prunus mume [ume]
ref|XP_007201161.1|  hypothetical protein PRUPE_ppa004192mg             216   8e-63   Prunus persica
gb|AHM92232.1|  AGPase large subunit protein                            213   8e-62   Hevea brasiliensis [jebe]
gb|EPS74142.1|  glucose-1-phosphate adenylyltransferase                 209   5e-60   Genlisea aurea
ref|XP_003541029.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    208   6e-60   Glycine max [soybeans]
ref|XP_006577921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   2e-59   Glycine max [soybeans]
ref|XP_003527197.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    207   2e-59   Glycine max [soybeans]
ref|XP_009342671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   3e-59   
ref|XP_003522921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   3e-59   Glycine max [soybeans]
ref|XP_010088945.1|  Glucose-1-phosphate adenylyltransferase larg...    206   4e-59   Morus notabilis
ref|XP_008460955.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   4e-59   
ref|XP_002512925.1|  glucose-1-phosphate adenylyltransferase, put...    206   4e-59   Ricinus communis
ref|XP_010531437.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_009345668.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   6e-59   Pyrus x bretschneideri [bai li]
gb|AAB91467.1|  ADP-glucose pyrophosphorylase large subunit 1           205   8e-59   Citrullus lanatus subsp. vulgaris
ref|XP_008377281.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   3e-58   Malus domestica [apple tree]
gb|KEH30449.1|  glucose-1-phosphate adenylyltransferase family pr...    202   3e-58   Medicago truncatula
ref|XP_008385901.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   3e-58   
ref|NP_001289786.1|  glucose-1-phosphate adenylyltransferase larg...    203   5e-58   Nelumbo nucifera [Indian lotus]
ref|XP_003606943.1|  Glucose-1-phosphate adenylyltransferase            203   7e-58   Medicago truncatula
ref|XP_004507462.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    203   7e-58   Cicer arietinum [garbanzo]
ref|XP_007131817.1|  hypothetical protein PHAVU_011G044000g             202   1e-57   Phaseolus vulgaris [French bean]
ref|XP_003537869.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    202   2e-57   Glycine max [soybeans]
ref|XP_009342669.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_009345666.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   4e-57   
gb|AAD56042.1|AF184598_1  ADP-glucose pyrophosphorylase large sub...    200   8e-57   Citrus unshiu [satsuma mandarin]
ref|XP_010254773.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    200   9e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009378638.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    200   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_008377280.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    199   1e-56   Malus domestica [apple tree]
sp|Q00081.1|GLGL1_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    198   2e-56   Solanum tuberosum [potatoes]
ref|XP_008385898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    199   2e-56   
ref|XP_007042146.1|  Glucose-1-phosphate adenylyltransferase fami...    199   3e-56   
gb|KDO84616.1|  hypothetical protein CISIN_1g015713mg                   194   5e-56   Citrus sinensis [apfelsine]
ref|XP_004148834.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    197   7e-56   
gb|KDO84615.1|  hypothetical protein CISIN_1g015713mg                   194   2e-55   Citrus sinensis [apfelsine]
ref|XP_006282507.1|  hypothetical protein CARUB_v10007053mg             196   2e-55   Capsella rubella
ref|XP_004500804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    196   2e-55   Cicer arietinum [garbanzo]
ref|NP_001284451.1|  myeloid leukemia factor 1                          196   4e-55   Cucumis melo [Oriental melon]
ref|XP_009378639.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    195   5e-55   
emb|CAB52196.1|  ADP-glucose pyrophosphorylase                          194   6e-55   Ipomoea batatas [batate]
ref|XP_009378637.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    195   6e-55   Pyrus x bretschneideri [bai li]
gb|KHF99865.1|  Glucose-1-phosphate adenylyltransferase large sub...    195   8e-55   Gossypium arboreum [tree cotton]
ref|XP_010437034.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    193   3e-54   Camelina sativa [gold-of-pleasure]
ref|NP_195632.1|  glucose-1-phosphate adenylyltransferase large s...    193   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263606.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    193   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006411722.1|  hypothetical protein EUTSA_v10024927mg             193   3e-54   
ref|XP_002866835.1|  hypothetical protein ARALYDRAFT_490693             193   3e-54   
ref|XP_010431888.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    193   4e-54   Camelina sativa [gold-of-pleasure]
gb|KJB79161.1|  hypothetical protein B456_013G035800                    193   4e-54   Gossypium raimondii
emb|CAA65541.1|  ADP-glucose pyrophosphorylase                          192   4e-54   Pisum sativum [garden pea]
ref|XP_007136159.1|  hypothetical protein PHAVU_009G023100g             192   5e-54   Phaseolus vulgaris [French bean]
dbj|BAC66692.1|  ADP-glucose pyrophosphorylase large subunit PvAGPL1    192   5e-54   Phaseolus vulgaris [French bean]
ref|XP_010431887.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    192   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006435035.1|  hypothetical protein CICLE_v10000842mg             192   7e-54   Citrus clementina [clementine]
ref|XP_010446453.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    190   4e-53   Camelina sativa [gold-of-pleasure]
emb|CDY56761.1|  BnaA06g40730D                                          191   6e-53   Brassica napus [oilseed rape]
ref|XP_006473534.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    189   1e-52   Citrus sinensis [apfelsine]
gb|AFO84073.1|  ADP glucose pyrophosphorylase                           188   2e-52   Actinidia deliciosa [Chinese gooseberry]
emb|CDX72711.1|  BnaC07g47330D                                          190   2e-52   
gb|AES74194.2|  glucose-1-phosphate adenylyltransferase family pr...    187   4e-52   Medicago truncatula
ref|XP_003603943.1|  Glucose-1-phosphate adenylyltransferase larg...    187   4e-52   
ref|XP_006386208.1|  hypothetical protein POPTR_0002s03480g             181   1e-51   
ref|XP_010437035.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    186   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009617843.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    186   2e-51   Nicotiana tomentosiformis
ref|XP_008220833.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    183   4e-51   Prunus mume [ume]
gb|KHG23571.1|  Glucose-1-phosphate adenylyltransferase large sub...    184   6e-51   Gossypium arboreum [tree cotton]
ref|XP_007222521.1|  hypothetical protein PRUPE_ppa004135mg             184   8e-51   Prunus persica
ref|XP_007017591.1|  Glucose-1-phosphate adenylyltransferase larg...    181   9e-51   
ref|XP_009416548.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    184   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAS00542.1|  ADP-glucose pyrophosphorylase large subunit             183   1e-50   Fragaria x ananassa
ref|XP_009101891.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    184   1e-50   Brassica rapa
ref|XP_009101892.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    183   1e-50   Brassica rapa
emb|CDP07489.1|  unnamed protein product                                183   2e-50   Coffea canephora [robusta coffee]
ref|XP_009759775.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    183   2e-50   Nicotiana sylvestris
ref|XP_008220832.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    183   2e-50   Prunus mume [ume]
gb|KJB58232.1|  hypothetical protein B456_009G200400                    183   2e-50   Gossypium raimondii
ref|XP_004289659.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-1-ph...    182   4e-50   Fragaria vesca subsp. vesca
gb|KJB32479.1|  hypothetical protein B456_005G244900                    182   4e-50   Gossypium raimondii
gb|KJB32482.1|  hypothetical protein B456_005G244900                    182   4e-50   Gossypium raimondii
ref|XP_010060971.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    182   5e-50   Eucalyptus grandis [rose gum]
ref|XP_007017590.1|  ADPGLC-PPase large subunit isoform 1               181   1e-49   
ref|XP_002300758.1|  ADP-glucose pyrophosphorylase large subunit ...    181   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011028874.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    181   1e-49   Populus euphratica
ref|XP_011007451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    180   2e-49   Populus euphratica
ref|XP_011007450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    180   3e-49   Populus euphratica
ref|XP_008388042.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    179   5e-49   
ref|XP_004291856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    179   6e-49   Fragaria vesca subsp. vesca
ref|XP_009336061.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    179   6e-49   Pyrus x bretschneideri [bai li]
gb|ACW82825.1|  ADP-glucose pyrophosphorylase large subunit L1 is...    179   6e-49   Lens culinaris
ref|XP_009365102.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    179   7e-49   Pyrus x bretschneideri [bai li]
gb|KDP38538.1|  hypothetical protein JCGZ_04463                         179   7e-49   Jatropha curcas
ref|XP_009365525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    178   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_011074558.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    177   2e-48   Sesamum indicum [beniseed]
ref|XP_002307668.2|  hypothetical protein POPTR_0005s25130g             177   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_002510419.1|  glucose-1-phosphate adenylyltransferase, put...    177   4e-48   Ricinus communis
ref|XP_010110050.1|  Glucose-1-phosphate adenylyltransferase larg...    174   4e-47   Morus notabilis
ref|XP_006878500.1|  hypothetical protein AMTR_s00011p00201790          174   5e-47   
ref|XP_004147856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    174   5e-47   Cucumis sativus [cucumbers]
ref|XP_004154849.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-1-ph...    174   6e-47   
ref|XP_006577992.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    172   1e-46   Glycine max [soybeans]
ref|XP_010472156.1|  PREDICTED: probable glucose-1-phosphate aden...    172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008466540.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    172   1e-46   
ref|XP_010472157.1|  PREDICTED: probable glucose-1-phosphate aden...    172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_003523570.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    172   2e-46   Glycine max [soybeans]
ref|XP_002281223.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    172   3e-46   Vitis vinifera
ref|XP_010429080.1|  PREDICTED: probable glucose-1-phosphate aden...    172   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002878559.1|  predicted protein                                  172   3e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_006294016.1|  hypothetical protein CARUB_v10023004mg             171   5e-46   Capsella rubella
gb|AAB91468.1|  ADP-glucose pyrophosphorylase large subunit 2           170   7e-46   Citrullus lanatus subsp. vulgaris
ref|XP_011083898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    170   7e-46   Sesamum indicum [beniseed]
gb|KDO42002.1|  hypothetical protein CISIN_1g0097201mg                  169   8e-46   Citrus sinensis [apfelsine]
gb|KDO42000.1|  hypothetical protein CISIN_1g0097201mg                  169   9e-46   Citrus sinensis [apfelsine]
ref|XP_009406290.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    171   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406289.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    171   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO41998.1|  hypothetical protein CISIN_1g0097201mg                  169   1e-45   Citrus sinensis [apfelsine]
gb|KDO41999.1|  hypothetical protein CISIN_1g0097201mg                  169   1e-45   Citrus sinensis [apfelsine]
ref|XP_006404613.1|  hypothetical protein EUTSA_v10000141mg             169   2e-45   
ref|XP_006581201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    169   3e-45   Glycine max [soybeans]
ref|XP_003528021.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    169   4e-45   Glycine max [soybeans]
ref|XP_007136616.1|  hypothetical protein PHAVU_009G059800g             169   4e-45   Phaseolus vulgaris [French bean]
ref|XP_010924297.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    168   4e-45   Elaeis guineensis
ref|XP_010416915.1|  PREDICTED: probable glucose-1-phosphate aden...    168   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010416916.1|  PREDICTED: probable glucose-1-phosphate aden...    168   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008800702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    167   7e-45   
gb|AJG44463.1|  ADP-glucose pyrophosphorylase large subunit             167   1e-44   Lilium davidii var. unicolor
emb|CDX99581.1|  BnaC04g33380D                                          167   2e-44   
ref|XP_008800701.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    167   2e-44   Phoenix dactylifera
ref|XP_009140291.1|  PREDICTED: probable glucose-1-phosphate aden...    166   2e-44   Brassica rapa
ref|XP_010673183.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    166   2e-44   
ref|NP_001289992.1|  glucose-1-phosphate adenylyltransferase larg...    166   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_179753.1|  glucose-1-phosphate adenylyltransferase large s...    165   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926128.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    164   1e-43   
emb|CDY15884.1|  BnaA04g12270D                                          164   2e-43   Brassica napus [oilseed rape]
gb|AEV40474.1|  ADP-glucose pyrophosphorylase 3                         163   4e-43   Spirodela polyrhiza
gb|EYU45186.1|  hypothetical protein MIMGU_mgv1a004400mg                163   4e-43   Erythranthe guttata [common monkey flower]
gb|AEH27531.1|  putative ADP-glucose pyrophosphorylase                  163   5e-43   Amorphophallus konjac [devil's-tongue]
gb|AJG44462.1|  ADP-glucose pyrophosphorylase large subunit             162   1e-42   Lilium davidii var. unicolor
ref|XP_009394804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    161   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006346702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    160   3e-42   
gb|AFK36497.1|  unknown                                                 160   5e-42   Lotus japonicus
ref|XP_003549440.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    160   5e-42   Glycine max [soybeans]
gb|KHN12692.1|  Glucose-1-phosphate adenylyltransferase large sub...    160   6e-42   Glycine soja [wild soybean]
sp|P55242.1|GLGL2_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    159   1e-41   Solanum tuberosum [potatoes]
gb|KJB63622.1|  hypothetical protein B456_010G008700                    157   2e-41   Gossypium raimondii
gb|AIO11223.1|  AGPL1 protein                                           158   2e-41   Gladiolus hybrid cultivar
gb|KJB63623.1|  hypothetical protein B456_010G008700                    157   3e-41   Gossypium raimondii
gb|KJB63621.1|  hypothetical protein B456_010G008700                    157   4e-41   Gossypium raimondii
gb|AAC49942.1|  ADP-glucose pyrophosphorylase large subunit             157   5e-41   Solanum lycopersicum
emb|CDX84911.1|  BnaC05g21440D                                          157   7e-41   
gb|AGT16332.1|  glucose-1-phosphate adenylyltransferase                 153   8e-41   Saccharum hybrid cultivar R570
ref|XP_006415741.1|  hypothetical protein EUTSA_v10007379mg             156   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_009113743.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    155   2e-40   Brassica rapa
ref|XP_009113739.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    155   2e-40   Brassica rapa
gb|AGB85111.1|  ADP-glucose pyrophosphorylase large subunit 3           155   3e-40   Ipomoea batatas [batate]
gb|KFK36157.1|  hypothetical protein AALP_AA4G085400                    155   4e-40   Arabis alpina [alpine rockcress]
ref|XP_010478112.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    155   4e-40   Camelina sativa [gold-of-pleasure]
dbj|BAF47748.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb2     154   5e-40   Ipomoea batatas [batate]
gb|AFL55398.1|  ADP-glucose pyrophosphorylase large subunit 3           154   6e-40   Ipomoea batatas [batate]
ref|XP_010323163.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    154   1e-39   Solanum lycopersicum
ref|XP_010323162.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    154   1e-39   Solanum lycopersicum
gb|AGT17354.1|  ADP-glucose pyrophosphorylase                           153   2e-39   Saccharum hybrid cultivar R570
ref|NP_174089.1|  glucose-1-phosphate adenylyltransferase large s...    153   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961109.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    153   2e-39   Setaria italica
ref|XP_010460525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    153   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002440313.1|  hypothetical protein SORBIDRAFT_09g029610          153   2e-39   Sorghum bicolor [broomcorn]
gb|AGT17180.1|  glucose-1-phosphate adenylyltransferase                 152   2e-39   Saccharum hybrid cultivar R570
ref|XP_010478113.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    152   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008648319.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    152   3e-39   
gb|AFW79323.1|  ADP-glucose pyrophosphorylase large subunit             152   3e-39   
ref|XP_006303972.1|  hypothetical protein CARUB_v10008862mg             152   4e-39   Capsella rubella
ref|NP_001056424.2|  Os05g0580000                                       152   4e-39   
ref|NP_001266081.1|  glucose-1-phosphate adenylyltransferase larg...    152   4e-39   Cicer arietinum [garbanzo]
dbj|BAA23490.1|  ADP glucose pyrophosphorylase large subunit            152   5e-39   Oryza sativa Japonica Group [Japonica rice]
gb|AAD39597.1|AC007858_11  10A19I.12                                    152   6e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    151   6e-39   Oryza brachyantha
ref|XP_011039886.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    152   6e-39   Populus euphratica
ref|XP_002320247.2|  hypothetical protein POPTR_0014s10560g             152   6e-39   Populus trichocarpa [western balsam poplar]
ref|NP_001233947.1|  ADP-glucose pyrophosphorylase large subunit        151   7e-39   
ref|NP_001105717.1|  glucose-1-phosphate adenylyltransferase larg...    151   7e-39   
ref|XP_006491439.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    151   9e-39   
gb|KDO86722.1|  hypothetical protein CISIN_1g043870mg                   151   9e-39   Citrus sinensis [apfelsine]
ref|XP_006444661.1|  hypothetical protein CICLE_v10023395mg             151   9e-39   
ref|XP_010499251.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    150   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003567817.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    150   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_002890743.1|  hypothetical protein ARALYDRAFT_472972             150   2e-38   
ref|XP_006841529.1|  hypothetical protein AMTR_s00003p00152830          150   2e-38   
ref|XP_010540326.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    150   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_003545270.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    150   2e-38   Glycine max [soybeans]
ref|XP_007051343.1|  ADPGLC-PPase large subunit                         150   3e-38   
ref|XP_007160732.1|  hypothetical protein PHAVU_001G012500g             149   3e-38   Phaseolus vulgaris [French bean]
gb|AFK46347.1|  unknown                                                 142   4e-38   Medicago truncatula
gb|ABF69950.1|  ADP-glucose pyrophosphorylase (glucose-1-phosphat...    148   4e-38   Musa acuminata [banana]
gb|KHN20962.1|  Glucose-1-phosphate adenylyltransferase large sub...    149   5e-38   Glycine soja [wild soybean]
gb|KDP28372.1|  hypothetical protein JCGZ_14143                         148   6e-38   Jatropha curcas
ref|XP_010652349.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    148   9e-38   Vitis vinifera
ref|XP_002994500.1|  hypothetical protein SELMODRAFT_138695             147   1e-37   
ref|XP_002274245.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    148   1e-37   
ref|XP_007163265.1|  hypothetical protein PHAVU_001G219900g             148   1e-37   Phaseolus vulgaris [French bean]
ref|XP_003553688.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    148   1e-37   Glycine max [soybeans]
gb|KHN43393.1|  Glucose-1-phosphate adenylyltransferase large sub...    148   1e-37   Glycine soja [wild soybean]
emb|CAN67125.1|  hypothetical protein VITISV_040166                     147   1e-37   Vitis vinifera
ref|XP_008799957.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    147   2e-37   
ref|XP_009396671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    147   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD98749.1|  ADP-glucose pyrophosphorylase large subunit            147   2e-37   Triticum aestivum [Canadian hard winter wheat]
emb|CBI37074.3|  unnamed protein product                                147   2e-37   Vitis vinifera
ref|XP_006644406.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    147   2e-37   Oryza brachyantha
sp|P12299.2|GLGL2_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    147   2e-37   Triticum aestivum [Canadian hard winter wheat]
gb|EMT32758.1|  hypothetical protein F775_52189                         147   3e-37   
sp|P30524.2|GLGL1_HORVU  RecName: Full=Glucose-1-phosphate adenyl...    147   3e-37   Hordeum vulgare [barley]
gb|AHA11391.1|  cytosolic ADP-glucose pyrophosphorylase large sub...    146   4e-37   Hordeum vulgare [barley]
gb|EMS53815.1|  Glucose-1-phosphate adenylyltransferase large sub...    145   7e-37   Triticum urartu
gb|KEH36175.1|  glucose-1-phosphate adenylyltransferase family pr...    145   8e-37   Medicago truncatula
ref|XP_002515141.1|  glucose-1-phosphate adenylyltransferase, put...    145   1e-36   Ricinus communis
gb|AHG12640.1|  ADP-glucose pyrophosphorylase large subunit             145   1e-36   Nicotiana tabacum [American tobacco]
ref|XP_010914842.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    144   1e-36   
ref|XP_009760082.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    145   1e-36   Nicotiana sylvestris
ref|XP_002970384.1|  hypothetical protein SELMODRAFT_231637             144   2e-36   
ref|XP_006850725.1|  hypothetical protein AMTR_s00025p00041760          141   2e-36   
ref|XP_010914841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    144   2e-36   Elaeis guineensis
ref|NP_001233977.1|  ADP-glucose pyrophosphorylase large subunit        144   2e-36   
ref|XP_004494490.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    144   2e-36   
gb|KHG05254.1|  Glucose-1-phosphate adenylyltransferase large sub...    144   3e-36   Gossypium arboreum [tree cotton]
gb|KDP40133.1|  hypothetical protein JCGZ_02131                         144   3e-36   Jatropha curcas
ref|XP_002968152.1|  hypothetical protein SELMODRAFT_169778             143   3e-36   
gb|KHN14186.1|  Glucose-1-phosphate adenylyltransferase large sub...    144   4e-36   Glycine soja [wild soybean]
ref|XP_003520778.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    144   4e-36   Glycine max [soybeans]
gb|KJB38095.1|  hypothetical protein B456_006G236600                    143   4e-36   Gossypium raimondii
gb|KJB38096.1|  hypothetical protein B456_006G236600                    143   4e-36   Gossypium raimondii
ref|XP_011090768.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    143   5e-36   Sesamum indicum [beniseed]
gb|KJB09550.1|  hypothetical protein B456_001G149300                    143   5e-36   Gossypium raimondii
gb|KJB38094.1|  hypothetical protein B456_006G236600                    143   5e-36   Gossypium raimondii
gb|KCW45857.1|  hypothetical protein EUGRSUZ_L00275                     141   6e-36   Eucalyptus grandis [rose gum]
sp|P12300.1|GLGL3_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    143   6e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009603253.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    143   6e-36   Nicotiana tomentosiformis
gb|ABK97513.1|  putative ADP-glucose pyrophosphorylase large subunit    142   7e-36   Sorghum bicolor [broomcorn]
gb|AGT16790.1|  ADP-glucose pyrophosphorylase large subunit             143   8e-36   Saccharum hybrid cultivar R570
ref|XP_004296919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    142   1e-35   Fragaria vesca subsp. vesca
ref|XP_004969255.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    142   1e-35   Setaria italica
ref|NP_001275395.1|  glucose-1-phosphate adenylyltransferase larg...    142   1e-35   Solanum tuberosum [potatoes]
ref|XP_010255929.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    142   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_002456012.1|  hypothetical protein SORBIDRAFT_03g028850          142   2e-35   Sorghum bicolor [broomcorn]
gb|KCW84252.1|  hypothetical protein EUGRSUZ_B01108                     141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_007221691.1|  hypothetical protein PRUPE_ppb012900mg             137   2e-35   
gb|AFO84093.1|  ADP glucose pyrophosphorylase                           141   2e-35   Actinidia chinensis
gb|AEV40472.1|  ADP-glucose pyrophosphorylase 2                         141   2e-35   Spirodela polyrhiza
prf||1909370A  ADP glucose pyrophosphorylase:SUBUNIT=L                  141   3e-35   
ref|XP_010093993.1|  Glucose-1-phosphate adenylyltransferase larg...    141   3e-35   
ref|XP_010039909.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    141   3e-35   
gb|AES82317.2|  glucose-1-phosphate adenylyltransferase family pr...    141   3e-35   
ref|XP_008776060.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    138   4e-35   
gb|AEV40470.1|  ADP-glucose pyrophosphorylase 1                         141   4e-35   
gb|KCW45645.1|  hypothetical protein EUGRSUZ_L00600                     141   4e-35   
gb|KCW84250.1|  hypothetical protein EUGRSUZ_B01108                     141   4e-35   
ref|XP_010035400.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   4e-35   
ref|XP_003561277.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   4e-35   
ref|XP_010039908.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   4e-35   
ref|XP_002517196.1|  glucose-1-phosphate adenylyltransferase, put...    140   4e-35   
ref|XP_010420717.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   4e-35   
gb|EEE55040.1|  hypothetical protein OsJ_02724                          140   5e-35   
ref|XP_010492975.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   5e-35   
gb|ACJ71343.1|  ADP-glucose pyrophosphorylase large subunit             140   5e-35   
dbj|BAD68891.1|  glucose-1-phosphate adenylyltransferase large chain    140   5e-35   
ref|NP_001043654.1|  Os01g0633100                                       140   5e-35   
gb|ACJ71347.1|  ADP-glucose pyrophosphorylase large subunit             140   5e-35   
gb|ACJ71336.1|  ADP-glucose pyrophosphorylase large subunit             140   5e-35   
gb|ACJ71339.1|  ADP-glucose pyrophosphorylase large subunit             140   5e-35   
gb|ACJ71334.1|  ADP-glucose pyrophosphorylase large subunit             140   5e-35   
gb|AAY42161.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   5e-35   
gb|AAY42198.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   5e-35   
gb|AAY42166.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   6e-35   
gb|AAY42191.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   6e-35   
gb|ACJ71342.1|  ADP-glucose pyrophosphorylase large subunit             140   6e-35   
gb|ACJ71335.1|  ADP-glucose pyrophosphorylase large subunit             140   6e-35   
gb|AAY42172.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   6e-35   
gb|AAK27727.1|  ADP-glucose pyrophosphorylase large subunit isoform     140   6e-35   
gb|AAY42201.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   6e-35   
gb|AAY42200.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   6e-35   
gb|AAY42149.1|  ADP-glucose pyrophosphorylase endosperm large sub...    139   6e-35   
gb|ACJ71344.1|  ADP-glucose pyrophosphorylase large subunit             140   8e-35   
ref|XP_003626099.1|  Glucose-1-phosphate adenylyltransferase            140   9e-35   
gb|AGT17261.1|  ADP-glucose pyrophosphorylase                           140   9e-35   
gb|AIZ00993.1|  ADP-glucose pyrophosphorylase large subunit 1           140   9e-35   
ref|XP_010556665.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   1e-34   
ref|XP_010454187.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   1e-34   
ref|XP_009405044.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    140   1e-34   
ref|XP_003549968.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    139   1e-34   
dbj|BAF47749.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb3     139   1e-34   
ref|NP_001121104.1|  glucose-1-phosphate adenylyltransferase larg...    139   1e-34   
ref|NP_001241391.1|  uncharacterized protein LOC100810451               139   1e-34   
ref|XP_009338465.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    139   1e-34   
gb|AFP90368.1|  endosperm glucose-1-phosphate adenylyltransferase...    139   1e-34   
gb|AFL55399.1|  ADP-glucose pyrophosphorylase large subunit 4           139   1e-34   
ref|XP_006289333.1|  hypothetical protein CARUB_v10002818mg             139   1e-34   
gb|AAB24191.2|  endosperm ADP-glucose pyrophosphorylase subunit h...    139   1e-34   
gb|AHL44840.1|  glucose-1-phosphate adenylyltransferase large sub...    139   2e-34   
emb|CBI26204.3|  unnamed protein product                                139   2e-34   
ref|XP_008340932.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    139   2e-34   
ref|NP_001106058.1|  putative glucose-1-phosphate adenylyltransfe...    139   2e-34   
tpg|DAA60137.1|  TPA: glucose-1-phosphate adenylyltransferase           139   2e-34   
ref|XP_008673450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    139   2e-34   
ref|XP_008673451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    139   2e-34   
gb|EPS60253.1|  glucose-1-phosphate adenylyltransferase                 138   2e-34   
ref|XP_002281069.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    139   2e-34   
ref|XP_008222970.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    139   2e-34   
ref|XP_002461746.1|  hypothetical protein SORBIDRAFT_02g007320          133   2e-34   
ref|XP_002311802.1|  ADP-glucose pyrophosphorylase family protein       138   3e-34   
gb|ACJ71332.1|  ADP-glucose pyrophosphorylase large subunit             138   3e-34   
gb|ACJ71333.1|  ADP-glucose pyrophosphorylase large subunit             138   3e-34   
ref|XP_010035362.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    138   3e-34   
ref|XP_001774318.1|  predicted protein                                  137   4e-34   
ref|XP_007034659.1|  ADP glucose pyrophosphorylase large subunit ...    138   4e-34   
tpg|DAA58443.1|  TPA: shrunken2                                         139   4e-34   
ref|XP_007153923.1|  hypothetical protein PHAVU_003G076500g             138   4e-34   
gb|ACJ71341.1|  ADP-glucose pyrophosphorylase large subunit             137   5e-34   
ref|XP_007034666.1|  ADP glucose pyrophosphorylase large subunit ...    137   6e-34   
gb|ACL52683.1|  unknown                                                 137   6e-34   
ref|XP_009345065.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    137   7e-34   
emb|CDY02573.1|  BnaC02g08620D                                          137   7e-34   
gb|EMS50037.1|  Glucose-1-phosphate adenylyltransferase large sub...    137   7e-34   
ref|NP_197423.1|  glucose-1-phosphate adenylyltransferase large s...    137   8e-34   
dbj|BAA76362.1|  glucose-1-phosphate adenylyltransferase                137   8e-34   
gb|ABR17521.1|  unknown                                                 137   9e-34   
emb|CAX51356.1|  large subunit of ADP-glucose pyrophosphorylase         137   9e-34   
ref|XP_009364201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    137   1e-33   
dbj|BAJ90901.1|  predicted protein                                      137   1e-33   
gb|ABD66657.1|  plastid ADP-glucose pyrophosphorylase large subunit     136   1e-33   
gb|AAK27685.1|AF347698_1  ADP-glucose pyrophosphorylase large sub...    137   1e-33   
ref|XP_008390847.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    137   1e-33   
ref|NP_001284415.1|  myeloid leukemia factor 2                          136   1e-33   
gb|EYU41519.1|  hypothetical protein MIMGU_mgv1a004639mg                136   1e-33   
gb|KFK26166.1|  hypothetical protein AALP_AA8G211600                    136   1e-33   
gb|ADQ37987.1|  ADP-glucose pyrophosphorylase endosperm large sub...    134   1e-33   
gb|ADQ37986.1|  ADP-glucose pyrophosphorylase endosperm large sub...    134   1e-33   
ref|XP_009126310.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    136   2e-33   
gb|ADQ37988.1|  ADP-glucose pyrophosphorylase endosperm large sub...    134   2e-33   
gb|ADQ37989.1|  ADP-glucose pyrophosphorylase endosperm large sub...    134   2e-33   
ref|XP_010941806.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    136   2e-33   
emb|CDY47206.1|  BnaAnng08760D                                          136   2e-33   
gb|AGB85112.1|  ADP-glucose pyrophosphorylase large subunit 4           136   2e-33   
dbj|BAC16096.1|  putative glucose-1-phosphate adenylyltransferase...    135   2e-33   
ref|NP_001059276.1|  Os07g0243200                                       135   2e-33   
ref|XP_011034216.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    135   2e-33   
gb|KIY95189.1|  glucose-1-phosphate adenylyltransferase                 130   3e-33   
emb|CDY68209.1|  BnaC09g54280D                                          135   3e-33   
ref|XP_004164723.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    135   4e-33   
ref|XP_004134146.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    135   4e-33   
ref|XP_002873938.1|  hypothetical protein ARALYDRAFT_488807             135   4e-33   
gb|KCW46725.1|  hypothetical protein EUGRSUZ_K00547                     134   4e-33   
ref|XP_009120906.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    135   4e-33   
ref|XP_010666779.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    135   4e-33   
ref|XP_004981866.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    134   5e-33   
ref|NP_001266131.1|  glucose-1-phosphate adenylyltransferase larg...    135   6e-33   
ref|XP_008438706.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    134   6e-33   
tpg|DAA51191.1|  TPA: hypothetical protein ZEAMMB73_768829              132   7e-33   
gb|AAC49729.1|  ADP-glucose pyrophosphorylase large subunit             134   7e-33   
ref|XP_003560093.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    134   8e-33   
gb|AES92592.2|  glucose-1-phosphate adenylyltransferase family pr...    134   9e-33   
ref|XP_006400480.1|  hypothetical protein EUTSA_v10013265mg             134   1e-32   
ref|NP_001051184.1|  Os03g0735000                                       134   1e-32   
ref|XP_003610395.1|  Glucose-1-phosphate adenylyltransferase            134   1e-32   
gb|EEC76133.1|  hypothetical protein OsI_13419                          134   1e-32   
ref|XP_004981865.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    134   1e-32   
ref|XP_004959119.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    134   1e-32   
ref|XP_006489328.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    133   2e-32   
ref|XP_002973739.1|  hypothetical protein SELMODRAFT_149205             133   2e-32   
ref|XP_002975788.1|  hypothetical protein SELMODRAFT_267891             133   2e-32   
ref|XP_010666778.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    133   2e-32   
emb|CEG00850.1|  Nucleotidyl transferase                                133   2e-32   
ref|XP_006651788.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    132   2e-32   
ref|XP_006419854.1|  hypothetical protein CICLE_v10004731mg             133   2e-32   
gb|AAS88891.1|  AGPLU2                                                  132   3e-32   
ref|XP_001751725.1|  predicted protein                                  132   3e-32   
gb|AAM95945.1|  ADP-glucose pyrophosphorylase large subunit             132   3e-32   
ref|XP_001422382.1|  predicted protein                                  132   3e-32   
ref|XP_010551763.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    132   4e-32   
tpg|DAA51194.1|  TPA: hypothetical protein ZEAMMB73_768829              131   4e-32   
ref|XP_003084430.1|  AGPLU2 (ISS)                                       132   4e-32   
gb|KDO74744.1|  hypothetical protein CISIN_1g013483mg                   131   5e-32   
ref|XP_001784075.1|  predicted protein                                  131   6e-32   
gb|KDO74743.1|  hypothetical protein CISIN_1g013483mg                   131   6e-32   
gb|KDO74742.1|  hypothetical protein CISIN_1g013483mg                   131   6e-32   
gb|KDO74745.1|  hypothetical protein CISIN_1g013483mg                   130   8e-32   
ref|NP_001106017.1|  plastid ADP-glucose pyrophosphorylase large ...    131   8e-32   
gb|ABS19875.1|  putative glucose-1-phosphate adenylyltransferase ...    131   9e-32   
ref|XP_001782975.1|  predicted protein                                  131   1e-31   
ref|XP_007511445.1|  predicted protein                                  131   1e-31   
gb|EPS66248.1|  hypothetical protein M569_08527                         130   1e-31   
gb|AGT16263.1|  plastid ADP-glucose pyrophosphorylase                   130   2e-31   
gb|AGT16453.1|  glucose-1-phosphate adenylyltransferase                 130   2e-31   
gb|AGT17074.1|  glucose-1-phosphate adenylyltransferase                 130   2e-31   
ref|XP_008458581.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    130   3e-31   
ref|XP_003056043.1|  adp-glucose pyrophosphorylase                      129   3e-31   
ref|XP_002507549.1|  adp-glucose pyrophosphorylase                      129   5e-31   
ref|XP_004149284.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    129   5e-31   
ref|XP_002463921.1|  hypothetical protein SORBIDRAFT_01g008940          128   9e-31   
ref|XP_001778378.1|  predicted protein                                  125   8e-30   
ref|XP_002951950.1|  hypothetical protein VOLCADRAFT_75183              125   1e-29   
ref|XP_001784242.1|  predicted protein                                  124   2e-29   
ref|XP_011401140.1|  Glucose-1-phosphate adenylyltransferase larg...    124   3e-29   
ref|XP_001759196.1|  predicted protein                                  123   6e-29   
ref|XP_005842916.1|  hypothetical protein CHLNCDRAFT_37654              122   1e-28   
gb|AAB38781.1|  ADP-glucose pyrophosphorylase large subunit             122   1e-28   
gb|AIA58073.1|  ADP glucose pyrophosphorylase                           114   2e-28   
ref|XP_001767907.1|  predicted protein                                  121   3e-28   
gb|AIA58020.1|  ADP glucose pyrophosphorylase                           114   3e-28   
gb|AIA58085.1|  ADP glucose pyrophosphorylase                           113   3e-28   
ref|WP_011243233.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    120   3e-28   
gb|AIA58026.1|  ADP glucose pyrophosphorylase                           112   4e-28   
gb|AIA58025.1|  ADP glucose pyrophosphorylase                           112   4e-28   
ref|WP_029983784.1|  glucose-1-phosphate adenylyltransferase            113   7e-28   
ref|WP_029979085.1|  glucose-1-phosphate adenylyltransferase            112   7e-28   
ref|WP_014066531.1|  glucose-1-phosphate adenylyltransferase            119   8e-28   
gb|ABK97515.1|  putative ADP-glucose pyrophosphorylase large subunit    119   8e-28   
gb|KHN28605.1|  Aldo-keto reductase family 4 member C9                  119   1e-27   
ref|XP_001693447.1|  ADP-glucose pyrophosphorylase large subunit        119   2e-27   
ref|WP_041041363.1|  glucose-1-phosphate adenylyltransferase            118   3e-27   
ref|WP_006171646.1|  glucose-1-phosphate adenylyltransferase            118   3e-27   
gb|AIA58084.1|  ADP glucose pyrophosphorylase                           111   3e-27   
ref|XP_005649170.1|  glucose-1-phosphate adenylyltransferase            118   3e-27   
ref|WP_011613709.1|  glucose-1-phosphate adenylyltransferase            118   3e-27   
ref|WP_012844475.1|  glucose-1-phosphate adenylyltransferase            118   3e-27   
ref|WP_011935670.1|  glucose-1-phosphate adenylyltransferase            117   3e-27   
ref|WP_015226172.1|  glucose-1-phosphate adenylyltransferase            117   3e-27   
ref|YP_002048929.1|  glucose-1-phosphate adenylyltransferase            117   4e-27   
ref|WP_011144244.1|  glucose-1-phosphate adenylyltransferase            117   4e-27   
ref|WP_011933203.1|  glucose-1-phosphate adenylyltransferase            117   4e-27   
ref|WP_015208914.1|  glucose-1-phosphate adenylyltransferase            117   5e-27   
ref|WP_006041310.1|  glucose-1-phosphate adenylyltransferase            117   5e-27   
ref|WP_010308242.1|  glucose-1-phosphate adenylyltransferase            117   5e-27   
ref|WP_026222134.1|  glucose-1-phosphate adenylyltransferase            117   5e-27   
ref|WP_015228619.1|  glucose-1-phosphate adenylyltransferase            117   5e-27   
gb|AIA58005.1|  ADP glucose pyrophosphorylase                           109   6e-27   
ref|WP_035156038.1|  glucose-1-phosphate adenylyltransferase            117   6e-27   
ref|WP_011132403.1|  glucose-1-phosphate adenylyltransferase            117   6e-27   
ref|WP_023171254.1|  glucose-1-phosphate adenylyltransferase            117   6e-27   
ref|WP_035998839.1|  glucose-1-phosphate adenylyltransferase            117   7e-27   
ref|WP_010998776.1|  glucose-1-phosphate adenylyltransferase            117   7e-27   
ref|WP_015114419.1|  glucose-1-phosphate adenylyltransferase            117   7e-27   
gb|KDO42001.1|  hypothetical protein CISIN_1g0097201mg                  117   7e-27   
gb|AFV14956.1|  glucose-1-phosphate adenylyltransferase                 117   7e-27   
ref|WP_011318814.1|  glucose-1-phosphate adenylyltransferase            117   7e-27   
ref|WP_015140081.1|  glucose-1-phosphate adenylyltransferase            117   7e-27   
ref|WP_011820128.1|  glucose-1-phosphate adenylyltransferase            117   8e-27   
ref|WP_036920778.1|  glucose-1-phosphate adenylyltransferase            116   8e-27   
ref|WP_024124420.1|  glucose-1-phosphate adenylyltransferase GlgC       116   8e-27   
ref|WP_015144769.1|  glucose-1-phosphate adenylyltransferase            116   9e-27   
ref|WP_029979459.1|  glucose-1-phosphate adenylyltransferase            110   9e-27   
ref|WP_013322137.1|  glucose-1-phosphate adenylyltransferase            116   9e-27   
ref|WP_011057127.1|  glucose-1-phosphate adenylyltransferase            116   9e-27   
gb|KIJ84186.1|  glucose-1-phosphate adenylyltransferase                 116   9e-27   
ref|WP_002793903.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_006528192.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_017318322.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_012597885.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
dbj|GAL94421.1|  glucose-1-phosphate adenylyltransferase                116   1e-26   
ref|WP_029636857.1|  glucose-1-phosphate adenylyltransferase [          116   1e-26   
ref|WP_016514814.1|  Glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_002741425.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_006194760.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_008201765.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_002776780.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_039741952.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_038555202.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_024971182.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
ref|WP_012265852.1|  glucose-1-phosphate adenylyltransferase            116   1e-26   
gb|KIE12365.1|  glucose-1-phosphate adenylyltransferase                 116   1e-26   



>gb|AGB85109.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +1

Query  235  MEFCATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLT  414
            MEFCATLKSSAHLPRET FFGG+IRGS+NNNVL++QSRKSL+L+ NKRKIKPGVAFSVLT
Sbjct  1    MEFCATLKSSAHLPRETEFFGGRIRGSLNNNVLLSQSRKSLRLDGNKRKIKPGVAFSVLT  60

Query  415  RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLID  594
            RENGTETLTVEAPILERRRANPKNVAAIILGGGAGT LFPLTNRAATPAVP+GGCYRLID
Sbjct  61   RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTHLFPLTNRAATPAVPLGGCYRLID  120

Query  595  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF
Sbjct  121  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  160



>dbj|BAF47746.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1A [Ipomoea 
batatas]
Length=517

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +1

Query  235  MEFCATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLT  414
            MEFCATLKSSAHLPRET FFGG+IRGS+NNNVL++QSRKSL+L+ NKRKIKPGVAFSVLT
Sbjct  1    MEFCATLKSSAHLPRETEFFGGRIRGSLNNNVLLSQSRKSLRLDGNKRKIKPGVAFSVLT  60

Query  415  RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLID  594
            RENGTETLTVEAPILERRRANPKNVAAIILGGGAGT LFPLTNRAATPAVP+GGCYRLID
Sbjct  61   RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTHLFPLTNRAATPAVPLGGCYRLID  120

Query  595  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF
Sbjct  121  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  160



>gb|AFL55396.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +1

Query  235  MEFCATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLT  414
            MEFC TLKSSAHLPRET FFGG+IRGS+NNNVL ++SRKSL+++ NKRKIKPGVAFSVLT
Sbjct  1    MEFCPTLKSSAHLPRETEFFGGRIRGSLNNNVLASKSRKSLRVDGNKRKIKPGVAFSVLT  60

Query  415  RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLID  594
            RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVP+GGCYRLID
Sbjct  61   RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPLGGCYRLID  120

Query  595  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF
Sbjct  121  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  160



>gb|AAC21562.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=517

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +1

Query  235  MEFCATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLT  414
            MEFCATLKSSAHLPRET FFGG+IRGS+NNNVL++QSRKSL+L+ NKRKIKPGVAFSVLT
Sbjct  1    MEFCATLKSSAHLPRETEFFGGRIRGSLNNNVLLSQSRKSLRLDGNKRKIKPGVAFSVLT  60

Query  415  RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLID  594
            RENGTETLTVEAPILERRRANPKNVAAIIL GGAGT LFPLTNRAATPAVP+GGCYRLID
Sbjct  61   RENGTETLTVEAPILERRRANPKNVAAIILPGGAGTHLFPLTNRAATPAVPLGGCYRLID  120

Query  595  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IPMSNCINSGVNKIFVLTQFNSASLNRHISRT FGNGVSF
Sbjct  121  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTVFGNGVSF  160



>gb|AGB85110.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 3/158 (2%)
 Frame = +1

Query  241  FCATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRE  420
            +CATLKS+ HLPRE+  +G ++   + N VLVNQ  KSLKLE N RKIKPGVAFSVLTRE
Sbjct  4    YCATLKSTTHLPRESELWGKRM---LKNRVLVNQFGKSLKLERNGRKIKPGVAFSVLTRE  60

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
             G ETLTVEAP LER RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR+IDIP
Sbjct  61   TGKETLTVEAPRLERVRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRMIDIP  120

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            MSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNGVSF
Sbjct  121  MSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGVSF  158



>dbj|BAF47747.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1B [Ipomoea 
batatas]
Length=515

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 3/158 (2%)
 Frame = +1

Query  241  FCATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRE  420
            +CATLKS+ HLPRE+  +G ++   + N VLV Q  KSLKLE N RKIKPGVAFSVLTRE
Sbjct  4    YCATLKSTTHLPRESELWGKRM---LKNRVLVKQFGKSLKLERNGRKIKPGVAFSVLTRE  60

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
             G ETLTVEAP LER RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR+IDIP
Sbjct  61   TGKETLTVEAPRLERVRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRMIDIP  120

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            MSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNGVSF
Sbjct  121  MSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGVSF  158



>gb|AFL55397.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 3/158 (2%)
 Frame = +1

Query  241  FCATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRE  420
            +CATLKS+ HLPRE+  +G ++   +  +V+VNQ  KSLKLE N RKIKPGVAFSVLTRE
Sbjct  4    YCATLKSTTHLPRESELWGKRM---LKTSVVVNQFGKSLKLERNGRKIKPGVAFSVLTRE  60

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
             G ETL+VEAP LER RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR+IDIP
Sbjct  61   TGRETLSVEAPRLERVRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRMIDIP  120

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            MSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNGVSF
Sbjct  121  MSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGVSF  158



>emb|CAB55495.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=490

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  316  VNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAA  495
            +NNNVL++QSRKSL+L+ NKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAA
Sbjct  1    LNNNVLLSQSRKSLRLDGNKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAA  60

Query  496  IILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNR  675
            IIL GGAGTQLFPLTNRAATPAVP+GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNR
Sbjct  61   IILPGGAGTQLFPLTNRAATPAVPLGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNR  120

Query  676  HISRTYFGNGVSF  714
            HISRTYFGNGVSF
Sbjct  121  HISRTYFGNGVSF  133



>emb|CDO97030.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = +1

Query  247  ATLKSSAHLPR---ETGFFGGKIRGSVNNNVLVNQSRKSLKLE-ENKRKIKPGVAFSVLT  414
            AT+K++AHL     E G +G +++GS+N N  VNQ  KSLKL+ E K+K KPG AFSV+T
Sbjct  6    ATMKATAHLATVNGENGIWGERVKGSLNGNFWVNQLAKSLKLDYEKKQKFKPGAAFSVIT  65

Query  415  RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLID  594
            RE G ETLT+EAP  ERRRA+PKNVAAIILGGGAGTQLFPLT+R ATPAVPVGGCYRLID
Sbjct  66   RETGKETLTIEAPRFERRRADPKNVAAIILGGGAGTQLFPLTSRTATPAVPVGGCYRLID  125

Query  595  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IPMSNCINSG+NKIFVLTQFNSASLNRHI+RTY GNGV+F
Sbjct  126  IPMSNCINSGINKIFVLTQFNSASLNRHIARTYHGNGVNF  165



>ref|XP_011088418.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088419.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088420.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088421.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088422.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088423.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
Length=526

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 136/169 (80%), Gaps = 9/169 (5%)
 Frame = +1

Query  235  MEFCATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIK  387
            M+ CATLK +AHL           E G +G KIRGS+++    NQ  +SL LE   RKIK
Sbjct  1    MDSCATLKPTAHLGNLSKGGFGNGEKGIWGEKIRGSLSSCGWANQLGRSLSLENKGRKIK  60

Query  388  PGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVP  567
            PGVA+SVLTREN  ET+TV+ PI ERRRANPKNVAAIILGGGAG  LFPLTNRAATPAVP
Sbjct  61   PGVAYSVLTRENNKETVTVQTPIPERRRANPKNVAAIILGGGAGKHLFPLTNRAATPAVP  120

Query  568  VGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            VGGCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTY GNG+SF
Sbjct  121  VGGCYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHISRTYTGNGISF  169



>ref|XP_006365120.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365121.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Solanum tuberosum]
Length=527

 Score =   239 bits (611),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  +KS+ HL R         E  FFG KIRGS+N+N+ +NQ  KSLKLE+ + KIKPGV
Sbjct  5    CVPMKSTVHLGRVSTGGFNNGEKEFFGEKIRGSLNSNLRINQLSKSLKLEKKENKIKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A+SV+T EN T+T+ V+ P LERRRANPK+VAA+ILGGG GT+LFPLT+R ATPAVPVGG
Sbjct  65   AYSVITTENDTQTVFVDMPRLERRRANPKDVAAVILGGGEGTKLFPLTSRTATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIFVLTQ+NSA LNRHI+RTYFGNGVSF
Sbjct  125  CYRLIDIPMSNCINSAINKIFVLTQYNSAPLNRHIARTYFGNGVSF  170



>gb|ABC26921.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|ABC26922.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=524

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 136/166 (82%), Gaps = 12/166 (7%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CA +KS+ HL R         E   FG KIRGS+NNN+ +NQ  KSLKLE   +KIKPGV
Sbjct  5    CAAMKSTVHLGRVSTGGFNNGEKEIFGEKIRGSLNNNLRINQLSKSLKLE---KKIKPGV  61

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A+SV+T EN TET+ V+ P LERRRANPK+VAA+ILGGG GT+LFPLT+R ATPAVPVGG
Sbjct  62   AYSVITTENDTETVFVDMPRLERRRANPKDVAAVILGGGEGTKLFPLTSRTATPAVPVGG  121

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIFVLTQ+NSA+LNRHI+RTYFGNGVSF
Sbjct  122  CYRLIDIPMSNCINSAINKIFVLTQYNSAALNRHIARTYFGNGVSF  167



>ref|XP_011015433.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015434.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015435.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CATLK++ H+ +         +  F+G +IRGS+NN+V VNQ  KSLK++++  K KPGV
Sbjct  5    CATLKATTHVAKASKGGFNNGDKEFWGERIRGSLNNSVWVNQLAKSLKVDKSVNKFKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            AFSVLT  NG ET+T + P  ERR+A+PKNVA+IILGGGAGTQLFPLT RAATPAVP+GG
Sbjct  65   AFSVLTSSNGRETVTFQPPRFERRKADPKNVASIILGGGAGTQLFPLTRRAATPAVPLGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRH++RTYFGNG+ F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHLARTYFGNGIIF  170



>ref|XP_011048155.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=540

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CATLK++ H+ +         +  F+G +IRGS+NN+V VNQ  KSLK++++  K KPGV
Sbjct  5    CATLKATTHVAKASKGGFNNGDKEFWGERIRGSLNNSVWVNQLAKSLKVDKSVNKFKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            AFSVLT  NG ET+T + P  ERR+A+PKNVA+IILGGGAGTQLFPLT RAATPAVP+GG
Sbjct  65   AFSVLTSSNGRETVTFQPPRFERRKADPKNVASIILGGGAGTQLFPLTRRAATPAVPLGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRH++RTYFGNG+ F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHLARTYFGNGIIF  170



>ref|XP_002283855.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
Length=527

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 134/166 (81%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C T K+ AHL +         +  F+G +IRGS+NN+  V+Q  K LK E+  RKIKPGV
Sbjct  5    CVTFKAKAHLAKASRGGLSNGDNEFWGERIRGSLNNSGWVSQLAKGLKTEKRPRKIKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A SV+T  NG ET+T++API ERRRA+PKNVA+IILGGGAGTQLFPLT R ATPAVPVGG
Sbjct  65   ACSVITSNNGKETVTIQAPIFERRRADPKNVASIILGGGAGTQLFPLTIRQATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIF+LTQFNSASLNRHI+RTYFGNGV+F
Sbjct  125  CYRLIDIPMSNCINSNINKIFILTQFNSASLNRHIARTYFGNGVNF  170



>ref|XP_002313036.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86991.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=527

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 136/166 (82%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CATLK++ H+ +         +  F+G +IRGS NN+V VNQ  KSLK++++  K KPGV
Sbjct  5    CATLKANTHVAKASKGGFNNGDKEFWGERIRGSFNNSVWVNQLAKSLKVDKSVNKFKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            AFSVLT  NG ET+T++ P  ERR+A+PKNVA+IILGGGAGTQLFPLT RAATPAVP+GG
Sbjct  65   AFSVLTSSNGRETVTLQPPRFERRKADPKNVASIILGGGAGTQLFPLTRRAATPAVPLGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNS SLNRH++RTYFGNG+ F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSTSLNRHLARTYFGNGIIF  170



>ref|XP_010690849.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +1

Query  241  FCATLKSSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            +CATL  S HL R      E+GF+G +I GS+ +NVLVN+   SLK+++  RKIKPGVAF
Sbjct  4    YCATLGGSTHLTRTGKRDGESGFWGERISGSLKSNVLVNKLSMSLKIDQRIRKIKPGVAF  63

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            SV+T  N TE +  E PI ERRRA+PKNVA+IILGGG G QLFPLT+R ATPAVPVGG Y
Sbjct  64   SVMTSNNATEIIIRETPIFERRRADPKNVASIILGGGVGAQLFPLTSRTATPAVPVGGSY  123

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINSG+NKIF+LTQFNSASLNRHI RTY GNG++F
Sbjct  124  RLIDIPMSNCINSGINKIFILTQFNSASLNRHIYRTYHGNGINF  167



>ref|XP_009621409.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana tomentosiformis]
Length=528

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 10/167 (6%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSR-KSLKLEENKRKIKPG  393
            C  LKS+AHL R         E  F G +IRGS+NNN L   +  KSLKLE+ + KIKPG
Sbjct  5    CVALKSTAHLGRVSKGGFENGEKEFLGEQIRGSLNNNNLRVNNLSKSLKLEKKESKIKPG  64

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            VAFSV+T ENG ETLTVEAP  +RRRANPKNVA++ILGGGAGT+LFPLT+RAATPAVPVG
Sbjct  65   VAFSVITTENGKETLTVEAPRFDRRRANPKNVASVILGGGAGTKLFPLTSRAATPAVPVG  124

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCYRLIDIPMSNCINSG+NKIFVLTQ+NSA LNRHI+RTYFGNGVSF
Sbjct  125  GCYRLIDIPMSNCINSGINKIFVLTQYNSAPLNRHIARTYFGNGVSF  171



>ref|NP_001233918.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40723.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=516

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 134/163 (82%), Gaps = 12/163 (7%)
 Frame = +1

Query  253  LKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFS  405
            +KS+ HL R         E   FG KIRGS+NNN+ +NQ  KSLKLE   +KIKPGVA+S
Sbjct  1    MKSTVHLGRVSTGGFNNGEKEIFGEKIRGSLNNNLRINQLSKSLKLE---KKIKPGVAYS  57

Query  406  VLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            V+T EN TET+ V+ P LERRRANPK+VAA+ILGGG GT+LFPLT+R ATPAVPVGGCYR
Sbjct  58   VITTENDTETVFVDMPRLERRRANPKDVAAVILGGGEGTKLFPLTSRTATPAVPVGGCYR  117

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            LIDIPMSNCINS +NKIFVLTQ+NSA+LNRHI+RTYFGNGVSF
Sbjct  118  LIDIPMSNCINSAINKIFVLTQYNSAALNRHIARTYFGNGVSF  160



>ref|XP_009763056.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana sylvestris]
Length=528

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 140/171 (82%), Gaps = 11/171 (6%)
 Frame = +1

Query  235  MEFC-ATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQS-RKSLKLEENKRK  381
            M+ C   LKS+AHL R         E  F G +IRGS+NNN L   +  KSLKLE+ + K
Sbjct  1    MDTCFVALKSTAHLGRVSKGGFENGEKEFLGEQIRGSLNNNNLRVNNLSKSLKLEKKESK  60

Query  382  IKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPA  561
            IKPGVAFSV+T ENG ETLTVEAP  +RRRANPKNVA++ILGGGAGT+LFPLT+RAATPA
Sbjct  61   IKPGVAFSVITTENGKETLTVEAPRFDRRRANPKNVASVILGGGAGTKLFPLTSRAATPA  120

Query  562  VPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            VPVGGCYRLIDIPMSNCINSG+NKIFVLTQ+NSA LNRHI+RTYFGNGVSF
Sbjct  121  VPVGGCYRLIDIPMSNCINSGINKIFVLTQYNSAPLNRHIARTYFGNGVSF  171



>gb|AAC49941.1| ADP-glucose pyrophosphorylase large subunit 1 [Solanum lycopersicum]
Length=524

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 134/166 (81%), Gaps = 12/166 (7%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CA +KS+ HL R         E   FG KIRGS+NNN+ +NQ  KSLKLE   +KIK G 
Sbjct  5    CAAMKSTVHLGRVSTGGFNNGEKEIFGEKIRGSLNNNLRINQLSKSLKLE---KKIKFGE  61

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A+SV+T EN TET+ V+ P LERRRANPK+VAA+ILGGG GT+LFPLT+R ATPAVPVGG
Sbjct  62   AYSVITIENDTETVFVDMPRLERRRANPKDVAAVILGGGEGTKLFPLTSRTATPAVPVGG  121

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIFVLTQ+NSA+LNRHI+RTYFGNGVSF
Sbjct  122  CYRLIDIPMSNCINSAINKIFVLTQYNSAALNRHIARTYFGNGVSF  167



>ref|XP_011037496.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011037497.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  L+++ H+ +         +T F+G +IRGS NN+V VNQ  KSLK++++  K  PGV
Sbjct  5    CVALRANTHVAKASKGGFNNGDTEFWGERIRGSFNNSVWVNQFAKSLKVDKSVNKFTPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            AF+VLT  NG ET+T++ P   RRRA+PKNVA+IILGGGAGTQLFPLT RAATPAVPVGG
Sbjct  65   AFAVLTSNNGKETVTLQPPRFGRRRADPKNVASIILGGGAGTQLFPLTRRAATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRH++ TYFGNG++F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHLAHTYFGNGINF  170



>gb|AAF66436.1|AF249917_1 ADP-glucose pyrophosphorylase large subunit [Perilla frutescens]
Length=527

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 132/166 (80%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLP---------RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CATLKS++HL           + GF+G KI+GS+NN     Q  K L LE+  RKIKPGV
Sbjct  5    CATLKSTSHLSNVSKSAFCGEKNGFWGEKIKGSLNNCARAYQFGKKLNLEKRGRKIKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A+SVLT++N  ETL +  P+ E+R ANPK VAAIILGGGAG QLFPLT++AATPAVPVGG
Sbjct  65   AYSVLTKKNINETLMIPPPLFEKRGANPKIVAAIILGGGAGKQLFPLTSKAATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTY GNGVSF
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHISRTYTGNGVSF  170



>gb|EYU37810.1| hypothetical protein MIMGU_mgv1a004455mg [Erythranthe guttata]
Length=526

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 129/167 (77%), Gaps = 12/167 (7%)
 Frame = +1

Query  244  CATLKSSAHL----------PRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            CATLK +AHL             +GF+G KIRGS+NN   +   +K L LE N RKIKPG
Sbjct  5    CATLKPAAHLANLRKGVFCNEESSGFWGDKIRGSLNN--YIQFGKKKLNLENNGRKIKPG  62

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
             A SVL RE   ET TV+ P +ER+RAN KNVAAIILGGG+G QLFPLT+RAATPAVP+G
Sbjct  63   FASSVLIRETDNETTTVKTPRIERKRANLKNVAAIILGGGSGAQLFPLTSRAATPAVPIG  122

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCYRLID+PMSNCINSG+NKIFVLTQFNSASLNRHI RTY GNGVSF
Sbjct  123  GCYRLIDVPMSNCINSGINKIFVLTQFNSASLNRHICRTYTGNGVSF  169



>gb|KCW55369.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=474

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  LK++A L +         + GF G +IRGS++N+V V Q  ++L++E+  +K KPGV
Sbjct  5    CVALKANASLAQSNKSCLKNVDKGFLGERIRGSLDNSVWVKQVARNLRVEKKFKKAKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            AF+V+T     ETLT+ +P+L R RA+PK VAAIILGGGAG QLFPLT RAATPAVPVGG
Sbjct  65   AFAVITSNTVAETLTIRSPVLHRPRADPKKVAAIILGGGAGIQLFPLTRRAATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRH++RTYFGNGV+F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHLARTYFGNGVNF  170



>gb|ABC26923.1| ADPglucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=527

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 138/166 (83%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CA +KS+ HL R         E   FG K+RGS+NNN+ +NQ  KSLKLE+ ++KIKPGV
Sbjct  5    CAAMKSTVHLGRVSTGSFNNGEKEIFGEKMRGSLNNNLRINQLSKSLKLEKKEKKIKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A++V+T EN TET+ V+ P LERRRANPK+VAA+ILGGG GT+LFPLT+R ATPAVPVGG
Sbjct  65   AYAVITTENDTETVFVDMPRLERRRANPKDVAAVILGGGEGTKLFPLTSRTATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIFVLTQ+NSA+LNRHI+RTYFGNGVSF
Sbjct  125  CYRLIDIPMSNCINSAINKIFVLTQYNSAALNRHIARTYFGNGVSF  170



>ref|XP_010028607.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010028608.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW55367.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=527

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  LK++A L +         + GF G +IRGS++N+V V Q  ++L++E+  +K KPGV
Sbjct  5    CVALKANASLAQSNKSCLKNVDKGFLGERIRGSLDNSVWVKQVARNLRVEKKFKKAKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            AF+V+T     ETLT+ +P+L R RA+PK VAAIILGGGAG QLFPLT RAATPAVPVGG
Sbjct  65   AFAVITSNTVAETLTIRSPVLHRPRADPKKVAAIILGGGAGIQLFPLTRRAATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRH++RTYFGNGV+F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHLARTYFGNGVNF  170



>emb|CBI37674.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 129/166 (78%), Gaps = 19/166 (11%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C T K+ AHL +         +  F+G +IRGS+NN+  V+Q RK          IKPGV
Sbjct  5    CVTFKAKAHLAKASRGGLSNGDNEFWGERIRGSLNNSGWVSQPRK----------IKPGV  54

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A SV+T  NG ET+T++API ERRRA+PKNVA+IILGGGAGTQLFPLT R ATPAVPVGG
Sbjct  55   ACSVITSNNGKETVTIQAPIFERRRADPKNVASIILGGGAGTQLFPLTIRQATPAVPVGG  114

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIF+LTQFNSASLNRHI+RTYFGNGV+F
Sbjct  115  CYRLIDIPMSNCINSNINKIFILTQFNSASLNRHIARTYFGNGVNF  160



>gb|AAD56405.1|AF184345_1 ADP-glucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=520

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 9/163 (6%)
 Frame = +1

Query  253  LKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFS  405
            +KS+ HL R         E   FG K+RGS+NNN+ +NQ  KSLKLE+ ++KIKPGVA+S
Sbjct  1    MKSTVHLGRVSTGGFNNGEKEIFGEKMRGSLNNNLRINQLSKSLKLEKKEKKIKPGVAYS  60

Query  406  VLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            V+T EN TET+ V+ P LERRRANPK+VAA+ILGGG GT+LFPLT+R ATPAVPVGGCYR
Sbjct  61   VITTENDTETVFVDMPRLERRRANPKDVAAVILGGGEGTKLFPLTSRTATPAVPVGGCYR  120

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            LIDIPMSNCINS +NKIFVLTQ+NSA+LNRHI+RTYFGNGVSF
Sbjct  121  LIDIPMSNCINSAINKIFVLTQYNSAALNRHIARTYFGNGVSF  163



>ref|XP_002306116.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86627.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=526

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            +T F+G +IRGS NN +  NQ  KSLK++++  K  PGVAF+VLT  NG ET+T++ P  
Sbjct  26   DTEFWGERIRGSFNN-IWANQFAKSLKVDKSVNKFTPGVAFAVLTSNNGKETVTLQPPRF  84

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
             RRRA+PKNVA+IILGGGAGTQLFPLT RAATPAVPVGGCYRLIDIPMSNCINSG+NKIF
Sbjct  85   GRRRADPKNVASIILGGGAGTQLFPLTRRAATPAVPVGGCYRLIDIPMSNCINSGINKIF  144

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++ TYFGNG++F
Sbjct  145  VLTQFNSASLNRHLAHTYFGNGINF  169



>gb|KDP41770.1| hypothetical protein JCGZ_26788 [Jatropha curcas]
Length=527

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 131/166 (79%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPRET--GF-------FGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  LK++ H+ + +  GF        G  +RGS+N  V +NQ  +SL++E N  K KPGV
Sbjct  5    CVPLKANTHMAQASRAGFRSGDKEILGENMRGSLNKGVWLNQLTRSLRVERNVNKAKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A++VLT  N  E +T++ PI ERR+ +PKNVA+IILGGGAGTQLFPLT RAATPAVPVGG
Sbjct  65   AYAVLTSNNPKEVVTLQPPIFERRKVDPKNVASIILGGGAGTQLFPLTRRAATPAVPVGG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CY+LIDIPMSNCINSG++KIFVLTQFNSASLNRH++RTYFGNGV+F
Sbjct  125  CYKLIDIPMSNCINSGIHKIFVLTQFNSASLNRHLARTYFGNGVNF  170



>gb|AGS94412.1| ADP-glucose pyrophosphorylase large subunit 4 [Actinidia deliciosa]
Length=524

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 130/167 (78%), Gaps = 12/167 (7%)
 Frame = +1

Query  241  FCATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            FC  L    HL +         E+GF+  ++R S+ NN+ V+Q  KSL+ E   RKI+PG
Sbjct  4    FCGALGPKTHLGKVRKDCLNDGESGFWRERMRESMKNNLRVDQLGKSLRSERRARKIRPG  63

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            V+ SV+T ++G ETLT++AP  ERRRANPKNV AIILGGGAGTQLFPLT++ ATPAVPVG
Sbjct  64   VSCSVITTDHGKETLTIQAPRFERRRANPKNVIAIILGGGAGTQLFPLTSKTATPAVPVG  123

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY---FGNG  705
            GCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTY   FG+G
Sbjct  124  GCYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYGMSFGDG  170



>ref|XP_006423322.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
 ref|XP_006487217.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Citrus sinensis]
 gb|ESR36562.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
Length=527

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 131/166 (79%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPRETGF---------FGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  L+++ H+ + + +         +G +IRGSV+N+    Q +KSLK E+   K+KPGV
Sbjct  5    CVGLRANTHVVKASKYGSKIGDNALWGERIRGSVSNDGCTKQLKKSLKAEKRDEKVKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A++V+T ++  E +T+  P LERRR +PKNVAAIILGGGAGT+LFPLT RAATPAVPV G
Sbjct  65   AYAVMTSKHPNEVMTLAPPRLERRRVDPKNVAAIILGGGAGTKLFPLTLRAATPAVPVAG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  170



>ref|NP_001275823.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Citrus sinensis]
 gb|ACF77017.1| ADP-glucose pyrophosphorylase large subunit [Citrus sinensis]
Length=527

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 130/166 (78%), Gaps = 9/166 (5%)
 Frame = +1

Query  244  CATLKSSAHLPRETGF---------FGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  L+++ H+ + + +         +G +IRGSV+N+    Q +KSLK E+   K+KPGV
Sbjct  5    CVGLRANTHVVKASKYGSKIGDNALWGERIRGSVSNDGCTKQLKKSLKAEKRDEKVKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A++V+T ++  E +T+  P LERRR +PKNVAAIILGGGAGT+LFPLT RAATPAVPV G
Sbjct  65   AYAVMTSKHPNEVMTLAPPRLERRRVDPKNVAAIILGGGAGTKLFPLTLRAATPAVPVAG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG +F
Sbjct  125  CYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGTNF  170



>ref|XP_008236919.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Prunus mume]
Length=524

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 130/164 (79%), Gaps = 8/164 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C TLK +AHL +       + GF+G ++RGS+NN +  N+  K+L+ E+  +K+K GV  
Sbjct  5    CVTLKPNAHLRKPSGLCNGDGGFWGERVRGSLNNKLWDNRLTKALRAEKRAKKVKSGVVL  64

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            SVLT  N TE + V+ P + RRR +PKNVA+IILGGGAGTQLFPLT R+ATPAVPVGGCY
Sbjct  65   SVLTSSN-TEAVAVQMPPIYRRRVDPKNVASIILGGGAGTQLFPLTIRSATPAVPVGGCY  123

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  124  RLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  167



>ref|XP_007201161.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
 gb|EMJ02360.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
Length=524

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 128/164 (78%), Gaps = 8/164 (5%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C TLK + HL +       + GF+G ++RGS+NN +  NQ  K+L+ E+  +K+K GV  
Sbjct  5    CVTLKPNTHLRKPSGLCNGDAGFWGERVRGSLNNKLWDNQLTKALRAEKRAKKVKSGVVL  64

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            SVLT  N TE + V+ P + RRR +PK VA+IILGGGAGTQLFPLT R+ATPAVPVGGCY
Sbjct  65   SVLTSSN-TEAVAVQMPPIYRRRVDPKTVASIILGGGAGTQLFPLTIRSATPAVPVGGCY  123

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  124  RLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  167



>gb|AHM92232.1| AGPase large subunit protein [Hevea brasiliensis]
Length=527

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 10/170 (6%)
 Frame = +1

Query  235  MEFCAT-LKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKI  384
            M+ C+  +K++AH+ +         +  F+G +IRGS+NN++  +Q  +SL+ E N  K+
Sbjct  1    MDSCSVAVKANAHVAKPSKGDFKSGDKEFWGERIRGSLNNSIWSHQMTRSLRAERNVIKV  60

Query  385  KPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
            KPGVA +VLT  N  E +T++ P  ERR+ +PKNVA+IILGGGAGT LFPLT RAATPAV
Sbjct  61   KPGVACAVLTSNNPKEVVTLQPPRFERRKVDPKNVASIILGGGAGTALFPLTRRAATPAV  120

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PVGGCY+LIDIPMSN INSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  121  PVGGCYKLIDIPMSNSINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  170



>gb|EPS74142.1| glucose-1-phosphate adenylyltransferase [Genlisea aurea]
Length=543

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 130/165 (79%), Gaps = 6/165 (4%)
 Frame = +1

Query  235  MEFC-ATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRK----IKPGVA  399
            M+ C ATLK +     E GF+G K+RGSV +   +N S K   LE  K+K    +K G+A
Sbjct  1    MDSCFATLKHTGIRSVENGFWGEKLRGSVGSMGCLNVSVKE-GLENGKKKKKKNMKQGIA  59

Query  400  FSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
            +SVLTRE   E LT++AP +E+RR +PKNVAAIILGGG+G QLFPLT R+ATPAVPVGGC
Sbjct  60   YSVLTREENRERLTIQAPRIEKRRVDPKNVAAIILGGGSGKQLFPLTRRSATPAVPVGGC  119

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            YRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTY GNG+SF
Sbjct  120  YRLIDIPMSNCINSGINKIFVLTQFNSASLNRHISRTYTGNGISF  164



>ref|XP_003541029.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Glycine max]
 gb|KHN25384.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=528

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 10/167 (6%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNN-VLVNQSRKSLKLEENKRKIKPG  393
            C TLK++ HL +         ++GF G +I+G +N +  ++NQ   SL+ +E  +K KPG
Sbjct  5    CVTLKANTHLVKSRKDNTFRQDSGFLGERIKGGLNYSPWIINQLASSLRTQERVKKAKPG  64

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            V  +VLT  N  E++  + P   RR+A+PKNV +IILGGG G QLFPLT RAATPAVPVG
Sbjct  65   VVSAVLTSSNTKESVAFQMPSFLRRKADPKNVVSIILGGGPGIQLFPLTKRAATPAVPVG  124

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTYFGNG++F
Sbjct  125  GCYRLIDIPMSNCINSGLNKIFVLTQFNSASLNRHISRTYFGNGINF  171



>ref|XP_006577921.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Glycine max]
Length=489

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  244  CATLKSSAHLP-RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKR-KIKPGVAFSVLTR  417
            C TLKS+ HL   E GF G +I+G  NN+ LV  ++ +++   +KR K   GV  +VLT 
Sbjct  5    CVTLKSNTHLANSEKGFLGERIKGGFNNSALV-MNQLAIRSRSHKRVKHGVGVVSAVLTS  63

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
             N  E+LT++ P   RRRA+PKNV +IILGGG GTQLFPLT RAATPAVPVGGCYRLIDI
Sbjct  64   NNAKESLTLQVPSFLRRRADPKNVISIILGGGPGTQLFPLTKRAATPAVPVGGCYRLIDI  123

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PMSNC+NSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  124  PMSNCLNSGINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>ref|XP_003527197.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 gb|KHN20061.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  244  CATLKSSAHLP-RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKR-KIKPGVAFSVLTR  417
            C TLK++ HL   E GF G +I+G  NN+ LV  ++ +++   +KR K   GV  SVLT 
Sbjct  5    CVTLKANTHLANSEKGFLGERIKGGFNNSALV-MNQLAIRSRSHKRVKHGVGVVSSVLTS  63

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
             N  E+LT++ P   RRRA+PKNV +IILGGG GTQLFPLT RAATPAVPVGGCYRLIDI
Sbjct  64   NNAKESLTLQVPSFLRRRADPKNVVSIILGGGPGTQLFPLTKRAATPAVPVGGCYRLIDI  123

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PMSNC+NSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  124  PMSNCLNSGINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>ref|XP_009342671.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=509

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 123/164 (75%), Gaps = 15/164 (9%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C  LK + HL         +TGF G  +RGS N+ +  +Q      L  +KRK+KPG   
Sbjct  5    CVALKPNTHLRNASGFCNGDTGFLGESVRGSFNHRLWASQ------LRTDKRKVKPGAVL  58

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            +VLT  N TE +T++ P+  RRR +PKNVA+IILGGGAGTQLFPLT R+ATPAVPVGGCY
Sbjct  59   AVLT-SNDTEAVTLQMPMF-RRRVDPKNVASIILGGGAGTQLFPLTKRSATPAVPVGGCY  116

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  117  RLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  160



>ref|XP_003522921.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006577920.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN33746.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  244  CATLKSSAHLP-RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKR-KIKPGVAFSVLTR  417
            C TLKS+ HL   E GF G +I+G  NN+ LV  ++ +++   +KR K   GV  +VLT 
Sbjct  5    CVTLKSNTHLANSEKGFLGERIKGGFNNSALV-MNQLAIRSRSHKRVKHGVGVVSAVLTS  63

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
             N  E+LT++ P   RRRA+PKNV +IILGGG GTQLFPLT RAATPAVPVGGCYRLIDI
Sbjct  64   NNAKESLTLQVPSFLRRRADPKNVISIILGGGPGTQLFPLTKRAATPAVPVGGCYRLIDI  123

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PMSNC+NSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  124  PMSNCLNSGINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>ref|XP_010088945.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
 gb|EXB37149.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
Length=535

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 125/174 (72%), Gaps = 17/174 (10%)
 Frame = +1

Query  244  CATLKSSAHLPR----------ETGFFGGKIRGSVNNNVL------VNQSRKSLKLEENK  375
            C T K +AHL +          ++G  G KIRGS+  N L      +N    + K   NK
Sbjct  5    CVTTKPNAHLAKASQGGLRYGGDSGILGEKIRGSLKKNSLWIKQATLNSLLGNEKRIRNK  64

Query  376  RKIKPGVAFSVLTRENGTETLT-VEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAA  552
             K+KPGVAF+V T  +  E LT ++ P   RRRA+PKNVAAIILGGGAGTQLFPLT RAA
Sbjct  65   AKVKPGVAFAVATTNDTKEALTTLQVPQFHRRRADPKNVAAIILGGGAGTQLFPLTRRAA  124

Query  553  TPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
             PAVPVGGCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNGV+F
Sbjct  125  IPAVPVGGCYRLIDIPMSNCINSDINKIFVLTQFNSASLNRHIARTYFGNGVNF  178



>ref|XP_008460955.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
 ref|XP_008460956.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
Length=526

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 126/170 (74%), Gaps = 14/170 (8%)
 Frame = +1

Query  235  MEFC-ATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKI  384
            M+ C  +LKS+  L +         E GF+G K+RG  N NV +    KSLK E+   K+
Sbjct  4    MDSCFVSLKSNTQLMKGNWGGLDRCENGFYGEKVRGGFNENVWI----KSLKYEKKALKL  59

Query  385  KPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
             P VA++V T     + +T++ P + + +ANPKNVA+IILGGGAGT LFPLT R+ATPAV
Sbjct  60   TPNVAYAVATPNVSKQPMTIQVPTVPKVKANPKNVASIILGGGAGTHLFPLTKRSATPAV  119

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PVGGCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTYFGNGV+F
Sbjct  120  PVGGCYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHISRTYFGNGVTF  169



>ref|XP_002512925.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF49428.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=531

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 118/146 (81%), Gaps = 4/146 (3%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI----  456
            F G  IRGS  N+V  NQ ++ LK + N  K+KPGVA++VLT  N  E +T+  P     
Sbjct  29   FLGEMIRGSSKNSVWFNQMKRRLKADWNVNKVKPGVAYAVLTSNNPKEIVTLSPPPPPPR  88

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
             ERR+ +PKNVA+IILGGGAGTQLFPLT RAATPAVPVGGCY+LIDIPMSNCINSG+NKI
Sbjct  89   FERRKVDPKNVASIILGGGAGTQLFPLTRRAATPAVPVGGCYKLIDIPMSNCINSGINKI  148

Query  637  FVLTQFNSASLNRHISRTYFGNGVSF  714
            FVLTQFNSASLNRH++RTYFGNG++F
Sbjct  149  FVLTQFNSASLNRHLARTYFGNGINF  174



>ref|XP_010531437.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
 ref|XP_010531439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
Length=526

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 123/164 (75%), Gaps = 7/164 (4%)
 Frame = +1

Query  244  CATLKSSAHLPRE------TGFFGGKIRGSVNNNVLVNQSRKSLKLEEN-KRKIKPGVAF  402
            C  L  +  LP+E        F+G KI+GS NNN  VN     LK  +   RK +PGVA+
Sbjct  6    CFALGKNPTLPKERFKNVANRFWGEKIKGSSNNNDFVNPFASDLKSNKTGSRKFRPGVAY  65

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            +V T +N  E LT++  + ERR+A+PKNVAAIILGGG G QLFPLT R+ATPAVPVGGCY
Sbjct  66   AVATSKNAKEALTIQPSLFERRKADPKNVAAIILGGGNGAQLFPLTKRSATPAVPVGGCY  125

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLID+PMSNC+NS +NKIFVLTQFNSASLNRH++RTYFGNG++F
Sbjct  126  RLIDVPMSNCLNSNINKIFVLTQFNSASLNRHLARTYFGNGINF  169



>ref|XP_009345668.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=517

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 123/164 (75%), Gaps = 15/164 (9%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C  LK + HL         +TGF G  +RGS N+ +  +Q      L  +KRK+KPG   
Sbjct  5    CVALKPNTHLRNASGFCNGDTGFLGESVRGSFNHRLWASQ------LRTDKRKVKPGAVL  58

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            +VLT  N TE +T++ P+  RRR +PKNVA+IILGGGAGTQLFPLT R+ATPAVPVGGCY
Sbjct  59   AVLT-SNDTEAVTLQMPMF-RRRVDPKNVASIILGGGAGTQLFPLTKRSATPAVPVGGCY  116

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  117  RLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  160



>gb|AAB91467.1| ADP-glucose pyrophosphorylase large subunit 1 [Citrullus lanatus 
subsp. vulgaris]
Length=526

 Score =   205 bits (522),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 127/170 (75%), Gaps = 14/170 (8%)
 Frame = +1

Query  235  MEFC-ATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKI  384
            M+ C  +LKS+ HL +         E GF+G K+RGS N N  +    KSLK E+   K+
Sbjct  4    MDSCFVSLKSNTHLMKGNWGGLDRCENGFYGEKVRGSFNENAWI----KSLKSEKKALKL  59

Query  385  KPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
             P VA++V T     + ++++ P + + +ANPKNVA+IILGGGAGT LFPLT R+ATPAV
Sbjct  60   TPNVAYAVATPNISKQPVSIQVPSIPKVKANPKNVASIILGGGAGTHLFPLTRRSATPAV  119

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PVGGCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTYFGNGV+F
Sbjct  120  PVGGCYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHISRTYFGNGVNF  169



>ref|XP_008377281.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 123/167 (74%), Gaps = 14/167 (8%)
 Frame = +1

Query  235  MEFCATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            M+ C     + HL +       ++GF G ++RGS NN +  NQ      L   KRK+KPG
Sbjct  1    MDSCCVALKNTHLRKPSGFCNGDSGFLGERVRGSFNNRLWANQ------LRTGKRKVKPG  54

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
               +VLT ++ TE + ++ P L RRR +PKNVA+IILGGGAGTQLFPLT R+A PAVPVG
Sbjct  55   AVLAVLTSKD-TEAVALQMPSLPRRRVDPKNVASIILGGGAGTQLFPLTIRSAIPAVPVG  113

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  114  GCYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  160



>gb|KEH30449.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=475

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +1

Query  247  ATLKSSAHLPRETGFFGGKIRGSVNNNVLV-NQSRKSLKLEENKRKIKPGVAFSVLTREN  423
            A L+  +   ++ GF G +I+  VN +  + NQ   SL+ +E  +K KPGV  +VLT  +
Sbjct  15   ANLRKDSIFHQDNGFLGERIKVGVNYSPWIGNQFGISLRTKERVKKAKPGVVSAVLTSND  74

Query  424  GTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPM  603
             TET T + P   RR+A+PKNVA+I+LGGG G QLFPLT RAATPAVPVGGCYRLIDIPM
Sbjct  75   ATETKTFQVPSFIRRKADPKNVASIVLGGGPGVQLFPLTKRAATPAVPVGGCYRLIDIPM  134

Query  604  SNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            SNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  135  SNCINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  171



>ref|XP_008385901.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 122/164 (74%), Gaps = 15/164 (9%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C  LK + HL         + GF G  +RGS N+ +  NQ      L  +KRK+KPG   
Sbjct  5    CVALKPNTHLGNASGFCNGDPGFLGESVRGSSNHRLWANQ------LRTDKRKVKPGAIL  58

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            +VLT  N TE +T++ P+  RRR +PKNVA+IILGGGAGTQLFPLT R+ATPAVPVGGCY
Sbjct  59   AVLT-SNDTEAVTLQMPMF-RRRVDPKNVASIILGGGAGTQLFPLTKRSATPAVPVGGCY  116

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  117  RLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  160



>ref|NP_001289786.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Nelumbo nucifera]
 gb|AHZ08829.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
 gb|AHZ08830.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
Length=528

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 129/168 (77%), Gaps = 11/168 (7%)
 Frame = +1

Query  244  CATLKSSAH---------LPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CATLK++AH           R+ GF+G  +RGS+ N  +  +  KSL+ E   RKIK GV
Sbjct  5    CATLKANAHPVQVRKGLITNRDNGFWGECLRGSLKNGTMGTKLTKSLRTENGGRKIKTGV  64

Query  397  AFSVLTRENG-TETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            A+SV T  N    T T +AP+L ++RA+PKNVA+IILGGGAGT+LFPLT+R A PAVP+G
Sbjct  65   AYSVFTDVNKEVATQTFQAPLLGKQRADPKNVASIILGGGAGTRLFPLTSRRAKPAVPIG  124

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GCYRLID+PMSNCINSG+NKIF++TQFNSASLNRH++RTY FGNGV+F
Sbjct  125  GCYRLIDVPMSNCINSGINKIFIMTQFNSASLNRHLARTYNFGNGVNF  172



>ref|XP_003606943.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula]
 gb|AES89140.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=528

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +1

Query  247  ATLKSSAHLPRETGFFGGKIRGSVNNNVLV-NQSRKSLKLEENKRKIKPGVAFSVLTREN  423
            A L+  +   ++ GF G +I+  VN +  + NQ   SL+ +E  +K KPGV  +VLT  +
Sbjct  15   ANLRKDSIFHQDNGFLGERIKVGVNYSPWIGNQFGISLRTKERVKKAKPGVVSAVLTSND  74

Query  424  GTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPM  603
             TET T + P   RR+A+PKNVA+I+LGGG G QLFPLT RAATPAVPVGGCYRLIDIPM
Sbjct  75   ATETKTFQVPSFIRRKADPKNVASIVLGGGPGVQLFPLTKRAATPAVPVGGCYRLIDIPM  134

Query  604  SNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            SNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  135  SNCINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  171



>ref|XP_004507462.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=528

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 123/167 (74%), Gaps = 10/167 (6%)
 Frame = +1

Query  244  CATLKSSAHLP---------RETGFFGGKIRGSVNNN-VLVNQSRKSLKLEENKRKIKPG  393
            C   K++ H+          +E GF G +I+G ++ +  ++NQ    LK  E  +K KPG
Sbjct  5    CVNFKTTTHVANLRKDNIFRQENGFLGERIKGGLSYSPWIINQLAICLKTNERVKKAKPG  64

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            V  +VLT  + TET+T + P   RR+A+PKNV +IILGGG G QLFPLT R+ATPAVPVG
Sbjct  65   VVSAVLTSNDATETMTFQVPSFRRRKADPKNVVSIILGGGPGVQLFPLTKRSATPAVPVG  124

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCY+LIDIPMSNCINSG+NK+FVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  125  GCYKLIDIPMSNCINSGINKVFVLTQFNSASLNRHIARTYFGNGINF  171



>ref|XP_007131817.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
 gb|ESW03811.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
Length=528

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 124/167 (74%), Gaps = 10/167 (6%)
 Frame = +1

Query  244  CATLKSSAH---------LPRETGFFGGKIRGSVNNN-VLVNQSRKSLKLEENKRKIKPG  393
            C TLK++ H           ++ GF G +I+GS++ +  ++NQ   SL+ +E  +K KPG
Sbjct  5    CVTLKANTHYGNLRKDNTFRQDGGFLGDRIKGSLSYSPWIINQLALSLRTQERVKKAKPG  64

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            V  +VLT     E++  + P   RR+ANPKNV +IILGGG G QLFPLT RAATPAVPVG
Sbjct  65   VVSAVLTSSTTKESVDFQIPAFLRRKANPKNVVSIILGGGPGIQLFPLTKRAATPAVPVG  124

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCY+LIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTYFGNG++F
Sbjct  125  GCYKLIDIPMSNCINSGLNKIFVLTQFNSASLNRHISRTYFGNGINF  171



>ref|XP_003537869.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006590891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN39792.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=530

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 125/169 (74%), Gaps = 12/169 (7%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNN-VLVNQ--SRKSLKLEENKRKIK  387
            C TLK++ HL +         + GF G +I+G +N +  ++NQ  S  SL+ +E   K K
Sbjct  5    CVTLKANTHLVKSRKDNTFRQDGGFLGERIKGGLNYSPWIINQLASTSSLRTQEKVNKAK  64

Query  388  PGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVP  567
            PGV  +VLT  N  E++  + P   RR+A+PKNV ++ILGGG G QLFPLT RAATPAVP
Sbjct  65   PGVVSAVLTSSNIKESVAFQMPSFLRRKADPKNVVSVILGGGPGIQLFPLTKRAATPAVP  124

Query  568  VGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            VGGCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTYFGNG++F
Sbjct  125  VGGCYRLIDIPMSNCINSGLNKIFVLTQFNSASLNRHISRTYFGNGINF  173



>ref|XP_009342669.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009342670.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=511

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 123/166 (74%), Gaps = 17/166 (10%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C  LK + HL         +TGF G  +RGS N+ +  +Q      L  +KRK+KPG   
Sbjct  5    CVALKPNTHLRNASGFCNGDTGFLGESVRGSFNHRLWASQ------LRTDKRKVKPGAVL  58

Query  403  SVLTRENGTETL--TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            +VLT  N TE +  T++ P+  RRR +PKNVA+IILGGGAGTQLFPLT R+ATPAVPVGG
Sbjct  59   AVLT-SNDTEAVSQTLQMPMF-RRRVDPKNVASIILGGGAGTQLFPLTKRSATPAVPVGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  117  CYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>ref|XP_009345666.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345667.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=519

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 123/166 (74%), Gaps = 17/166 (10%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C  LK + HL         +TGF G  +RGS N+ +  +Q      L  +KRK+KPG   
Sbjct  5    CVALKPNTHLRNASGFCNGDTGFLGESVRGSFNHRLWASQ------LRTDKRKVKPGAVL  58

Query  403  SVLTRENGTETL--TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            +VLT  N TE +  T++ P+  RRR +PKNVA+IILGGGAGTQLFPLT R+ATPAVPVGG
Sbjct  59   AVLT-SNDTEAVSQTLQMPMF-RRRVDPKNVASIILGGGAGTQLFPLTKRSATPAVPVGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  117  CYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>gb|AAD56042.1|AF184598_1 ADP-glucose pyrophosphorylase large subunit [Citrus unshiu]
Length=531

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 125/166 (75%), Gaps = 13/166 (8%)
 Frame = +1

Query  244  CATLKSSAHLPRETGF---------FGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            C  L+++ H+ + + +         +G +IRGSV N+    Q +KSLK E+   K+KPGV
Sbjct  5    CVGLRANTHVVKASKYGSKIGDNALWGERIRGSVRNDGCTKQLKKSLKAEKRDEKVKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A++++T ++  E +T+  P LERRR +PKNVAAIILGGGAGT+LFPLT RAATPAVPV G
Sbjct  65   AYAIMTSKHPNEVMTLAPPRLERRRVDPKNVAAIILGGGAGTKLFPLTLRAATPAVPVSG  124

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIP    INSG+NKIFVLTQFNSASLNRHI+RTYFGNG +F
Sbjct  125  CYRLIDIP----INSGINKIFVLTQFNSASLNRHIARTYFGNGTNF  166



>ref|XP_010254773.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 129/168 (77%), Gaps = 11/168 (7%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CATLK++AH  +         + GF+G  +RGS+NN  +  +  KSL+ E   RKIK GV
Sbjct  5    CATLKANAHPVQVRKGLITNGDNGFWGECLRGSLNNGTMGTKLTKSLRTENGGRKIKTGV  64

Query  397  AFSVLTRENG-TETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            A+SV T  N    T T +AP+L ++ A+PKNVA+IILGGGAGT+LFPLT+R A PAVP+G
Sbjct  65   AYSVFTDVNKEVATQTFQAPLLGKQIADPKNVASIILGGGAGTRLFPLTSRRAKPAVPIG  124

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GCYRLID+PMSNCINSG+NKIF++TQFNSASLNRH++RTY FGNGV+F
Sbjct  125  GCYRLIDVPMSNCINSGINKIFIMTQFNSASLNRHLARTYNFGNGVNF  172



>ref|XP_009378638.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=523

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 122/167 (73%), Gaps = 14/167 (8%)
 Frame = +1

Query  235  MEFCATLKSSAHLPRETGF-------FGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            M+ C     + HL R +GF        G ++RGS +N +  NQ      L  +KRK+ PG
Sbjct  7    MDSCCVALKNTHLRRPSGFCNGGSGFLGERVRGSFSNRLWANQ------LRTDKRKVIPG  60

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
               +VLT ++  E LT++ P L RRR +PK+VA+IILGGGAGTQLFPLT R+A PAVPVG
Sbjct  61   AVLAVLTSKDA-EALTLQMPSLPRRRVDPKHVASIILGGGAGTQLFPLTIRSAIPAVPVG  119

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  120  GCYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  166



>ref|XP_008377280.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 124/169 (73%), Gaps = 16/169 (9%)
 Frame = +1

Query  235  MEFCATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            M+ C     + HL +       ++GF G ++RGS NN +  NQ      L   KRK+KPG
Sbjct  1    MDSCCVALKNTHLRKPSGFCNGDSGFLGERVRGSFNNRLWANQ------LRTGKRKVKPG  54

Query  394  VAFSVLTRENGTETLT--VEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVP  567
               +VLT ++ TE ++  ++ P L RRR +PKNVA+IILGGGAGTQLFPLT R+A PAVP
Sbjct  55   AVLAVLTSKD-TEAVSQALQMPSLPRRRVDPKNVASIILGGGAGTQLFPLTIRSAIPAVP  113

Query  568  VGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            VGGCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  114  VGGCYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>sp|Q00081.1|GLGL1_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1; AltName: Full=ADP-glucose pyrophosphorylase; AltName: 
Full=ADP-glucose synthase; AltName: Full=AGPase S; AltName: 
Full=Alpha-D-glucose-1-phosphate adenyl transferase, partial 
[Solanum tuberosum]
 emb|CAA43490.1| ADP-glucose pyrophosphorylase large subunit [Solanum tuberosum]
Length=470

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +1

Query  379  KIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATP  558
            KIKPGVA+SV+T EN T+T+ V+ P LERRRANPK+VAA+ILGGG GT+LFPLT+R ATP
Sbjct  2    KIKPGVAYSVITTENDTQTVFVDMPRLERRRANPKDVAAVILGGGEGTKLFPLTSRTATP  61

Query  559  AVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            AVPVGGCYRLIDIPMSNCINS +NKIFVLTQ+NSA LNRHI+RTYFGNGVSF
Sbjct  62   AVPVGGCYRLIDIPMSNCINSAINKIFVLTQYNSAPLNRHIARTYFGNGVSF  113



>ref|XP_008385898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385899.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 122/166 (73%), Gaps = 17/166 (10%)
 Frame = +1

Query  244  CATLKSSAHLPR-------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            C  LK + HL         + GF G  +RGS N+ +  NQ      L  +KRK+KPG   
Sbjct  5    CVALKPNTHLGNASGFCNGDPGFLGESVRGSSNHRLWANQ------LRTDKRKVKPGAIL  58

Query  403  SVLTRENGTETL--TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            +VLT  N TE +  T++ P+  RRR +PKNVA+IILGGGAGTQLFPLT R+ATPAVPVGG
Sbjct  59   AVLT-SNDTEAVSQTLQMPMF-RRRVDPKNVASIILGGGAGTQLFPLTKRSATPAVPVGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  117  CYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>ref|XP_007042146.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
 gb|EOX97977.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
Length=526

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +1

Query  301  KIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANP  480
            +IRGS+NN++ VNQ   SL+ ++ ++KIK G AF+VLT     E +T++   +ERRR +P
Sbjct  33   RIRGSLNNSLWVNQLANSLRTDKKEKKIKTG-AFAVLTSNTPREAVTLQPRRIERRRVDP  91

Query  481  KNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNS  660
            KNVA+IILGGG GT LFPLT RAATPAVPVGGCY+LIDIPMSNCINSG+NKIFVLTQFNS
Sbjct  92   KNVASIILGGGTGTHLFPLTKRAATPAVPVGGCYKLIDIPMSNCINSGINKIFVLTQFNS  151

Query  661  ASLNRHISRTYFGNGVSF  714
            ASLNRH++RTY+GNG++F
Sbjct  152  ASLNRHLARTYYGNGINF  169



>gb|KDO84616.1| hypothetical protein CISIN_1g015713mg [Citrus sinensis]
Length=348

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 9/169 (5%)
 Frame = +1

Query  235  MEFC--ATLKSSAHLP---RETGFFGGKIRGSVNNNVLVNQSR--KSLKLEE-NKRKIKP  390
            M+ C  A LK++AH     R TGF+GG ++GS+ +  L   SR  K+L+ E+ NK   KP
Sbjct  1    MDSCCAAALKANAHPAVSNRNTGFWGGSVKGSLKSWDLNFGSRVWKNLRTEKINKNVTKP  60

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            GVA+S+LT +   ET+T +AP+ E  +A+PKNVAAIILGGGAGT+LFPLTNR A PAVP+
Sbjct  61   GVAYSILTSDTNKETVTFQAPMFETPQADPKNVAAIILGGGAGTRLFPLTNRRAKPAVPI  120

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GG YRLIDIPMSNCINSG NKIF++TQFNS SLNRH++R+Y  GNGV+F
Sbjct  121  GGNYRLIDIPMSNCINSGFNKIFIMTQFNSFSLNRHLARSYNLGNGVNF  169



>ref|XP_004148834.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis sativus]
 ref|XP_004172290.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis sativus]
 gb|KGN61813.1| hypothetical protein Csa_2G248700 [Cucumis sativus]
Length=526

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 123/170 (72%), Gaps = 14/170 (8%)
 Frame = +1

Query  235  MEFC-ATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKI  384
            M+ C  +LKS   L +         E  FFG K+RG  + NV +    +SLK E+   K+
Sbjct  4    MDSCFVSLKSDTQLMKGNWGGFDRCENRFFGEKVRGGFSENVWI----RSLKSEKKALKL  59

Query  385  KPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
             P V ++V T     + +T++ P + + +ANPKNVA+IILGGGAGT LFPLT R+ATPAV
Sbjct  60   TPNVTYAVATPNVSKQPMTIQVPTVPKVKANPKNVASIILGGGAGTHLFPLTKRSATPAV  119

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PVGGCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNGV+F
Sbjct  120  PVGGCYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGVTF  169



>gb|KDO84615.1| hypothetical protein CISIN_1g015713mg [Citrus sinensis]
Length=402

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 9/169 (5%)
 Frame = +1

Query  235  MEFC--ATLKSSAHLP---RETGFFGGKIRGSVNNNVLVNQSR--KSLKLEE-NKRKIKP  390
            M+ C  A LK++AH     R TGF+GG ++GS+ +  L   SR  K+L+ E+ NK   KP
Sbjct  1    MDSCCAAALKANAHPAVSNRNTGFWGGSVKGSLKSWDLNFGSRVWKNLRTEKINKNVTKP  60

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            GVA+S+LT +   ET+T +AP+ E  +A+PKNVAAIILGGGAGT+LFPLTNR A PAVP+
Sbjct  61   GVAYSILTSDTNKETVTFQAPMFETPQADPKNVAAIILGGGAGTRLFPLTNRRAKPAVPI  120

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GG YRLIDIPMSNCINSG NKIF++TQFNS SLNRH++R+Y  GNGV+F
Sbjct  121  GGNYRLIDIPMSNCINSGFNKIFIMTQFNSFSLNRHLARSYNLGNGVNF  169



>ref|XP_006282507.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
 gb|EOA15405.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
Length=521

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 114/145 (79%), Gaps = 4/145 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E+ F G KI+GSV      + + K L+     RK+ PGVA+++ T +N  E L V+  + 
Sbjct  24   ESKFLGEKIKGSVLKPFSSDLASKKLR----NRKMNPGVAYAIATSKNAKEALKVQPSMF  79

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ERRRA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  80   ERRRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKIF  139

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  140  VLTQFNSASLNRHLARTYFGNGINF  164



>ref|XP_004500804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=518

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 123/160 (77%), Gaps = 6/160 (4%)
 Frame = +1

Query  244  CATLKSSAHL--PRETGFFGGKIRGSVNNNVLV-NQSRKSLKLEENKRKIKPGVAFSVLT  414
            C TLK++ H    ++  FFG +I+GS NN+  V +Q  + L+    ++KIK G   ++LT
Sbjct  5    CVTLKANTHCIDSKKGSFFGDRIKGSFNNSSWVTDQLNQRLR---TQKKIKHGALSAILT  61

Query  415  RENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLID  594
             ++   +LT++ P   R RA+PKNV +I+LGGG GT L+PLT RAATPAVPVGGCYRLID
Sbjct  62   SDDPKGSLTLQVPSFMRVRADPKNVISIVLGGGPGTHLYPLTKRAATPAVPVGGCYRLID  121

Query  595  IPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNGV+F
Sbjct  122  IPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGVNF  161



>ref|NP_001284451.1| myeloid leukemia factor 1 [Cucumis melo]
 gb|AAB91463.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo]
Length=525

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 123/170 (72%), Gaps = 15/170 (9%)
 Frame = +1

Query  235  MEFC-ATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKI  384
            M+ C  +LKS+  L +         E GF   K+RG  N NV +    KSLK E+   K+
Sbjct  4    MDSCFVSLKSNTQLMKGNWGGLDRCENGFMVEKVRGGFNENVWI----KSLKYEKKALKL  59

Query  385  KPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
             P VA++V T     + +T++ P + + +ANPKNVA+IILGGGAGT LFPLT R+ATPAV
Sbjct  60   TPNVAYAV-TPNVSKQPMTIQVPTVPKVKANPKNVASIILGGGAGTHLFPLTKRSATPAV  118

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            P GGCYRLIDIPMSNCINSG+NKIFVLTQFNSASLNRHISRTYFGNGV+F
Sbjct  119  PAGGCYRLIDIPMSNCINSGINKIFVLTQFNSASLNRHISRTYFGNGVTF  168



>ref|XP_009378639.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378640.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378642.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378643.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
Length=519

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 121/168 (72%), Gaps = 14/168 (8%)
 Frame = +1

Query  235  MEFCATLKSSAHLPRETGF-------FGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            M+ C     + HL R +GF        G ++RGS +N +  NQ      L  +KRK+ PG
Sbjct  1    MDSCCVALKNTHLRRPSGFCNGGSGFLGERVRGSFSNRLWANQ------LRTDKRKVIPG  54

Query  394  VAFSVLTRENGTE-TLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
               +VLT ++    + T++ P L RRR +PK+VA+IILGGGAGTQLFPLT R+A PAVPV
Sbjct  55   AVLAVLTSKDAEALSQTLQMPSLPRRRVDPKHVASIILGGGAGTQLFPLTIRSAIPAVPV  114

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GGCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  115  GGCYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  162



>emb|CAB52196.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=450

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/93 (99%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = +1

Query  436  LTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCI  615
            LTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVP+GGCYRLIDIPMSNCI
Sbjct  1    LTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPLGGCYRLIDIPMSNCI  60

Query  616  NSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            NSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF
Sbjct  61   NSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  93



>ref|XP_009378637.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=525

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 121/168 (72%), Gaps = 14/168 (8%)
 Frame = +1

Query  235  MEFCATLKSSAHLPRETGF-------FGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            M+ C     + HL R +GF        G ++RGS +N +  NQ      L  +KRK+ PG
Sbjct  7    MDSCCVALKNTHLRRPSGFCNGGSGFLGERVRGSFSNRLWANQ------LRTDKRKVIPG  60

Query  394  VAFSVLTRENGTE-TLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
               +VLT ++    + T++ P L RRR +PK+VA+IILGGGAGTQLFPLT R+A PAVPV
Sbjct  61   AVLAVLTSKDAEALSQTLQMPSLPRRRVDPKHVASIILGGGAGTQLFPLTIRSAIPAVPV  120

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GGCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  121  GGCYRLIDIPMSNCINSNINKIFVLTQFNSASLNRHIARTYFGNGINF  168



>gb|KHF99865.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
 gb|KHG27467.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
Length=528

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 125/168 (74%), Gaps = 12/168 (7%)
 Frame = +1

Query  244  CATLKSSAHLP--RETGF-------FGGKIRGSVNNN-VLVNQSRKSLKLEENK-RKIKP  390
            C  LK ++HL   R +GF        G +IRGS+NNN V VN+   SL     K  KIKP
Sbjct  5    CVALKVNSHLVNVRNSGFGNGDNTFLGERIRGSLNNNSVWVNRVANSLSTYNKKAMKIKP  64

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            G AF+V+T  N  E  T+ +    R+R +PKNVA+IILGGGAGT LFPLT RAATPAVP+
Sbjct  65   G-AFAVITSNNPREAKTLPSRRFNRQRVDPKNVASIILGGGAGTHLFPLTRRAATPAVPI  123

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GGCY+LIDIPMSNCINSG+NKIFVLTQFNSASLNRH++RTY+GNG++F
Sbjct  124  GGCYKLIDIPMSNCINSGINKIFVLTQFNSASLNRHVARTYYGNGINF  171



>ref|XP_010437034.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+GS+      +   K L      RK++PGVA+++ T +N  E L V+  + 
Sbjct  25   ENKFWGEKIKGSLLKPFSSDLGSKKL----GNRKLRPGVAYAIATSKNAKEALKVQPSMF  80

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ER+RA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  81   ERKRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKIF  140

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  141  VLTQFNSASLNRHLARTYFGNGINF  165



>ref|NP_195632.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
 sp|P55231.2|GLGL3_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA77173.1| glucose-1-phosphate adenylyltransferase [Arabidopsis thaliana]
 emb|CAB43636.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 emb|CAB80584.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAL24344.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAQ56821.1| At4g39210 [Arabidopsis thaliana]
 gb|AEE87038.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
Length=521

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 4/145 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F G KI+GSV      + S K  +     RK++PGVA+++ T +N  E L  +  + 
Sbjct  24   ENKFLGEKIKGSVLKPFSSDLSSKKFR----NRKLRPGVAYAIATSKNAKEALKNQPSMF  79

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ERRRA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  80   ERRRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKIF  139

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  140  VLTQFNSASLNRHLARTYFGNGINF  164



>ref|XP_010263606.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 128/169 (76%), Gaps = 13/169 (8%)
 Frame = +1

Query  244  CATLKSSAHLPRET----------GFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            CATL  +AH P +            F+G ++RGS+ N V+  +  KSL+ +    KIK G
Sbjct  5    CATLNPNAH-PVQVRKGLITDGNNAFWGERLRGSLKNGVMRTKLAKSLRADNGGGKIKTG  63

Query  394  VAFSVLTR-ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            VAFSVLT   N T T T++AP+L R+ A+PKNVA+IILGGGAGT+LFPLT+R A PAVP+
Sbjct  64   VAFSVLTDVNNDTVTETIQAPLLGRQIADPKNVASIILGGGAGTRLFPLTSRRAKPAVPI  123

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GGCYRLID+P SNCINSG++KIF++TQFNSASLNRH++RTY FGNGV+F
Sbjct  124  GGCYRLIDVPTSNCINSGLDKIFIMTQFNSASLNRHLARTYNFGNGVNF  172



>ref|XP_006411722.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
 dbj|BAJ34261.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53175.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
Length=521

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 123/168 (73%), Gaps = 12/168 (7%)
 Frame = +1

Query  235  MEFCA--TLKSSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP  390
            M+ C   +L ++  LP+      E  F+G KI+GS       + S K    +   R+ KP
Sbjct  1    MDSCCYFSLGTNTFLPKDSLTNVENKFWGEKIKGSFLKPFASDSSSK----KSRNRQRKP  56

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            GVA+++ T +N  E LT++  + ERR+A+PKNVAAIILGGG G +LFPLT RAATPAVPV
Sbjct  57   GVAYAIATSKNAKEALTIQRSMFERRKADPKNVAAIILGGGNGAKLFPLTKRAATPAVPV  116

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GGCYR+IDIPMSNCINS +NKIFVLTQFNSASLNRH++RTYFGNG++F
Sbjct  117  GGCYRMIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTYFGNGINF  164



>ref|XP_002866835.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43094.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 4/145 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F G KI+GSV N    + S K  +     RK++ GVA+++ T +N  E L  +  + 
Sbjct  24   ENKFLGEKIKGSVLNPFSSDLSSKKFR----NRKLRSGVAYAIATSKNAKEALKNQPSMF  79

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ERRRA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  80   ERRRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSSINKIF  139

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  140  VLTQFNSASLNRHLARTYFGNGINF  164



>ref|XP_010431888.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431889.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431890.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
Length=522

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+GS+      +   K  +     RK++PGVA+++ T +N  E L V+  + 
Sbjct  25   ENKFWGEKIKGSLLKPFSSDLGSKKFR----NRKLRPGVAYAIATSKNAKEALKVQPSMF  80

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ER+RA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  81   ERKRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKIF  140

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  141  VLTQFNSASLNRHLARTYFGNGINF  165



>gb|KJB79161.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79162.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79163.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
Length=528

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 122/168 (73%), Gaps = 12/168 (7%)
 Frame = +1

Query  244  CATLKSSAHLPR---------ETGFFGGKIRGSVNNN-VLVNQSRKSLKLEENK-RKIKP  390
            C  LK ++HL           +  F G +IRGS+NNN V VN+   SL     K  KIKP
Sbjct  5    CVALKVNSHLVNVRNSGFGNGDNAFLGERIRGSLNNNSVWVNRVANSLSTYNKKAMKIKP  64

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            G AF+V+T  N  E   + +    R+R +PKNVA+IILGGGAGT LFPLT RAATPAVP+
Sbjct  65   G-AFAVITSNNPREAKALPSRRFNRQRVDPKNVASIILGGGAGTHLFPLTRRAATPAVPI  123

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GGCY+LIDIPMSNCINSG+NKIFVLTQFNSASLNRH++RTY+GNG++F
Sbjct  124  GGCYKLIDIPMSNCINSGINKIFVLTQFNSASLNRHVARTYYGNGINF  171



>emb|CAA65541.1| ADP-glucose pyrophosphorylase [Pisum sativum]
Length=510

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 118/159 (74%), Gaps = 12/159 (8%)
 Frame = +1

Query  244  CATLKSSAHLP--RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTR  417
            C +LK++ H P  ++  FFG +I+GS+ N+  V            ++KIKP    ++LT 
Sbjct  5    CVSLKTNTHFPNSKKGSFFGERIKGSLKNSSWVT----------TQKKIKPASFSAILTS  54

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
            ++   +L ++ P   R RA+PKNV +I+LGGG GT L+PLT RAATPAVPVGGCYRLIDI
Sbjct  55   DDPKGSLNLQVPSFLRLRADPKNVISIVLGGGPGTHLYPLTKRAATPAVPVGGCYRLIDI  114

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            PMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNGV+F
Sbjct  115  PMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGVNF  153



>ref|XP_007136159.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 ref|XP_007136160.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08153.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08154.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
Length=525

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 122/164 (74%), Gaps = 11/164 (7%)
 Frame = +1

Query  250  TLKSSAHLP---------RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            TLK++AHL          +E+ F G +++   NN+  V  + +  +   +++++  GVA 
Sbjct  7    TLKANAHLANSEKGHLFRQESSFLGERVKVGPNNSAFV--TNQLARCSRSQKRVNHGVAS  64

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            ++LT  +  E+L+++ P   RRR +PKNV +IILGGG G QLFPLT RAATPAVPVGGCY
Sbjct  65   AILTSNDAKESLSLQVPSFMRRRVDPKNVVSIILGGGPGKQLFPLTQRAATPAVPVGGCY  124

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  125  RLIDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  168



>dbj|BAC66692.1| ADP-glucose pyrophosphorylase large subunit PvAGPL1 [Phaseolus 
vulgaris]
Length=525

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 122/164 (74%), Gaps = 11/164 (7%)
 Frame = +1

Query  250  TLKSSAHLP---------RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
            TLK++AHL          +E+ F G +++   NN+  V  + +  +   +++++  GVA 
Sbjct  7    TLKANAHLANSEKGHLFRQESSFLGERVKVGPNNSAFV--TNQLARCSRSQKRVNHGVAS  64

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            ++LT  +  E+L+++ P   RRR +PKNV +IILGGG G QLFPLT RAATPAVPVGGCY
Sbjct  65   AILTSNDAKESLSLQVPSFMRRRVDPKNVVSIILGGGPGKQLFPLTQRAATPAVPVGGCY  124

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            RLIDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  125  RLIDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  168



>ref|XP_010431887.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Camelina sativa]
Length=534

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+GS+      +   K  +     RK++PGVA+++ T +N  E L V+  + 
Sbjct  37   ENKFWGEKIKGSLLKPFSSDLGSKKFR----NRKLRPGVAYAIATSKNAKEALKVQPSMF  92

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ER+RA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  93   ERKRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKIF  152

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  153  VLTQFNSASLNRHLARTYFGNGINF  177



>ref|XP_006435035.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
 gb|ESR48275.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
Length=526

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 129/169 (76%), Gaps = 9/169 (5%)
 Frame = +1

Query  235  MEFC--ATLKSSAHLP---RETGFFGGKIRGSVNNNVLVNQSR--KSLKLEE-NKRKIKP  390
            M+ C  A LK++AH     R TGF+GG ++GS+ +  L   SR  K+L+ E+ NK   KP
Sbjct  1    MDSCCAAALKANAHPAVSNRNTGFWGGSVKGSLKSGDLNFGSRVWKNLRTEKINKNVTKP  60

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            GV +S+LT +   ET+T +AP+ E  +A+PKNVAAIILGGGAGT+LFPLTNR A PAVP+
Sbjct  61   GVGYSILTSDTNKETVTFQAPMFETPQADPKNVAAIILGGGAGTRLFPLTNRRAKPAVPI  120

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GG YRLIDIPMSNCINSG NKIF++TQFNS SLNRH++R+Y  GNGV+F
Sbjct  121  GGNYRLIDIPMSNCINSGFNKIFIMTQFNSFSLNRHLARSYNLGNGVNF  169



>ref|XP_010446453.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446454.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446456.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446457.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
Length=522

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 112/145 (77%), Gaps = 4/145 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+GS+      +   K  +     RK++ GVA+++ T  N  E L V++ + 
Sbjct  25   ENNFWGEKIKGSLLKPFSSDLCSKKFR----NRKLRSGVAYAIATSNNAKEALKVQSSMF  80

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ER+RA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  81   ERKRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKIF  140

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  141  VLTQFNSASLNRHLARTYFGNGINF  165



>emb|CDY56761.1| BnaA06g40730D [Brassica napus]
Length=595

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+GS +     + S K L+  ++ R   PGVA++V T +N  E L ++  +L
Sbjct  96   ENSFWGEKIKGSFSKPFASDSSSKELRYRKSPR---PGVAYAVATSKNAKEALRLQPSML  152

Query  460  -ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
             ERR+A+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKI
Sbjct  153  GERRKADPKNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKI  212

Query  637  FVLTQFNSASLNRHISRTYFGNGVSF  714
            FVLTQFNSASLNRH++RTYFGNG++F
Sbjct  213  FVLTQFNSASLNRHLARTYFGNGINF  238



>ref|XP_006473534.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Citrus sinensis]
Length=526

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 130/169 (77%), Gaps = 9/169 (5%)
 Frame = +1

Query  235  MEFC--ATLKSSAHLP---RETGFFGGKIRGSVNNNVLVNQSR--KSLKLEE-NKRKIKP  390
            M+ C  A LK++A+     R TGF+GG ++GS+ +  L   SR  K+L+ E+ NK   KP
Sbjct  1    MDSCCAAALKANANPAVSNRNTGFWGGCVKGSLKSWDLNFGSRVWKNLRTEKINKNVTKP  60

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            GVA+S+LT +   ET+T +AP+ E  +A+PKNVAAIILGGGAGT+LFPLTNR A PAVP+
Sbjct  61   GVAYSILTSDTNKETVTFQAPMFETPQADPKNVAAIILGGGAGTRLFPLTNRRAKPAVPI  120

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GG YRLIDIPMSNCINSG NKIF++TQFNS SLNRH++R+Y  GNGV+F
Sbjct  121  GGNYRLIDIPMSNCINSGFNKIFIMTQFNSFSLNRHLARSYNLGNGVNF  169



>gb|AFO84073.1| ADP glucose pyrophosphorylase [Actinidia deliciosa]
Length=520

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 121/164 (74%), Gaps = 14/164 (9%)
 Frame = +1

Query  244  CATLKSS---AHLPRE-TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVL  411
            CA+LK+    AH+ RE T F+G +I+GS+ + +L NQ  KSLK        KPGVAFSVL
Sbjct  7    CASLKTHVHPAHVSREDTWFWGERIKGSLKSKILGNQFPKSLKS-------KPGVAFSVL  59

Query  412  TR--ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            T   +   E LT E P  E      KNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYR
Sbjct  60   TTSPDIDKEVLTFEPPTFEPETVEAKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYR  119

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            LID+PMSNCINSG+ KIF+LTQFNS SLNRHISRTY FGNG++F
Sbjct  120  LIDVPMSNCINSGIRKIFILTQFNSFSLNRHISRTYNFGNGINF  163



>emb|CDX72711.1| BnaC07g47330D [Brassica napus]
Length=632

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 113/146 (77%), Gaps = 4/146 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+GS +     + S K     ++ R   PGVA++V T +N  E L +E  +L
Sbjct  133  ENRFWGEKIKGSFSKPFASDSSSKEFSFRKSSR---PGVAYAVATSKNTKEALRLEPSML  189

Query  460  -ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
             ERR+A+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKI
Sbjct  190  GERRKADPKNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKI  249

Query  637  FVLTQFNSASLNRHISRTYFGNGVSF  714
            FVLTQFNSASLNRH++RTYFGNG++F
Sbjct  250  FVLTQFNSASLNRHLARTYFGNGINF  275



>gb|AES74194.2| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=518

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 120/162 (74%), Gaps = 10/162 (6%)
 Frame = +1

Query  244  CATLKSSAH--LPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEE---NKRKIKPGVAFSV  408
            C T+K + H  + ++  FFG +I+GS +N+  V       +L E   N++KIK     ++
Sbjct  5    CLTIKPNTHFSISKKGSFFGERIKGSFHNSSWVTD-----QLNERFTNQKKIKHVAVSAI  59

Query  409  LTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRL  588
            LT ++   +L ++ P   R RA+PKNV +I+LGGG GT L+PLT RAATPAVPVGGCYRL
Sbjct  60   LTSDDPKGSLNLQVPSFMRLRADPKNVISIVLGGGPGTHLYPLTKRAATPAVPVGGCYRL  119

Query  589  IDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  120  IDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  161



>ref|XP_003603943.1| Glucose-1-phosphate adenylyltransferase large subunit [Medicago 
truncatula]
Length=526

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 120/162 (74%), Gaps = 10/162 (6%)
 Frame = +1

Query  244  CATLKSSAH--LPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEE---NKRKIKPGVAFSV  408
            C T+K + H  + ++  FFG +I+GS +N+  V       +L E   N++KIK     ++
Sbjct  5    CLTIKPNTHFSISKKGSFFGERIKGSFHNSSWVTD-----QLNERFTNQKKIKHVAVSAI  59

Query  409  LTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRL  588
            LT ++   +L ++ P   R RA+PKNV +I+LGGG GT L+PLT RAATPAVPVGGCYRL
Sbjct  60   LTSDDPKGSLNLQVPSFMRLRADPKNVISIVLGGGPGTHLYPLTKRAATPAVPVGGCYRL  119

Query  589  IDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            IDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  120  IDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGINF  161



>ref|XP_006386208.1| hypothetical protein POPTR_0002s03480g [Populus trichocarpa]
 gb|ERP64005.1| hypothetical protein POPTR_0002s03480g [Populus trichocarpa]
Length=301

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            T F+G  ++ ++ +     Q RK+L+     +KIKPGVA+S+LT +   ET+  EAP+ E
Sbjct  29   TIFWGENLKKNLKSWDSRAQLRKNLR--SGVKKIKPGVAYSLLTSDVNEETVIFEAPVFE  86

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +A+P NVA+IILGGGAGT+LFPLT+R A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  87   TPQADPSNVASIILGGGAGTRLFPLTSRRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  146

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FGNGVSF
Sbjct  147  LTQFNSFSLNRHLARTYNFGNGVSF  171



>ref|XP_010437035.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X2 [Camelina sativa]
Length=519

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 111/145 (77%), Gaps = 7/145 (5%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+GS+      +   K L      RK++PGVA+++ T +N  E L     + 
Sbjct  25   ENKFWGEKIKGSLLKPFSSDLGSKKL----GNRKLRPGVAYAIATSKNAKEAL---PSMF  77

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            ER+RA+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKIF
Sbjct  78   ERKRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKIF  137

Query  640  VLTQFNSASLNRHISRTYFGNGVSF  714
            VLTQFNSASLNRH++RTYFGNG++F
Sbjct  138  VLTQFNSASLNRHLARTYFGNGINF  162



>ref|XP_009617843.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
 ref|XP_009617844.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
Length=529

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 121/169 (72%), Gaps = 11/169 (7%)
 Frame = +1

Query  241  FCATLKSSAHLP--------RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            FCA +K +A           ++  F+G KI G + N     +S KS + EE  RK+K GV
Sbjct  4    FCANMKGTAQSVAITRGISNQDNSFWGDKISGRLINKGFGFRSCKSFRTEERGRKVKSGV  63

Query  397  AFSVLTRENGTETLTVEAPILERR--RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            AFSVLTR+   E ++ +  I E    +A+PK VA++ILGGGAGT+LFPLT+R A PAVP+
Sbjct  64   AFSVLTRDINKELVSFDESIFEEEHPKADPKTVASVILGGGAGTRLFPLTSRRAKPAVPI  123

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GGCYRLID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FGNGV+F
Sbjct  124  GGCYRLIDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGNGVNF  172



>ref|XP_008220833.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X2 [Prunus mume]
Length=424

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            +GF+G  +R  + +  L  Q  KS K E   RK+KPGVA S+LT  N  +++T ++P+ E
Sbjct  27   SGFWGESVRVGLKSRDLSAQLLKSSKFESGARKLKPGVAHSILTDIN-QDSVTFQSPLFE  85

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  86   TPKADPKNVASIILGGGAGTRLFPLTSQRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  145

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FG+G++F
Sbjct  146  LTQFNSFSLNRHLARTYNFGDGMNF  170



>gb|KHG23571.1| Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic 
-like protein [Gossypium arboreum]
Length=526

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 109/142 (77%), Gaps = 4/142 (3%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F G + RGSV  N L N  R   K E    KIK GV F+VLT     E +T++    ER 
Sbjct  32   FLGERTRGSVWFNQLSNTLRGDDKKEN---KIKSGV-FAVLTSNTPREAVTLKPRRFERP  87

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            R +PKNVA+IILGGGAGT LFPLT RAATPAVPVGGCY+LIDIPMSNCINSG+NKIFVLT
Sbjct  88   RVDPKNVASIILGGGAGTHLFPLTKRAATPAVPVGGCYKLIDIPMSNCINSGINKIFVLT  147

Query  649  QFNSASLNRHISRTYFGNGVSF  714
            QFNSASLNRH++RTY+GNG+SF
Sbjct  148  QFNSASLNRHLARTYYGNGISF  169



>ref|XP_007222521.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
 gb|EMJ23720.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
Length=527

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 124/167 (74%), Gaps = 11/167 (7%)
 Frame = +1

Query  244  CATLKSSAHLPRE---------TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CAT++++AH  +          +GF+G  +R  + +  L  Q  K  K E   RK+KPGV
Sbjct  5    CATMRANAHPIKVGKGGLRNQGSGFWGESVRVGLKSRDLSAQLLKISKFESRARKLKPGV  64

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A S+LT  N  +++T ++P+ E  +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GG
Sbjct  65   AHSILTDIN-QDSVTFQSPLFETPKADPKNVASIILGGGAGTRLFPLTSQRAKPAVPIGG  123

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH++RTY FG+G++F
Sbjct  124  CYRLIDIPMSNCINSGIKKIFILTQFNSFSLNRHLARTYNFGDGMNF  170



>ref|XP_007017591.1| Glucose-1-phosphate adenylyltransferase large subunit isoform 
2 [Theobroma cacao]
 gb|EOY14816.1| Glucose-1-phosphate adenylyltransferase large subunit isoform 
2 [Theobroma cacao]
Length=401

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F+G  IRG + +  L  Q  KSL+  +  +  KPGVA+SVLT +   +TL  +AP+ E  
Sbjct  28   FWGESIRGGLKSRDLGAQLWKSLRAAKGVKNAKPGVAYSVLTPDIDKKTL-FQAPVFETP  86

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLID+PMSNCINSG+ KIF+LT
Sbjct  87   QADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDVPMSNCINSGIKKIFILT  146

Query  649  QFNSASLNRHISRTY-FGNGVSF  714
            QFNS SLNRH++RTY FGNGV+F
Sbjct  147  QFNSFSLNRHLARTYNFGNGVNF  169



>ref|XP_009416548.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=529

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = +1

Query  277  RETGFFGGKI-RGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAP  453
            RE+G +G  I  G     V  ++  KSLK   +    K GVAFSVLT +   ET+   AP
Sbjct  25   RESGIWGDGIGNGPKTTKVWDSKVAKSLKTRSSFGGRKTGVAFSVLTSDVDQETMVFHAP  84

Query  454  ILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNK  633
            +  RR A+PK+VA+IILGGGAGTQL PLT+  ATPAVP+GGCYRLIDIPMSNCINSG+NK
Sbjct  85   MFGRRTADPKSVASIILGGGAGTQLVPLTSTRATPAVPIGGCYRLIDIPMSNCINSGINK  144

Query  634  IFVLTQFNSASLNRHISRTY-FGNGVSF  714
            IF++TQFNSASLNRHISRTY FGNG++F
Sbjct  145  IFIMTQFNSASLNRHISRTYNFGNGINF  172



>gb|AAS00542.1| ADP-glucose pyrophosphorylase large subunit [Fragaria x ananassa]
Length=507

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 115/167 (69%), Gaps = 21/167 (13%)
 Frame = +1

Query  241  FCATLKSSAHLPRET---------GFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            +C TLK + HL + T         GF G +IR S  N   V+ S K+          +PG
Sbjct  4    WCVTLKPNTHLRQPTQAGLCCGANGFLGQRIRESFGNRGWVHGSEKT----------RPG  53

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            V  SV+T ++   TL V  P   R R +PKNVA+IILGGGA TQLFPLT RAATPAVPVG
Sbjct  54   VVSSVVTTKDFETTLKV--PTYHRPRVDPKNVASIILGGGAFTQLFPLTRRAATPAVPVG  111

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCYRLIDIPMSNCINS +NKIFVLTQFNS SLNRH++RTYFGNG++F
Sbjct  112  GCYRLIDIPMSNCINSNINKIFVLTQFNSTSLNRHLARTYFGNGINF  158



>ref|XP_009101891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Brassica rapa]
Length=529

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+G+ + +   + S K L+    ++ + PGVA++V T +N  E L ++  +L
Sbjct  30   ENKFWGEKIKGNFSKSFASDSSSKELRY---RKSLNPGVAYAVATSKNAKEALRLQPSML  86

Query  460  -ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
             ERR+A+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKI
Sbjct  87   GERRKADPKNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKI  146

Query  637  FVLTQFNSASLNRHISRTYFGNGVSF  714
            FVLTQFNSASLNRH++RTYFGNG++F
Sbjct  147  FVLTQFNSASLNRHLARTYFGNGINF  172



>ref|XP_009101892.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Brassica rapa]
Length=523

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            E  F+G KI+G+ + +   + S K L+    ++ + PGVA++V T +N  E L ++  +L
Sbjct  24   ENKFWGEKIKGNFSKSFASDSSSKELRY---RKSLNPGVAYAVATSKNAKEALRLQPSML  80

Query  460  -ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
             ERR+A+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYR+IDIPMSNCINS +NKI
Sbjct  81   GERRKADPKNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRMIDIPMSNCINSCINKI  140

Query  637  FVLTQFNSASLNRHISRTYFGNGVSF  714
            FVLTQFNSASLNRH++RTYFGNG++F
Sbjct  141  FVLTQFNSASLNRHLARTYFGNGINF  166



>emb|CDP07489.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 121/169 (72%), Gaps = 12/169 (7%)
 Frame = +1

Query  244  CATLKSSAHLPR--------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE--NKRKIKPG  393
            CAT+K++AH  +        ++GF G KI+GS+ +        +SLK       +KIKPG
Sbjct  5    CATMKANAHPSQIRRAFGYGDSGFLGKKIKGSLKSKASGTNFCRSLKSTSVNGAKKIKPG  64

Query  394  VAFSVLTRENGTETLTVEAPIL-ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            VAFS+ T++   E +  EAP+  E    +PK VAAI+LGGGAGT+LFPLT++ A PAVP+
Sbjct  65   VAFSIFTQDIDQEIMQFEAPVFDESSTVDPKTVAAIVLGGGAGTRLFPLTSKRAKPAVPI  124

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GGCYRLID+PMSNCINSG+ KIF+LTQFNS SLNRH++R Y FGNGV+F
Sbjct  125  GGCYRLIDVPMSNCINSGIRKIFILTQFNSFSLNRHLARMYNFGNGVNF  173



>ref|XP_009759775.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759780.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759785.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759792.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
Length=529

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 121/169 (72%), Gaps = 11/169 (7%)
 Frame = +1

Query  241  FCATLKSSAHLP--------RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            FCA +K +A           + + F+G KI G + N     +S KS + EE  RK+K GV
Sbjct  4    FCANMKGTAQSVAISRGISNQGSSFWGNKISGRLINKGFGVRSCKSFRTEERGRKVKSGV  63

Query  397  AFSVLTRENGTETLTVEAPIL--ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            AFSVLTR+   E ++ +  I   E  +A+PK VA++ILGGGAGT+LFPLT+R A PAVP+
Sbjct  64   AFSVLTRDINKELVSFDESIFGEEHPKADPKTVASVILGGGAGTRLFPLTSRRAKPAVPI  123

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GGCYRLID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FGNGV+F
Sbjct  124  GGCYRLIDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGNGVNF  172



>ref|XP_008220832.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Prunus mume]
Length=527

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            +GF+G  +R  + +  L  Q  KS K E   RK+KPGVA S+LT  N  +++T ++P+ E
Sbjct  27   SGFWGESVRVGLKSRDLSAQLLKSSKFESGARKLKPGVAHSILTDIN-QDSVTFQSPLFE  85

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  86   TPKADPKNVASIILGGGAGTRLFPLTSQRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  145

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FG+G++F
Sbjct  146  LTQFNSFSLNRHLARTYNFGDGMNF  170



>gb|KJB58232.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58233.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58234.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
Length=526

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 111/145 (77%), Gaps = 4/145 (3%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            T F+G  IRG  +      Q  KSL+ E   +K KPGVA+SV+T E   ET+  E P  E
Sbjct  28   TVFWGETIRGGRD---FGTQLWKSLRAENGVKKAKPGVAYSVITPEINKETMKFETPKFE  84

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  85   APQADPKNVASIILGGGAGTRLFPLTSQRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  144

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FGNGV+F
Sbjct  145  LTQFNSFSLNRHLARTYNFGNGVNF  169



>ref|XP_004289659.1| PREDICTED: LOW QUALITY PROTEIN: glucose-1-phosphate adenylyltransferase 
large subunit 1-like [Fragaria vesca subsp. vesca]
Length=507

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 115/167 (69%), Gaps = 21/167 (13%)
 Frame = +1

Query  241  FCATLKSSAHLPRET---------GFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            +C TLK ++H  + T         GF G +IR S+ N       R  L+  E KR   P 
Sbjct  4    WCVTLKPNSHFRQPTQAGLCSGANGFLGERIRESLGN-------RGWLRRTEKKR---PS  53

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            V  SV+T ++    L V  P   R R +PKNVA+IILGGGAGTQLFPLT RAATPAVPVG
Sbjct  54   VVRSVVTSKDFETILKV--PTYHRLRVDPKNVASIILGGGAGTQLFPLTRRAATPAVPVG  111

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GCYRLIDIPMSNCINS +NKIFVLTQFNS SLNRH++RTYFGNG++F
Sbjct  112  GCYRLIDIPMSNCINSNINKIFVLTQFNSTSLNRHLARTYFGNGINF  158



>gb|KJB32479.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
 gb|KJB32480.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=524

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F G + RGSV  N L N  R   K E    KIK GV+ +VLT +   E +T++    ER 
Sbjct  30   FLGERTRGSVWFNQLSNTLRGDDKKEN---KIKSGVS-AVLTSDTPREAVTLKPRRFERP  85

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            R +PKNVA+IILGGGAGT+LFPLT RAATPAVPVGGCY+LIDIPMSNCINSG+NKIFVLT
Sbjct  86   RVDPKNVASIILGGGAGTRLFPLTKRAATPAVPVGGCYKLIDIPMSNCINSGINKIFVLT  145

Query  649  QFNSASLNRHISRTYFGNGVSF  714
            QFNSASLNRH++RTY+GNG++F
Sbjct  146  QFNSASLNRHLARTYYGNGINF  167



>gb|KJB32482.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=521

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F G + RGSV  N L N  R   K E    KIK GV+ +VLT +   E +T++    ER 
Sbjct  30   FLGERTRGSVWFNQLSNTLRGDDKKEN---KIKSGVS-AVLTSDTPREAVTLKPRRFERP  85

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            R +PKNVA+IILGGGAGT+LFPLT RAATPAVPVGGCY+LIDIPMSNCINSG+NKIFVLT
Sbjct  86   RVDPKNVASIILGGGAGTRLFPLTKRAATPAVPVGGCYKLIDIPMSNCINSGINKIFVLT  145

Query  649  QFNSASLNRHISRTYFGNGVSF  714
            QFNSASLNRH++RTY+GNG++F
Sbjct  146  QFNSASLNRHLARTYYGNGINF  167



>ref|XP_010060971.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010060972.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW67874.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
 gb|KCW67875.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
Length=524

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +1

Query  349  KSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQL  528
            KSL+ E    ++KPG+A+SVLT E   ET+T++AP+LE  RA+PK+ A+IILGGGAGT+L
Sbjct  45   KSLRSETRIGRVKPGIAYSVLTPEVDKETMTLQAPVLETPRADPKSFASIILGGGAGTRL  104

Query  529  FPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNG  705
            FPLT+R A PAVP+GGCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH+SRTY F NG
Sbjct  105  FPLTSRRAKPAVPLGGCYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRTYNFDNG  164

Query  706  VSF  714
            VSF
Sbjct  165  VSF  167



>ref|XP_007017590.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
 gb|EOY14815.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
Length=526

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F+G  IRG + +  L  Q  KSL+  +  +  KPGVA+SVLT +   +TL  +AP+ E  
Sbjct  28   FWGESIRGGLKSRDLGAQLWKSLRAAKGVKNAKPGVAYSVLTPDIDKKTL-FQAPVFETP  86

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLID+PMSNCINSG+ KIF+LT
Sbjct  87   QADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDVPMSNCINSGIKKIFILT  146

Query  649  QFNSASLNRHISRTY-FGNGVSF  714
            QFNS SLNRH++RTY FGNGV+F
Sbjct  147  QFNSFSLNRHLARTYNFGNGVNF  169



>ref|XP_002300758.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
 gb|EEE80031.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
Length=528

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            T F+G  ++ ++ +     Q RK+L+     +KIKPGVA+S+LT +   ET+  EAP+ E
Sbjct  29   TIFWGENLKKNLKSWDSRAQLRKNLR--SGVKKIKPGVAYSLLTSDVNEETVIFEAPVFE  86

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +A+P NVA+IILGGGAGT+LFPLT+R A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  87   TPQADPSNVASIILGGGAGTRLFPLTSRRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  146

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FGNGVSF
Sbjct  147  LTQFNSFSLNRHLARTYNFGNGVSF  171



>ref|XP_011028874.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Populus euphratica]
Length=528

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 3/145 (2%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            T F+G  ++ ++ +     Q RK+L+     +KIKPGVA+S+LT +   ET+  EAP+ E
Sbjct  29   TIFWGENLKKNLKSWDSRAQLRKNLR--SGVKKIKPGVAYSLLTSDVNEETVIFEAPVFE  86

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +A+P NVA+IILGGGAGT+LFPLT+R A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  87   TPQADPSNVASIILGGGAGTRLFPLTSRRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  146

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FGNGVSF
Sbjct  147  LTQFNSFSLNRHLARTYNFGNGVSF  171



>ref|XP_011007451.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Populus euphratica]
Length=518

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            T F+G +I+ +  +  L     K+++     +K KPGVA+SVLT E   E +T EAP+ E
Sbjct  29   THFWGERIKKNPKSRALSALLWKNMR--SGVKKAKPGVAYSVLTSEVNKEIVTFEAPVFE  86

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
             ++A+P NVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  87   TQQADPGNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  146

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FGNGVSF
Sbjct  147  LTQFNSFSLNRHLARTYNFGNGVSF  171



>ref|XP_011007450.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Populus euphratica]
Length=528

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            T F+G +I+ +  +  L     K+++     +K KPGVA+SVLT E   E +T EAP+ E
Sbjct  29   THFWGERIKKNPKSRALSALLWKNMR--SGVKKAKPGVAYSVLTSEVNKEIVTFEAPVFE  86

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
             ++A+P NVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  87   TQQADPGNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  146

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRH++RTY FGNGVSF
Sbjct  147  LTQFNSFSLNRHLARTYNFGNGVSF  171



>ref|XP_008388042.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Malus domestica]
Length=512

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 10/159 (6%)
 Frame = +1

Query  244  CATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP-GVAFSVLTRE  420
            CATL       R  GF G  +R    +  L  Q  KS K E   RK+KP GVA+S+LT +
Sbjct  5    CATL-------RTNGFLGEGVRLGSKSRDLSAQFLKSSKFETRGRKLKPAGVAYSILT-D  56

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
               E +T +AP+ E  +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIP
Sbjct  57   VDNENVTFQAPLFETPKADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIP  116

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            MSNCINSG+ KIF+LTQ+NS SLNRH++RTY FG+G++F
Sbjct  117  MSNCINSGIQKIFILTQYNSFSLNRHLARTYNFGDGMNF  155



>ref|XP_004291856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Fragaria vesca subsp. vesca]
Length=521

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 124/168 (74%), Gaps = 19/168 (11%)
 Frame = +1

Query  244  CATLKSSAHLP---------RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CATLK++A LP         +  GF+G +I+   +N  L     KS+K E   RKIK GV
Sbjct  5    CATLKANA-LPVKVGGGLRNQSNGFWGERIKSRDSNTQLF----KSVKSE---RKIKSGV  56

Query  397  AFSVLTR-ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
              S+LT  E   + +T +AP+ E ++A+PKNVA+IILGGGAGT+LFPLT+R A PAVP+G
Sbjct  57   VHSILTSPELNQDNVTFQAPLFETQKADPKNVASIILGGGAGTRLFPLTSRRAKPAVPIG  116

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH++RTY FG+G++F
Sbjct  117  GCYRLIDIPMSNCINSGIKKIFILTQFNSFSLNRHLARTYNFGDGMNF  164



>ref|XP_009336061.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Pyrus x bretschneideri]
Length=512

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 10/159 (6%)
 Frame = +1

Query  244  CATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP-GVAFSVLTRE  420
            CATL       R  GF G  +R    +  L  Q  KS K E   RK+KP GVA+S+LT +
Sbjct  5    CATL-------RTNGFLGEGVRLGSKSRDLSAQFLKSSKFETRGRKLKPPGVAYSILT-D  56

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
               E +T +AP+ E  +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIP
Sbjct  57   VDNENVTFQAPLFETPKADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIP  116

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            MSNCINSG+ KIF+LTQ+NS SLNRH++RTY FG+G++F
Sbjct  117  MSNCINSGIKKIFILTQYNSFSLNRHLARTYNFGDGMNF  155



>gb|ACW82825.1| ADP-glucose pyrophosphorylase large subunit L1 isoform [Lens 
culinaris]
Length=510

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 13/163 (8%)
 Frame = +1

Query  235  MEFC-ATLKSSAHL--PRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFS  405
            M  C  +LK++ H    R+  FFG +  GS+ N+  V            +++IK     +
Sbjct  1    MASCFVSLKTNTHFLNSRKGSFFGERSNGSLKNSSWVTA----------QKRIKSAAFSA  50

Query  406  VLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            +LT ++   +L ++ P   R RA+PKNV +I+LGGG GT L+PLT RAATPAVPVGGCYR
Sbjct  51   ILTSDDPKGSLNLQVPSFLRLRADPKNVISIVLGGGPGTHLYPLTKRAATPAVPVGGCYR  110

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            LIDIPMSNCINSG+NKIFVLTQFNSASLNRHI+RTYFGNGV+F
Sbjct  111  LIDIPMSNCINSGINKIFVLTQFNSASLNRHIARTYFGNGVNF  153



>ref|XP_009365102.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 10/159 (6%)
 Frame = +1

Query  244  CATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP-GVAFSVLTRE  420
            CATL       R  GF G  +R    +  L  Q  KS K E   RK+KP GVA+S+LT +
Sbjct  5    CATL-------RTNGFLGEGVRLGSKSRDLSAQFLKSSKFETRGRKLKPPGVAYSILT-D  56

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
               E +T +AP+ E  +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIP
Sbjct  57   VDNENVTFQAPLFETPKADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIP  116

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            MSNCINSG+ KIF+LTQ+NS SLNRH++RTY FG+G++F
Sbjct  117  MSNCINSGIKKIFILTQYNSFSLNRHLARTYNFGDGMNF  155



>gb|KDP38538.1| hypothetical protein JCGZ_04463 [Jatropha curcas]
Length=527

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 111/146 (76%), Gaps = 7/146 (5%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENK---RKIKPGVAFSVLTRENGTETLTVEAPIL  459
            F+G  I+G   N    N + K+L+ E N    +K KPGVA+SV T +   ET T E P+L
Sbjct  28   FWGDWIKG---NRKSRNFNAKNLRTESNNNGIKKFKPGVAYSVFTSDVNKETATFETPVL  84

Query  460  ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIF  639
            E   A+PK VA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF
Sbjct  85   ETPTADPKKVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIKKIF  144

Query  640  VLTQFNSASLNRHISRTY-FGNGVSF  714
            +LTQFNS SLNRH++RTY FGNGV+F
Sbjct  145  ILTQFNSCSLNRHLARTYNFGNGVNF  170



>ref|XP_009365525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365526.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365527.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 10/159 (6%)
 Frame = +1

Query  244  CATLKSSAHLPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP-GVAFSVLTRE  420
            CATL       R  GF G  +R    +  L     KS K E   RK+KP GVA+S+ T  
Sbjct  5    CATL-------RANGFLGESVRLGSKSRDLSALFLKSSKFESRGRKLKPPGVAYSIFTDV  57

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
            N  E +T +AP+ E  RA+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIP
Sbjct  58   N-QEAVTFQAPLFETPRADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIP  116

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            MSNCINSG+ KIF+LTQ+NS SLNRH++RTY FG+G++F
Sbjct  117  MSNCINSGIKKIFILTQYNSFSLNRHLARTYNFGDGMNF  155



>ref|XP_011074558.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
 ref|XP_011074559.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
Length=529

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 3/149 (2%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R+ GF+G  ++    NN+L  Q  K    E+  RK KPGVAFSVLTR+   E   +E+ +
Sbjct  24   RDNGFWGDSVKRRSKNNLLGAQIWKKSLSEKRVRKFKPGVAFSVLTRDINKELAALESSL  83

Query  457  L--ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVN  630
               E  +A+PK VA+IILGGGAGT+L+PLT+R A PAVP+GGCYRLID+PMSNCINSG+ 
Sbjct  84   FLEENPKADPKTVASIILGGGAGTRLYPLTSRRAKPAVPIGGCYRLIDVPMSNCINSGIR  143

Query  631  KIFVLTQFNSASLNRHISRTY-FGNGVSF  714
             IF+LTQ+NS SLNRH++RTY FGNG++F
Sbjct  144  NIFILTQYNSFSLNRHLARTYNFGNGMNF  172



>ref|XP_002307668.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
 gb|EEE94664.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
Length=528

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 112/145 (77%), Gaps = 3/145 (2%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            T F+G +I+ +  +  L     K+L+     +K KPGVA+SVLT +   E +T EAP+ E
Sbjct  29   THFWGERIKKNPKSRDLSALLWKNLR--SGVKKAKPGVAYSVLTSDVNKEIVTFEAPVFE  86

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
             ++A+P NVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF+
Sbjct  87   TQQADPGNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIKKIFI  146

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            LTQFNS SLNRHI+RTY  GNGVSF
Sbjct  147  LTQFNSFSLNRHIARTYNLGNGVSF  171



>ref|XP_002510419.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF52606.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=523

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 118/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  244  CATLKSSAH---LPRETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKR--KIKPGVAFSV  408
            CA L+ +A+   + R T F G  I  S+       Q  K+L+ E  KR   +KP V +SV
Sbjct  5    CAALRVAANALDVNRGTPFCGESINRSLKAKKFSAQ-MKNLRTENGKRIKTVKPVVTYSV  63

Query  409  LTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRL  588
            LT +   ETLT + P+ E  RA+PK VA+IILGGGAGT+LFPLT++ A PAVP+GGCYRL
Sbjct  64   LTSDFNQETLTFDTPVFETPRADPKKVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRL  123

Query  589  IDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            IDIPMSNCINSG+ KIF++TQFNS SLNRH++RTY FGNGV+F
Sbjct  124  IDIPMSNCINSGIRKIFIMTQFNSFSLNRHLARTYNFGNGVNF  166



>ref|XP_010110050.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
 gb|EXC25068.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
Length=524

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 121/168 (72%), Gaps = 14/168 (8%)
 Frame = +1

Query  241  FCATLKSSAH---LPRET------GFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG  393
            +CATLK +     L RET       F+G  ++ S   ++  ++  KS+ L++   K KPG
Sbjct  4    YCATLKPNGQRIKLNRETLRNRSSVFWGESMKAS---SLKGSRDLKSINLQK-ILKTKPG  59

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            VA+S+LT +   E L  E+P  E  +A+PKNV +IILGGGAGT+LFPLT+R A PAVP+G
Sbjct  60   VAYSILTSDVEKEALKFESPTFETPKADPKNVVSIILGGGAGTRLFPLTSRRAKPAVPIG  119

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GCYRLIDIPMSNCINSG+ KIF++TQFNS SLNRH++RTY FG GV+F
Sbjct  120  GCYRLIDIPMSNCINSGIKKIFIMTQFNSFSLNRHLARTYNFGEGVNF  167



>ref|XP_006878500.1| hypothetical protein AMTR_s00011p00201790 [Amborella trichopoda]
 gb|ERM94645.1| hypothetical protein AMTR_s00011p00201790 [Amborella trichopoda]
Length=520

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 12/144 (8%)
 Frame = +1

Query  286  GFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILER  465
            GF G +++  +          KS+K      K K GVA+SVL  +   E +  +AP+ ER
Sbjct  31   GFSGAQLKKCI----------KSIKSRSLSPKFKMGVAYSVLA-DVDKEIMPFQAPMFER  79

Query  466  RRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVL  645
            + A+PK+V AIILGGGAGT+LFPLTNR A PAVP+GGCYRLID+PMSNCINSG+NKIF+L
Sbjct  80   QHADPKSVVAIILGGGAGTRLFPLTNRRAKPAVPIGGCYRLIDVPMSNCINSGINKIFIL  139

Query  646  TQFNSASLNRHISRTY-FGNGVSF  714
            TQFNSASLNRH++RTY FGNGV+F
Sbjct  140  TQFNSASLNRHLARTYNFGNGVNF  163



>ref|XP_004147856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Cucumis sativus]
 gb|KGN59984.1| hypothetical protein Csa_3G859710 [Cucumis sativus]
Length=532

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  376  RKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAAT  555
            RK+ PGVA+SVL  E   ET T++API E  RA+PK +A+IILGGGAGT+LFPLT++ A 
Sbjct  62   RKLAPGVAYSVLMSEINEETSTLQAPIFEAPRADPKKIASIILGGGAGTRLFPLTSQRAK  121

Query  556  PAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            PAVP+GGCYRLIDIPMSNCINSG+ KIFVLTQFNS SLNRH++R Y FGNGV+F
Sbjct  122  PAVPIGGCYRLIDIPMSNCINSGIEKIFVLTQFNSFSLNRHLARIYNFGNGVNF  175



>ref|XP_004154849.1| PREDICTED: LOW QUALITY PROTEIN: glucose-1-phosphate adenylyltransferase 
large subunit, chloroplastic/amyloplastic-like [Cucumis 
sativus]
Length=532

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  376  RKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAAT  555
            RK+ PGVA+SVL  E   ET T++API E  RA+PK +A+IILGGGAGT+LFPLT++ A 
Sbjct  62   RKLAPGVAYSVLMSEINEETSTLQAPIFEAPRADPKKIASIILGGGAGTRLFPLTSQRAK  121

Query  556  PAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            PAVP+GGCYRLIDIPMSNCINSG+ KIFVLTQFNS SLNRH++R Y FGNGV+F
Sbjct  122  PAVPIGGCYRLIDIPMSNCINSGIEKIFVLTQFNSFSLNRHLARIYNFGNGVNF  175



>ref|XP_006577992.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like isoform X2 [Glycine max]
Length=494

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 4/150 (3%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG--VAFSVLTRENGTETLTVE-  447
            R +GF+G   R SVN   L  QS K+ +   N R  KPG  +A +VLT +   +++  + 
Sbjct  24   RRSGFWGESTRRSVNTRFLSVQSWKTSRTSRNLRNSKPGSGIAHAVLTSDINEDSMAFQG  83

Query  448  APILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGV  627
             P  E+   +PK+VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLIDIPMSNCINSG+
Sbjct  84   VPTFEKPEVDPKSVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDIPMSNCINSGI  143

Query  628  NKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
             KIF+LTQFNS SLNRH+SR Y FGNG++F
Sbjct  144  RKIFILTQFNSFSLNRHLSRAYSFGNGITF  173



>ref|XP_010472156.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 109/152 (72%), Gaps = 10/152 (7%)
 Frame = +1

Query  259  SSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE-NKRKIKPGVAFSVLTR  417
            SS+ LP+      E  F+G KI    NNN  + + R     ++   RK K GV ++V T 
Sbjct  16   SSSILPKLSFKNVENRFWGDKIN---NNNGFLKRFRSDFGSKKFGNRKFKHGVVYAVATS  72

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
             N  E + V+  + ERR+A+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYRLIDI
Sbjct  73   NNPKEAMVVKPSMFERRKADPKNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRLIDI  132

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            PMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  133  PMSNCINSCINKIFVLTQFNSASLNRHLARTY  164



>ref|XP_008466540.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Cucumis melo]
 gb|ADN34184.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo subsp. 
melo]
Length=533

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  379  KIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATP  558
            K+ PGVA+SVL  E   ET T++API E  RA+PK VA+IILGGGAGT+LFPLT++ A P
Sbjct  64   KLAPGVAYSVLMSEVNEETTTLQAPIFEAPRADPKKVASIILGGGAGTRLFPLTSQRAKP  123

Query  559  AVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            AVP+GGCYRLIDIPMSNCINSG+ KIFVLTQFNS SLNRH++R Y FGNGV+F
Sbjct  124  AVPIGGCYRLIDIPMSNCINSGIEKIFVLTQFNSFSLNRHLARIYNFGNGVNF  176



>ref|XP_010472157.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 109/152 (72%), Gaps = 10/152 (7%)
 Frame = +1

Query  259  SSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE-NKRKIKPGVAFSVLTR  417
            SS+ LP+      E  F+G KI    NNN  + + R     ++   RK K GV ++V T 
Sbjct  12   SSSILPKLSFKNVENRFWGDKIN---NNNGFLKRFRSDFGSKKFGNRKFKHGVVYAVATS  68

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
             N  E + V+  + ERR+A+PKNVAAIILGGG G +LFPLT RAATPAVPVGGCYRLIDI
Sbjct  69   NNPKEAMVVKPSMFERRKADPKNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRLIDI  128

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            PMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  129  PMSNCINSCINKIFVLTQFNSASLNRHLARTY  160



>ref|XP_003523570.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like isoform X1 [Glycine max]
 gb|KHN45868.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=530

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 4/150 (3%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPG--VAFSVLTRENGTETLTVE-  447
            R +GF+G   R SVN   L  QS K+ +   N R  KPG  +A +VLT +   +++  + 
Sbjct  24   RRSGFWGESTRRSVNTRFLSVQSWKTSRTSRNLRNSKPGSGIAHAVLTSDINEDSMAFQG  83

Query  448  APILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGV  627
             P  E+   +PK+VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLIDIPMSNCINSG+
Sbjct  84   VPTFEKPEVDPKSVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDIPMSNCINSGI  143

Query  628  NKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
             KIF+LTQFNS SLNRH+SR Y FGNG++F
Sbjct  144  RKIFILTQFNSFSLNRHLSRAYSFGNGITF  173



>ref|XP_002281223.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 ref|XP_010664711.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 emb|CBI19730.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 117/167 (70%), Gaps = 14/167 (8%)
 Frame = +1

Query  244  CATLKSSAH-LPRE--------TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGV  396
            CA +K + H +P          +GF+G +I  S+ ++   N+  KSL+ E   + I    
Sbjct  5    CAKVKGNVHPVPVRNRGVGKVGSGFWGERIGTSLWSSSFSNRQWKSLRKERKAKTINR--  62

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
              +VLT +   E L  E P+ E++ A+P +VAAIILGGGAGT+LFPLT+R A PAVP+GG
Sbjct  63   --AVLTPDVDQENLIFEGPVFEKQHADPSSVAAIILGGGAGTRLFPLTSRRAKPAVPIGG  120

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CYRLID+PMSNCINSG+ KIF+LTQFNSASLNRHI+R Y FGNGV+F
Sbjct  121  CYRLIDVPMSNCINSGIRKIFILTQFNSASLNRHIARIYNFGNGVNF  167



>ref|XP_010429080.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
 ref|XP_010429081.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
Length=525

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 111/152 (73%), Gaps = 9/152 (6%)
 Frame = +1

Query  259  SSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE-NKRKIKPGVAFSVLTR  417
            SS+ LP+      E  F+G KI    NNN +  + R     ++   +K K GV ++V T 
Sbjct  12   SSSILPKLCFKNLENRFWGDKINN--NNNGVFKRFRSDFGSKKFGNQKFKHGVVYAVATS  69

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
             N  ET+TV+  + ERR+A+P+NVAAIILGGG G +LFPLT RAATPAVP+GGCYRLIDI
Sbjct  70   NNPKETMTVKPSMFERRKADPQNVAAIILGGGNGAKLFPLTKRAATPAVPLGGCYRLIDI  129

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            PMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  130  PMSNCINSCINKIFVLTQFNSASLNRHLARTY  161



>ref|XP_002878559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 109/151 (72%), Gaps = 12/151 (8%)
 Frame = +1

Query  259  SSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRE  420
            SS+ LP+      E  F+G KI    NNN    +S+  L  +   RK K  V ++V T  
Sbjct  12   SSSILPKLCFKNVEIRFWGEKI----NNNGFFKRSKSDL--DSKNRKFKRSVVYAVATSN  65

Query  421  NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIP  600
            N  + +TV+  + ERR+A+P+NVAAIILGGG G +LFPLT RAATPAVPVGGCYRLIDIP
Sbjct  66   NPKKAMTVKPSMFERRKADPQNVAAIILGGGNGAKLFPLTMRAATPAVPVGGCYRLIDIP  125

Query  601  MSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            MSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  126  MSNCINSCINKIFVLTQFNSASLNRHLARTY  156



>ref|XP_006294016.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
 gb|EOA26914.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
Length=523

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 109/152 (72%), Gaps = 11/152 (7%)
 Frame = +1

Query  259  SSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE-NKRKIKPGVAFSVLTR  417
            SS+ LP+      E  F G KI    NNN    + R  +  ++   RK K GV ++V T 
Sbjct  12   SSSILPKLCFKNAENRFLGEKI----NNNGFFKRFRSDVVSKKFGNRKFKHGVVYAVATS  67

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
             N  E +TV+  + ERR+A+P+NVAAIILGGG G +LFPLT RAATPAVPVGGCYRLIDI
Sbjct  68   NNPKEAMTVKPSMFERRKADPQNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRLIDI  127

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            PMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  128  PMSNCINSCINKIFVLTQFNSASLNRHLARTY  159



>gb|AAB91468.1| ADP-glucose pyrophosphorylase large subunit 2 [Citrullus lanatus 
subsp. vulgaris]
Length=481

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +1

Query  376  RKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAAT  555
            RK+ PGVA+SVL  E    + T++API E  RA+PK +A+IILGGGAGT+LFPLT++ A 
Sbjct  11   RKLTPGVAYSVLMSEISEVSSTLQAPIFETPRADPKKIASIILGGGAGTRLFPLTSQRAK  70

Query  556  PAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            PAVP+GGCYRLIDIPMSNCINSG+ KIFVLTQFNS SLNRH++R Y FGNGV+F
Sbjct  71   PAVPIGGCYRLIDIPMSNCINSGIEKIFVLTQFNSFSLNRHLARIYNFGNGVNF  124



>ref|XP_011083898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like, partial [Sesamum indicum]
Length=510

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 113/150 (75%), Gaps = 9/150 (6%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRK--IKPGVAFSVLTRENGTETLTVEAP  453
            E GF+G KIRGS+ + V   ++R++L     KR   +KPGV  SVLTR+   E +  E+ 
Sbjct  19   ENGFWGEKIRGSLKDKVF-GRTRQNL---SGKRSGNLKPGVTVSVLTRDINKEMVAFESS  74

Query  454  IL--ERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGV  627
                E  +A+P  VA+IILGGGAGT+LFPLT+R A PAVP+GGCYRLID+PMSNCINSG+
Sbjct  75   SFFEENPKADPGTVASIILGGGAGTRLFPLTSRRAKPAVPIGGCYRLIDVPMSNCINSGI  134

Query  628  NKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
             KIF+LTQFNS SLNRH++RTY FGNGV+F
Sbjct  135  RKIFILTQFNSFSLNRHLARTYNFGNGVNF  164



>gb|KDO42002.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=420

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  439  TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCIN  618
            T+  P LERRR +PKNVAAIILGGGAGT+LFPLT RAATPAVPV GCYRLIDIPMSNCIN
Sbjct  1    TLAPPRLERRRVDPKNVAAIILGGGAGTKLFPLTLRAATPAVPVAGCYRLIDIPMSNCIN  60

Query  619  SGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            SG+NKIFVLTQFNSASLNRHI+RTYFGNG +F
Sbjct  61   SGINKIFVLTQFNSASLNRHIARTYFGNGTNF  92



>gb|KDO42000.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=429

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  439  TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCIN  618
            T+  P LERRR +PKNVAAIILGGGAGT+LFPLT RAATPAVPV GCYRLIDIPMSNCIN
Sbjct  1    TLAPPRLERRRVDPKNVAAIILGGGAGTKLFPLTLRAATPAVPVAGCYRLIDIPMSNCIN  60

Query  619  SGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            SG+NKIFVLTQFNSASLNRHI+RTYFGNG +F
Sbjct  61   SGINKIFVLTQFNSASLNRHIARTYFGNGTNF  92



>ref|XP_009406290.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=526

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +1

Query  373  KRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAA  552
            KR+   G A +VLT +   ET+ + AP+   R A PK+VA+IILGGGAGTQLFPLT+  A
Sbjct  55   KRRNSLGAAVAVLTSDVSEETMVLHAPMFGYRTAEPKSVASIILGGGAGTQLFPLTSTRA  114

Query  553  TPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            TPAVP+GGCYRLIDIPMSNCINSG+NKIF++TQFNSASLNRHISRTY FGNG++F
Sbjct  115  TPAVPIGGCYRLIDIPMSNCINSGINKIFIMTQFNSASLNRHISRTYIFGNGINF  169



>ref|XP_009406289.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +1

Query  373  KRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAA  552
            KR+   G A +VLT +   ET+ + AP+   R A PK+VA+IILGGGAGTQLFPLT+  A
Sbjct  55   KRRNSLGAAVAVLTSDVSEETMVLHAPMFGYRTAEPKSVASIILGGGAGTQLFPLTSTRA  114

Query  553  TPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            TPAVP+GGCYRLIDIPMSNCINSG+NKIF++TQFNSASLNRHISRTY FGNG++F
Sbjct  115  TPAVPIGGCYRLIDIPMSNCINSGINKIFIMTQFNSASLNRHISRTYIFGNGINF  169



>gb|KDO41998.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=449

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  439  TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCIN  618
            T+  P LERRR +PKNVAAIILGGGAGT+LFPLT RAATPAVPV GCYRLIDIPMSNCIN
Sbjct  1    TLAPPRLERRRVDPKNVAAIILGGGAGTKLFPLTLRAATPAVPVAGCYRLIDIPMSNCIN  60

Query  619  SGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            SG+NKIFVLTQFNSASLNRHI+RTYFGNG +F
Sbjct  61   SGINKIFVLTQFNSASLNRHIARTYFGNGTNF  92



>gb|KDO41999.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=446

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  439  TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCIN  618
            T+  P LERRR +PKNVAAIILGGGAGT+LFPLT RAATPAVPV GCYRLIDIPMSNCIN
Sbjct  1    TLAPPRLERRRVDPKNVAAIILGGGAGTKLFPLTLRAATPAVPVAGCYRLIDIPMSNCIN  60

Query  619  SGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            SG+NKIFVLTQFNSASLNRHI+RTYFGNG +F
Sbjct  61   SGINKIFVLTQFNSASLNRHIARTYFGNGTNF  92



>ref|XP_006404613.1| hypothetical protein EUTSA_v10000141mg [Eutrema salsugineum]
 ref|XP_006404614.1| hypothetical protein EUTSA_v10000141mg [Eutrema salsugineum]
 gb|ESQ46066.1| hypothetical protein EUTSA_v10000141mg [Eutrema salsugineum]
 gb|ESQ46067.1| hypothetical protein EUTSA_v10000141mg [Eutrema salsugineum]
Length=494

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 112/159 (70%), Gaps = 12/159 (8%)
 Frame = +1

Query  241  FCATL-KSSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE-NKRKIKPGV  396
            +C  L KSS+ LP+      E  F+G KI    NN+         L  ++   R +K GV
Sbjct  5    YCFALGKSSSILPKLSFKNLENRFWGQKI----NNSGFFKCFASDLSSKKFCNRTVKHGV  60

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
             ++V T +N  + + V+  + ERR+A+PKNVAAIILGGG G QLFPLT RAATPAVPVGG
Sbjct  61   VYAVATSKNPKDVMRVKPSMFERRKADPKNVAAIILGGGNGAQLFPLTKRAATPAVPVGG  120

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            CYRLIDIPMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  121  CYRLIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTY  159



>ref|XP_006581201.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X2 [Glycine max]
Length=502

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 118/171 (69%), Gaps = 15/171 (9%)
 Frame = +1

Query  244  CATLKSSAHLP---------RETGFFGGKIRGSVNNNVLVN-QSRKSLKLEENKRKIKPG  393
            CATL +  HL          R +GF+G   RGSVN    ++ QS K+ +   N R  KPG
Sbjct  5    CATL-NGRHLAKVSEGIGRNRTSGFWGESTRGSVNTKRFLSVQSCKTSRTNRNLRNSKPG  63

Query  394  --VAFSVLTRENGTETLTVE-APILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
              +A +VLT +   +++  +  P  E+   +PK+VA+IILGGGAGT+LFPLT R A PAV
Sbjct  64   SGIARAVLTSDIDEDSMAFQGVPTFEKPEVDPKSVASIILGGGAGTRLFPLTGRRAKPAV  123

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            P+GGCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH+SR Y FGNG++F
Sbjct  124  PIGGCYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRAYSFGNGMTF  174



>ref|XP_003528021.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Glycine max]
 gb|KHN22238.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=531

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 118/171 (69%), Gaps = 15/171 (9%)
 Frame = +1

Query  244  CATLKSSAHLP---------RETGFFGGKIRGSVNNNVLVN-QSRKSLKLEENKRKIKPG  393
            CATL +  HL          R +GF+G   RGSVN    ++ QS K+ +   N R  KPG
Sbjct  5    CATL-NGRHLAKVSEGIGRNRTSGFWGESTRGSVNTKRFLSVQSCKTSRTNRNLRNSKPG  63

Query  394  --VAFSVLTRENGTETLTVE-APILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
              +A +VLT +   +++  +  P  E+   +PK+VA+IILGGGAGT+LFPLT R A PAV
Sbjct  64   SGIARAVLTSDIDEDSMAFQGVPTFEKPEVDPKSVASIILGGGAGTRLFPLTGRRAKPAV  123

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            P+GGCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH+SR Y FGNG++F
Sbjct  124  PIGGCYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRAYSFGNGMTF  174



>ref|XP_007136616.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08610.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=528

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP-GVAFSVLTRENGTETLTVE-A  450
            R +GF+G   RGS N   L  QS K+ +  +N R  KP G+  +VLT +   +++  +  
Sbjct  23   RRSGFWGESTRGSGNTRFLSVQSCKTSQTSKNLRNSKPPGIPRAVLTSDINEDSMAYQGV  82

Query  451  PILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVN  630
            P  +    NPK+VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLIDIPMSNCINSG+ 
Sbjct  83   PTFQTTEVNPKSVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDIPMSNCINSGIR  142

Query  631  KIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            KIF++TQFNS SLNRH+SRTY FGNG++F
Sbjct  143  KIFIMTQFNSFSLNRHLSRTYSFGNGMNF  171



>ref|XP_010924297.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
 ref|XP_010924298.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=520

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +1

Query  343  SRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGT  522
            ++K ++    +R  K GV  S+LT +   ET+  + P+   ++A+PKNVA+IILGGGAGT
Sbjct  39   AKKCVESRSLERGGKAGVTVSILTSDVSKETMVFQTPMFGSQKADPKNVASIILGGGAGT  98

Query  523  QLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FG  699
            QLFPLT+  ATPAVPVGGCYRLIDIPMSNCINSG+NKIF++TQFNSASLNRHI RTY  G
Sbjct  99   QLFPLTSTRATPAVPVGGCYRLIDIPMSNCINSGINKIFIMTQFNSASLNRHIHRTYNLG  158

Query  700  NGVSF  714
            NG++F
Sbjct  159  NGINF  163



>ref|XP_010416915.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE-NKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            E  F+  KI    NNN  + + R      +   RK K GV ++V T  N  E +TV+  +
Sbjct  29   ENRFWCDKIN---NNNGFLKRFRSDFGSNKFGNRKFKHGVVYAVATSNNPKEAMTVKPSM  85

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
             ERR+A+P+NVAAIILGGG G +LFPLT RAATPAVPVGGCYRLIDIPMSNCINS +NKI
Sbjct  86   FERRKADPQNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRLIDIPMSNCINSCINKI  145

Query  637  FVLTQFNSASLNRHISRTY  693
            FVLTQFNSASLNRH++RTY
Sbjct  146  FVLTQFNSASLNRHLARTY  164



>ref|XP_010416916.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010416917.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEE-NKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            E  F+  KI    NNN  + + R      +   RK K GV ++V T  N  E +TV+  +
Sbjct  25   ENRFWCDKIN---NNNGFLKRFRSDFGSNKFGNRKFKHGVVYAVATSNNPKEAMTVKPSM  81

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
             ERR+A+P+NVAAIILGGG G +LFPLT RAATPAVPVGGCYRLIDIPMSNCINS +NKI
Sbjct  82   FERRKADPQNVAAIILGGGNGAKLFPLTKRAATPAVPVGGCYRLIDIPMSNCINSCINKI  141

Query  637  FVLTQFNSASLNRHISRTY  693
            FVLTQFNSASLNRH++RTY
Sbjct  142  FVLTQFNSASLNRHLARTY  160



>ref|XP_008800702.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Phoenix dactylifera]
Length=496

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 117/166 (70%), Gaps = 18/166 (11%)
 Frame = +1

Query  247  ATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVA  399
            A LK++A+L +         E+G +G ++   +    + N+S       E +RK   GV 
Sbjct  11   AGLKANAYLGQVKKGGVGSGESGIWGEELCSRLATKCVWNRSL------EGRRK--AGVT  62

Query  400  FSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
            FS+LT +   E++  + P+   ++A+PK+VA+IILGGGAGTQLFPLT+  ATPAVPVGGC
Sbjct  63   FSILTTDVSKESMVFQTPMFGTQKADPKSVASIILGGGAGTQLFPLTSTRATPAVPVGGC  122

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            YRLIDIPMSNCINSG+NKIF+ TQFNSASLNRHI RTY  G+G++F
Sbjct  123  YRLIDIPMSNCINSGINKIFITTQFNSASLNRHIHRTYNLGSGINF  168



>gb|AJG44463.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=518

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +1

Query  385  KPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAV  564
            + GVAFSVLT +   ET+  + P+   R A+PKNVA+IILGGG GTQLFPLT+  ATPAV
Sbjct  51   RAGVAFSVLTSDVDKETMVFQPPMFSNRNADPKNVASIILGGGVGTQLFPLTSTRATPAV  110

Query  565  PVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            P+GGCYRLIDIPMSNCINSG+NKIF+++Q+NSASLNRHI RTY  GNG++F
Sbjct  111  PIGGCYRLIDIPMSNCINSGINKIFIMSQYNSASLNRHIYRTYNLGNGINF  161



>emb|CDX99581.1| BnaC04g33380D [Brassica napus]
Length=525

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 112/160 (70%), Gaps = 17/160 (11%)
 Frame = +1

Query  247  ATLKSSAHLPRET-------GFFGGKIRGSVNNNVLVNQSRKSLKLEENK---RKIK-PG  393
            AT KSS+ LP+ T        F+G KI+   +N       R +  L  NK   RK K   
Sbjct  8    ATGKSSSVLPKLTFKNVDSNKFWGEKIK---SNGFF---KRFASDLNSNKFGNRKFKHSS  61

Query  394  VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVG  573
            V ++V T +N  E + V+  + E+R+A+PKNVAAIILGGG G QLFPLT RAATPAVPVG
Sbjct  62   VVYAVATSKNPNEAMIVKPSMFEKRKADPKNVAAIILGGGNGAQLFPLTKRAATPAVPVG  121

Query  574  GCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            GCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  122  GCYRLIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTY  161



>ref|XP_008800701.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Phoenix dactylifera]
Length=525

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 117/166 (70%), Gaps = 18/166 (11%)
 Frame = +1

Query  247  ATLKSSAHLPR---------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVA  399
            A LK++A+L +         E+G +G ++   +    + N+S       E +RK   GV 
Sbjct  11   AGLKANAYLGQVKKGGVGSGESGIWGEELCSRLATKCVWNRSL------EGRRK--AGVT  62

Query  400  FSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
            FS+LT +   E++  + P+   ++A+PK+VA+IILGGGAGTQLFPLT+  ATPAVPVGGC
Sbjct  63   FSILTTDVSKESMVFQTPMFGTQKADPKSVASIILGGGAGTQLFPLTSTRATPAVPVGGC  122

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            YRLIDIPMSNCINSG+NKIF+ TQFNSASLNRHI RTY  G+G++F
Sbjct  123  YRLIDIPMSNCINSGINKIFITTQFNSASLNRHIHRTYNLGSGINF  168



>ref|XP_009140291.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140292.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140293.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140294.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140295.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
Length=520

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 24/161 (15%)
 Frame = +1

Query  247  ATLKSSAHLPR------ETGFFGGKIRGS-----VNNNVLVNQSRKSLKLEENKRKIKPG  393
            AT KS++ LP+      +  F+G KI+ +     +N+N   N            RK K G
Sbjct  8    ATGKSTSVLPKLTFKNVDNKFWGEKIKSNGFFKRLNSNQFGN------------RKFKHG  55

Query  394  -VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
             V ++V T +N  E + V+  + E+R+A+PKNVAAIILGGG G QLFPLT RAATPAVPV
Sbjct  56   GVVYAVATSKNPNEAMIVKPSMFEKRKADPKNVAAIILGGGNGAQLFPLTKRAATPAVPV  115

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            GGCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  116  GGCYRLIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTY  156



>ref|XP_010673183.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 117/166 (70%), Gaps = 14/166 (8%)
 Frame = +1

Query  244  CATLKSSAHLPRETG---FFGGKIRGSVNNNVLVNQSRKSLKLEENK-RKI-KPGVAFSV  408
             A +  +AHL  E G   F G +I  S+    L    R      E+K R + KPGVAFSV
Sbjct  5    AAAINVNAHL-TEVGKKRFLGERISQSLKGKDL----RALFSRTESKGRNVNKPGVAFSV  59

Query  409  LTRE---NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
            LT +   +  E+L  E  + E  +A+PKNVAAI+LGGGAGT+LFPLT+R A PAVP+GGC
Sbjct  60   LTSDFNQSVKESLKYEPALFESPKADPKNVAAIVLGGGAGTRLFPLTSRRAKPAVPIGGC  119

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            YRLID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FG+GV+F
Sbjct  120  YRLIDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGDGVNF  165



>ref|NP_001289992.1| glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
 sp|P55233.1|GLGL1_BETVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Beta vulgaris]
 emb|CAA55516.1| ADP-glucose pyrophosphorylase [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 117/166 (70%), Gaps = 14/166 (8%)
 Frame = +1

Query  244  CATLKSSAHLPRETG---FFGGKIRGSVNNNVLVNQSRKSLKLEENK-RKI-KPGVAFSV  408
             A +  +AHL  E G   F G +I  S+    L    R      E+K R + KPGVAFSV
Sbjct  5    AAAINVNAHL-TEVGKKRFLGERISQSLKGKDL----RALFSRTESKGRNVNKPGVAFSV  59

Query  409  LTRE---NGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
            LT +   +  E+L  E  + E  +A+PKNVAAI+LGGGAGT+LFPLT+R A PAVP+GGC
Sbjct  60   LTSDFNQSVKESLKYEPALFESPKADPKNVAAIVLGGGAGTRLFPLTSRRAKPAVPIGGC  119

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            YRLID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FG+GV+F
Sbjct  120  YRLIDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGDGVNF  165



>ref|NP_179753.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 ref|NP_001031391.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 sp|Q9SIK1.1|GLGL4_ARATH RecName: Full=Probable glucose-1-phosphate adenylyltransferase 
large subunit, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl 
transferase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD23646.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAL49924.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAM20291.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 dbj|BAH19825.1| AT2G21590 [Arabidopsis thaliana]
 gb|AEC07199.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 gb|AEC07200.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
Length=523

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 110/152 (72%), Gaps = 11/152 (7%)
 Frame = +1

Query  259  SSAHLPR------ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENK-RKIKPGVAFSVLTR  417
            SS+ LP+      E  F+G K     NNN L  +    L  ++ + +K K GV ++V T 
Sbjct  12   SSSILPKLSFRNVENRFYGEK----NNNNGLCKRFGSDLGSKKFRNQKFKHGVVYAVATS  67

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
            +N  + +TV+  + ERR+ +P+NVAAIILGGG G +LFPLT RAATPAVPVGGCYRLIDI
Sbjct  68   DNPKKAMTVKTSMFERRKVDPQNVAAIILGGGNGAKLFPLTMRAATPAVPVGGCYRLIDI  127

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            PMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  128  PMSNCINSCINKIFVLTQFNSASLNRHLARTY  159



>ref|XP_010926128.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=529

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 108/150 (72%), Gaps = 13/150 (9%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETL----TVE  447
            ET  +G ++ G V        ++KS+K      + K GVAF VL  +   +TL      +
Sbjct  31   ETVIWGERLCGRV--------AKKSVKSSSLGGRGKSGVAFCVLISDINKKTLASDHVFQ  82

Query  448  APILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGV  627
            APIL   +A+PKNVA+IILGGGAGTQLFPLT+  ATPAVP+GGCYR+ID+PMSNCINSG+
Sbjct  83   APILGNPKADPKNVASIILGGGAGTQLFPLTSTRATPAVPIGGCYRVIDVPMSNCINSGI  142

Query  628  NKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            NKIF++TQFNSASLNRHI RTY  GNG+ F
Sbjct  143  NKIFIMTQFNSASLNRHIHRTYNLGNGIHF  172



>emb|CDY15884.1| BnaA04g12270D [Brassica napus]
Length=520

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 24/161 (15%)
 Frame = +1

Query  247  ATLKSSAHLPR------ETGFFGGKIRGS-----VNNNVLVNQSRKSLKLEENKRKIKPG  393
            A+ KSS+ LP+      +  F+G  I+ +     +N+N   N            RK K G
Sbjct  8    ASGKSSSVLPKLTFKNVDNKFWGENIKSNGFFKRLNSNQFGN------------RKFKHG  55

Query  394  -VAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
             V ++V T +N  E + V+  + E+R+A+PKNVAAIILGGG G QLFPLT RAATPAVPV
Sbjct  56   GVVYAVATSKNPNEAMIVKPSMFEKRKADPKNVAAIILGGGNGAQLFPLTKRAATPAVPV  115

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            GGCYRLIDIPMSNCINS +NKIFVLTQFNSASLNRH++RTY
Sbjct  116  GGCYRLIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTY  156



>gb|AEV40474.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
 gb|AEV40475.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
Length=539

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +1

Query  406  VLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            +LT +   +TLT ++P  ++ RAN KNVAAIILGGGAGT+LFPLT+R A PAVP+GGCYR
Sbjct  79   ILTPDISKDTLTFQSPFFDKDRANAKNVAAIILGGGAGTKLFPLTSRRAEPAVPIGGCYR  138

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            LIDIPMSNCINSG+NKI+V+TQFNS SLNRH++RTY FGNGV+F
Sbjct  139  LIDIPMSNCINSGINKIYVMTQFNSWSLNRHLARTYNFGNGVNF  182



>gb|EYU45186.1| hypothetical protein MIMGU_mgv1a004400mg [Erythranthe guttata]
Length=529

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 114/176 (65%), Gaps = 27/176 (15%)
 Frame = +1

Query  244  CATLKSSAH--------LPRETGFFGGKIRGSVNNN--------VLVNQSRKSLKLEENK  375
            CA +K+           +  E    G ++RGS+ +         +++N+ R         
Sbjct  5    CAAIKAKVSPVEINGGSMRSEKVLLGERVRGSLKSKNAFGARTCIILNRKRS--------  56

Query  376  RKIKPGVAFSVLTRENGTETLTVEAP--ILERRRANPKNVAAIILGGGAGTQLFPLTNRA  549
            R   PGVAFSVLTR+   E    E+   I E  +A+P  VA+IILGGGAGT+LFPLTNR 
Sbjct  57   RNCYPGVAFSVLTRDINKEMAAFESSSFIDENPKADPGTVASIILGGGAGTRLFPLTNRR  116

Query  550  ATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            A PAVP+GGCYRLID+PMSNCINSG+ KIF++TQFNS SLNRH++RTY FGNGV+F
Sbjct  117  AKPAVPIGGCYRLIDVPMSNCINSGIRKIFIMTQFNSFSLNRHLARTYNFGNGVNF  172



>gb|AEH27531.1| putative ADP-glucose pyrophosphorylase [Amorphophallus konjac]
Length=543

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +1

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            ++LT E   +TLT ++P  E+  ANPKNVAAIILGGGAGT+LFPLT R A PAVP+GG Y
Sbjct  82   AILTPEISKDTLTFQSPFFEKEWANPKNVAAIILGGGAGTKLFPLTGRRAEPAVPIGGSY  141

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            RLIDIPMSNCINSG+NKI+V+TQFNS SLNRH++RTY FGNGV+F
Sbjct  142  RLIDIPMSNCINSGINKIYVMTQFNSWSLNRHLARTYNFGNGVNF  186



>gb|AJG44462.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=514

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = +1

Query  373  KRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAA  552
            +R+ + GVA +VLT     ET+  +AP+  R+ A+PK+VAAIILGGGAGT+LFPLTNR A
Sbjct  44   QRRARAGVAMAVLTSHVKEETVIPQAPLF-RQEADPKSVAAIILGGGAGTRLFPLTNRRA  102

Query  553  TPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
             PAVP+GG YRLID+PMSNCINSG+NKI+++TQFNS SLNRH++RTY FGNG+SF
Sbjct  103  KPAVPIGGGYRLIDVPMSNCINSGMNKIYIMTQFNSQSLNRHLARTYNFGNGISF  157



>ref|XP_009394804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=538

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 107/151 (71%), Gaps = 6/151 (4%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETL-----TV  444
            E+G +G    G+       ++  K++K        K GVAFS LT +   ETL      +
Sbjct  31   ESGIWGDGSAGASRIRAWESKVAKNVKSGRWVGGFKAGVAFSDLTSDVNQETLINDPYVI  90

Query  445  EAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSG  624
            +AP+  + + +PK+VA+IILGGG G QLFPLT+  ATPAVPVGGCY+LIDIPMSNCINSG
Sbjct  91   QAPMFGKHKPDPKSVASIILGGGPGAQLFPLTSTRATPAVPVGGCYKLIDIPMSNCINSG  150

Query  625  VNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            +NKIF++TQ+NSASLNRHI RT+ FGNG++F
Sbjct  151  INKIFIMTQYNSASLNRHIYRTFNFGNGINF  181



>ref|XP_006346702.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Solanum tuberosum]
Length=521

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 114/166 (69%), Gaps = 13/166 (8%)
 Frame = +1

Query  241  FCATLKSSAHLP----RETGFFGGKIRGS--VNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
             CA++K +A L     +E+ F+G KI G   +N    V +S KS   ++  R +      
Sbjct  4    LCASMKGTAQLVAICNQESAFWGEKISGRRLINKGFGV-RSCKSFTTQQRGRNVTS----  58

Query  403  SVLTRENGTETLTVEAPILERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
            +VLTR+   E L  E  + E +  A+PK VA++ILGGG GT+LFPLT+R A PAVP+GGC
Sbjct  59   AVLTRDINKEMLPFEESMFEEQPTADPKAVASVILGGGVGTRLFPLTSRRAKPAVPIGGC  118

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            YRLID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FGNGV F
Sbjct  119  YRLIDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGNGVGF  164



>gb|AFK36497.1| unknown [Lotus japonicus]
Length=535

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENK---RKIKP---GVAFSVLTRENGTETLTV  444
            +GF+G   RGS   + L  QS KS K+ +     R  KP   GVA +V+T +   E  T 
Sbjct  27   SGFWGETTRGSQKASFLSIQSCKS-KISQTHIKVRNFKPRGTGVARAVITSDINEEESTA  85

Query  445  --EAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCIN  618
              E+   E  +A+PK+VA+IILGGGAGT+LFPLT+R A PAVP+GGCYRLIDIPMSNCIN
Sbjct  86   FQESHTFETSKADPKSVASIILGGGAGTRLFPLTSRRAKPAVPIGGCYRLIDIPMSNCIN  145

Query  619  SGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            SG+ KIF+LTQFNS SLNRH++R Y FGNG++F
Sbjct  146  SGIRKIFILTQFNSFSLNRHLARAYNFGNGMNF  178



>ref|XP_003549440.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=524

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 105/158 (66%), Gaps = 13/158 (8%)
 Frame = +1

Query  247  ATLKSSAHLPRE---------TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVA  399
            ATL +SA+L  +         +GF+G   RGS N      QSRKSLK        KPG A
Sbjct  6    ATLNASANLVTKGIGSRNRTSSGFWGENTRGSFNMRFCSVQSRKSLK----ATTFKPGFA  61

Query  400  FSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
             +V + +   E L    PI +  +ANP+NVAAIILGGGAGT+LFPLT+  A  AVP+ GC
Sbjct  62   QAVYSPDVNKEPLVFHGPIFQNPKANPENVAAIILGGGAGTRLFPLTSTRAKQAVPIAGC  121

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            YRLIDIPMSNCINSG+ K++VLTQFNS SLN H+SRTY
Sbjct  122  YRLIDIPMSNCINSGIRKVYVLTQFNSFSLNGHLSRTY  159



>gb|KHN12692.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=524

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 105/158 (66%), Gaps = 13/158 (8%)
 Frame = +1

Query  247  ATLKSSAHLPRE---------TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVA  399
            ATL +SA+L  +         +GF+G   RGS N      QSRKSLK        KPG A
Sbjct  6    ATLNASANLVTKGIGSRNRTSSGFWGENTRGSFNMRFCSVQSRKSLK----ATTFKPGFA  61

Query  400  FSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
             +V + +   E L    PI +  +ANP+NVAAIILGGGAGT+LFPLT+  A  AVP+ GC
Sbjct  62   QAVYSPDVNKEPLVFHGPIFQNPKANPENVAAIILGGGAGTRLFPLTSTRAKQAVPIAGC  121

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY  693
            YRLIDIPMSNCINSG+ K++VLTQFNS SLN H+SRTY
Sbjct  122  YRLIDIPMSNCINSGIRKVYVLTQFNSFSLNGHLSRTY  159



>sp|P55242.1|GLGL2_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Solanum tuberosum]
 emb|CAA52917.1| ADP-glucose-pyrophosphorylase [Solanum tuberosum]
Length=519

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 112/165 (68%), Gaps = 12/165 (7%)
 Frame = +1

Query  241  FCATLKSSAHLP----RETGFFGGKIRGS--VNNNVLVNQSRKSLKLEENKRKIKPGVAF  402
             CA++K +A L     +E+ F+G KI G   +N    V +S KS   ++  R + P    
Sbjct  4    LCASMKGTAQLVAICNQESAFWGEKISGRRLINKGFGV-RSCKSFTTQQRGRNVTP----  58

Query  403  SVLTRENGTETLTVEAPILERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGC  579
            +VLTR+   E L  E  + E +  A+PK VA++ILGGG GT+LFPLT+R A PAVP+GGC
Sbjct  59   AVLTRDINKEMLPFEESMFEEQPTADPKAVASVILGGGVGTRLFPLTSRRAKPAVPIGGC  118

Query  580  YRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            YRLID+PMSNCINSG+ KIF+LTQFNS SLNRH++   FGNGV F
Sbjct  119  YRLIDVPMSNCINSGIRKIFILTQFNSFSLNRHLATYNFGNGVGF  163



>gb|KJB63622.1| hypothetical protein B456_010G008700 [Gossypium raimondii]
Length=470

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 102/143 (71%), Gaps = 5/143 (3%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F G +I  S+ +        +SL++E + RK K GV   V T  N  +  T    + E  
Sbjct  28   FLGERISWSIKSRDYGRVLWRSLRIENDVRKAKCGVVHCVQTPTNENDDPT----MFESP  83

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            +A+PK VA+I+LGGGAGT+LFPLT+  A PAVP+GGCYRLID+PMSNCINSG+ KIF+LT
Sbjct  84   QADPKEVASIVLGGGAGTRLFPLTSMRAKPAVPIGGCYRLIDVPMSNCINSGIKKIFILT  143

Query  649  QFNSASLNRHISRTY-FGNGVSF  714
            QFNS SLNRH++RTY FGNGV+F
Sbjct  144  QFNSFSLNRHLARTYNFGNGVNF  166



>gb|AIO11223.1| AGPL1 protein [Gladiolus hybrid cultivar]
Length=517

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +1

Query  382  IKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPA  561
            +K  V  SVLT +   ET+  +AP+  +  ANPK+VA+IILGGG GT LFPLT+  ATPA
Sbjct  49   VKARVTNSVLTSDVSNETMIFQAPMFAKPAANPKSVASIILGGGPGTHLFPLTSTRATPA  108

Query  562  VPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            VPVGGCY+LIDIPMSNC NSG+NKIF++TQFNSA LNRHISRTY  GNGV+F
Sbjct  109  VPVGGCYKLIDIPMSNCFNSGINKIFIMTQFNSACLNRHISRTYNLGNGVNF  160



>gb|KJB63623.1| hypothetical protein B456_010G008700 [Gossypium raimondii]
Length=493

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 102/143 (71%), Gaps = 5/143 (3%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F G +I  S+ +        +SL++E + RK K GV   V T  N  +  T    + E  
Sbjct  28   FLGERISWSIKSRDYGRVLWRSLRIENDVRKAKCGVVHCVQTPTNENDDPT----MFESP  83

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            +A+PK VA+I+LGGGAGT+LFPLT+  A PAVP+GGCYRLID+PMSNCINSG+ KIF+LT
Sbjct  84   QADPKEVASIVLGGGAGTRLFPLTSMRAKPAVPIGGCYRLIDVPMSNCINSGIKKIFILT  143

Query  649  QFNSASLNRHISRTY-FGNGVSF  714
            QFNS SLNRH++RTY FGNGV+F
Sbjct  144  QFNSFSLNRHLARTYNFGNGVNF  166



>gb|KJB63621.1| hypothetical protein B456_010G008700 [Gossypium raimondii]
Length=523

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 102/143 (71%), Gaps = 5/143 (3%)
 Frame = +1

Query  289  FFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERR  468
            F G +I  S+ +        +SL++E + RK K GV   V T  N  +  T    + E  
Sbjct  28   FLGERISWSIKSRDYGRVLWRSLRIENDVRKAKCGVVHCVQTPTNENDDPT----MFESP  83

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
            +A+PK VA+I+LGGGAGT+LFPLT+  A PAVP+GGCYRLID+PMSNCINSG+ KIF+LT
Sbjct  84   QADPKEVASIVLGGGAGTRLFPLTSMRAKPAVPIGGCYRLIDVPMSNCINSGIKKIFILT  143

Query  649  QFNSASLNRHISRTY-FGNGVSF  714
            QFNS SLNRH++RTY FGNGV+F
Sbjct  144  QFNSFSLNRHLARTYNFGNGVNF  166



>gb|AAC49942.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 111/163 (68%), Gaps = 10/163 (6%)
 Frame = +1

Query  241  FCA-TLKSSAHLPRETGFFGGKIRGS--VNNNVLVNQSRKSLKLEENKRKIKPGVAFSVL  411
             CA T +S A   +E+ F+G KI G   +N    V    KS   ++  R    GV  +VL
Sbjct  4    LCAGTAQSVAICNQESTFWGQKISGRRLINKGFGVRWC-KSFTTQQRGR----GVTSAVL  58

Query  412  TRENGTETLTVEAPILERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRL  588
            TR+   E L  E  + E +  A+PK VA++ILGGG GT+LFPLT+R A PAVP+GGCYRL
Sbjct  59   TRDINKEMLPFENSMFEEQPTADPKAVASVILGGGVGTRLFPLTSRRAKPAVPIGGCYRL  118

Query  589  IDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            ID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FGNGV F
Sbjct  119  IDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGNGVGF  161



>emb|CDX84911.1| BnaC05g21440D [Brassica napus]
Length=510

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 105/147 (71%), Gaps = 15/147 (10%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R++ F+G ++       V  N     LK +   +KI+  +  SVLT     E+     P+
Sbjct  26   RDSSFWGAEV-------VKANH----LKAQSGPQKIQTRLIRSVLTPSVDQES---HEPL  71

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L   RA+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  72   LRTPRADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  131

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  132  FILTQFNSFSLNRHLSRTYNFGNGVNF  158



>gb|AGT16332.1| glucose-1-phosphate adenylyltransferase [Saccharum hybrid cultivar 
R570]
Length=315

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  58   AQCVLTSDAGPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  117  CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  162



>ref|XP_006415741.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
 gb|ESQ34094.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
Length=518

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 110/169 (65%), Gaps = 22/169 (13%)
 Frame = +1

Query  241  FCATLKSSAHLP----------RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP  390
            +C+ +K     P          R + F+G ++  + N  +         K+    +KI+ 
Sbjct  4    YCSAMKLQCTSPFGMKKQVVSERPSAFWGAEVVKASNLRIQ--------KISSGPQKIQT  55

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
             +  SVLT     E+     P+L   RA+PKNVA+IILGGGAGT+LFPLT++ A PAVP+
Sbjct  56   KLICSVLTPFVDQES---HEPLLRTPRADPKNVASIILGGGAGTRLFPLTSKRAKPAVPI  112

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GGCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  113  GGCYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRTYNFGNGVNF  161



>ref|XP_009113743.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X2 [Brassica rapa]
 emb|CDY27626.1| BnaA09g27810D [Brassica napus]
Length=517

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 105/147 (71%), Gaps = 14/147 (10%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R++ F+G ++   V  N L  QS          +KI+  +  SVLT     E+     P+
Sbjct  27   RDSSFWGAEV---VKANHLKAQSG-------GPQKIQTRLIRSVLTPSVDQES---HEPL  73

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L   RA+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  74   LRTPRADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  133

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  134  FILTQFNSFSLNRHLSRTYNFGNGVNF  160



>ref|XP_009113739.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113740.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113742.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
Length=543

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 105/147 (71%), Gaps = 14/147 (10%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R++ F+G ++   V  N L  QS          +KI+  +  SVLT     E+     P+
Sbjct  27   RDSSFWGAEV---VKANHLKAQSG-------GPQKIQTRLIRSVLTPSVDQES---HEPL  73

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L   RA+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  74   LRTPRADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  133

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  134  FILTQFNSFSLNRHLSRTYNFGNGVNF  160



>gb|AGB85111.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=517

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 103/147 (70%), Gaps = 11/147 (7%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPIL  459
            ++GF+G KIRG            K+ + E   +K+  GVA S+LT +   + L+ E    
Sbjct  23   DSGFWGEKIRGC---------RIKTERHEGMPKKVNLGVACSILTHDVNKQHLSFETQHF  73

Query  460  ERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            E   + +P+NVA+I+LGGGAGT+LFPLT   A PAVP+GGCYRLID+PMSNCINSG+ KI
Sbjct  74   EEHSQGDPRNVASIVLGGGAGTRLFPLTRSRAKPAVPIGGCYRLIDVPMSNCINSGIRKI  133

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH++R Y  GNGV+F
Sbjct  134  FILTQFNSFSLNRHLARAYGIGNGVNF  160



>gb|KFK36157.1| hypothetical protein AALP_AA4G085400 [Arabis alpina]
Length=514

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  355  LKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFP  534
            L+ +   +KI+  +  SVLT     E+     PIL  + A+PKNVA+IILGGGAGT+LFP
Sbjct  40   LRTQSGPKKIQTNLIRSVLTPFVDQES---HEPILRTQSADPKNVASIILGGGAGTRLFP  96

Query  535  LTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVS  711
            LT++ A PAVP+GGCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH+SRTY FGNGV+
Sbjct  97   LTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRTYNFGNGVN  156

Query  712  F  714
            F
Sbjct  157  F  157



>ref|XP_010478112.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 105/147 (71%), Gaps = 10/147 (7%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R + F+G ++  + N      +SR         +KI+  +  SVLT     E+  V  P+
Sbjct  28   RVSAFWGAEVVKASNLRTYTIRSRP--------QKIQTNLIRSVLTPFVDQES-NVSEPL  78

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L  + A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  79   LRTQNADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  138

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  139  FILTQFNSFSLNRHLSRTYNFGNGVNF  165



>dbj|BAF47748.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb2 [Ipomoea batatas]
Length=518

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 12/148 (8%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSR-KSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            ++G +G KIRG          SR K+ + E   +K+  GVA S+LT +   E L+ E   
Sbjct  23   DSGLWGEKIRGC---------SRIKTERHEGMPKKVNLGVACSILTHDINQEHLSFETQH  73

Query  457  LERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNK  633
             E   + +P+NVA+I+LGGGAGT+LFPLT   A PAVP+GGCYRLID+PMSNCINSG+ K
Sbjct  74   FEEHSQGDPRNVASIVLGGGAGTRLFPLTRSRAKPAVPIGGCYRLIDVPMSNCINSGIRK  133

Query  634  IFVLTQFNSASLNRHISRTY-FGNGVSF  714
            IF+LTQFNS SLNRH++R Y  GNGV+F
Sbjct  134  IFILTQFNSFSLNRHLARAYGIGNGVNF  161



>gb|AFL55398.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=518

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 12/148 (8%)
 Frame = +1

Query  280  ETGFFGGKIRGSVNNNVLVNQSR-KSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            ++G +G KIRG          SR K+ + E   +K+  GVA S+LT +   E L+ E   
Sbjct  23   DSGLWGEKIRGC---------SRIKTERHEGMPKKVNLGVACSILTHDINKEHLSFETQH  73

Query  457  LERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNK  633
             E   + +P+NVA+I+LGGGAGT+LFPLT   A PAVP+GGCYRLID+PMSNCINSG+ K
Sbjct  74   FEEHSQGDPRNVASIVLGGGAGTRLFPLTRSRAKPAVPIGGCYRLIDVPMSNCINSGIRK  133

Query  634  IFVLTQFNSASLNRHISRTY-FGNGVSF  714
            IF+LTQFNS SLNRH++R Y  GNGV+F
Sbjct  134  IFILTQFNSFSLNRHLARAYGIGNGVNF  161



>ref|XP_010323163.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323164.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
Length=518

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 108/163 (66%), Gaps = 10/163 (6%)
 Frame = +1

Query  241  FCA-TLKSSAHLPRETGFFGGKIRGS--VNNNVLVNQSRKSLKLEENKRKIKPGVAFSVL  411
             CA T +S A   +E+ F+G KI G   +N    V   +     +  K      V  +VL
Sbjct  4    LCAGTAQSVAICNQESTFWGQKISGRRLINKGFGVRWCKSFTTQQRGKN-----VTSAVL  58

Query  412  TRENGTETLTVEAPILERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRL  588
            TR+   E L  E  + E +  A+PK VA++ILGGG GT+LFPLT+R A PAVP+GGCYRL
Sbjct  59   TRDINKEMLPFENSMFEEQPTADPKAVASVILGGGVGTRLFPLTSRRAKPAVPIGGCYRL  118

Query  589  IDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            ID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FGNGV F
Sbjct  119  IDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGNGVGF  161



>ref|XP_010323162.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X2 [Solanum lycopersicum]
Length=544

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 108/163 (66%), Gaps = 10/163 (6%)
 Frame = +1

Query  241  FCA-TLKSSAHLPRETGFFGGKIRGS--VNNNVLVNQSRKSLKLEENKRKIKPGVAFSVL  411
             CA T +S A   +E+ F+G KI G   +N    V   +     +  K      V  +VL
Sbjct  4    LCAGTAQSVAICNQESTFWGQKISGRRLINKGFGVRWCKSFTTQQRGKN-----VTSAVL  58

Query  412  TRENGTETLTVEAPILERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRL  588
            TR+   E L  E  + E +  A+PK VA++ILGGG GT+LFPLT+R A PAVP+GGCYRL
Sbjct  59   TRDINKEMLPFENSMFEEQPTADPKAVASVILGGGVGTRLFPLTSRRAKPAVPIGGCYRL  118

Query  589  IDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            ID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FGNGV F
Sbjct  119  IDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGNGVGF  161



>gb|AGT17354.1| ADP-glucose pyrophosphorylase [Saccharum hybrid cultivar R570]
Length=490

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  29   AQCVLTSDAGPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  87

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  88   CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  133



>ref|NP_174089.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
 sp|P55230.2|GLGL2_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF24945.1|AC012375_8 T22C5.13 [Arabidopsis thaliana]
 gb|AAL36283.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM14190.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE30862.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
Length=518

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +1

Query  373  KRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAA  552
            ++KI+  +  SVLT     E+     P+L  + A+PKNVA+IILGGGAGT+LFPLT++ A
Sbjct  50   QKKIQTNLIRSVLTPFVDQES---HEPLLRTQNADPKNVASIILGGGAGTRLFPLTSKRA  106

Query  553  TPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
             PAVP+GGCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  107  KPAVPIGGCYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRTYNFGNGVNF  161



>ref|XP_004961109.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Setaria italica]
Length=518

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  58   AQCVLTSDAGPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  117  CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  162



>ref|XP_010460525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 12/147 (8%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R + F+G ++   V  N L  Q+ +S       +KI+  +  SVLT     E+     P+
Sbjct  28   RVSAFWGAEV---VKANNLRTQTIRS-----GPQKIQTNLIRSVLTPFVDQES---NEPL  76

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L  + A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  77   LRTQNADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  136

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  137  FILTQFNSFSLNRHLSRTYNFGNGVNF  163



>ref|XP_002440313.1| hypothetical protein SORBIDRAFT_09g029610 [Sorghum bicolor]
 gb|EES18743.1| hypothetical protein SORBIDRAFT_09g029610 [Sorghum bicolor]
Length=519

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  58   AQCVLTSDAGPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  117  CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  162



>gb|AGT17180.1| glucose-1-phosphate adenylyltransferase [Saccharum hybrid cultivar 
R570]
Length=519

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  58   AQCVLTSDAGPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  117  CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  162



>ref|XP_010478113.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Camelina sativa]
Length=520

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 104/147 (71%), Gaps = 12/147 (8%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R + F+G ++  + N      +SR         +KI+  +  SVLT     E+     P+
Sbjct  28   RVSAFWGAEVVKASNLRTYTIRSRP--------QKIQTNLIRSVLTPFVDQES---NEPL  76

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L  + A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  77   LRTQNADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  136

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  137  FILTQFNSFSLNRHLSRTYNFGNGVNF  163



>ref|XP_008648319.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 ref|XP_008648320.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 gb|ACG34981.1| glucose-1-phosphate adenylyltransferase large subunit [Zea mays]
 gb|ACN28262.1| unknown [Zea mays]
 gb|AFW79324.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 1 
[Zea mays]
 gb|AFW79325.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 2 
[Zea mays]
Length=518

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +1

Query  406  VLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYR
Sbjct  60   VLTSDAGPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYR  118

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            LIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  119  LIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  161



>gb|AFW79323.1| ADP-glucose pyrophosphorylase large subunit [Zea mays]
Length=534

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +1

Query  406  VLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYR
Sbjct  60   VLTSDAGPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYR  118

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            LIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  119  LIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  161



>ref|XP_006303972.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
 gb|EOA36870.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
Length=519

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 12/147 (8%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R + F+G ++  + N         ++ ++    +KI+  +  SVLT     E+     P+
Sbjct  27   RVSAFWGTQVVKASN--------LRTHEIRSGPQKIQKNLIRSVLTPFVDQES---NEPL  75

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L  + A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  76   LRTQDADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  135

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  136  FILTQFNSFSLNRHLSRTYNFGNGVNF  162



>ref|NP_001056424.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|AAU10700.1| putative glucose-1-phosphate adenylyltransferase [Oryza sativa 
Japonica Group]
 gb|EAY99171.1| hypothetical protein OsI_21129 [Oryza sativa Indica Group]
 gb|ACA50479.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 dbj|BAG94825.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64817.1| hypothetical protein OsJ_19673 [Oryza sativa Japonica Group]
 dbj|BAF18338.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|ACY56044.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56045.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56046.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56047.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56048.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56049.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56050.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56051.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56052.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56053.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56054.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56055.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56056.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56057.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
Length=519

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = +1

Query  307  RGSVNNNVLVNQSRKSLKLEENKRKIKPGV------AFSVLTRENGTETLTVEAPILERR  468
             GS ++ + +  S  S+K +   R++  G       A  VLT + G +TL V      R 
Sbjct  23   EGSASDRLKIGDS-SSIKHDRAVRRMCLGYRGTKNGAQCVLTSDAGPDTLHVRTS-FRRN  80

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
             A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYRLIDIPMSNC NSG+NKIF++T
Sbjct  81   FADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRLIDIPMSNCFNSGINKIFIMT  140

Query  649  QFNSASLNRHISRTYFGNGVSF  714
            QFNSASLNRHI RTY G G++F
Sbjct  141  QFNSASLNRHIHRTYLGGGINF  162



>ref|NP_001266081.1| glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic-like 
[Cicer arietinum]
 gb|AAK27719.1|AF356003_1 ADP-glucose pyrophosphorylase large subunit CagpL2 [Cicer arietinum]
Length=521

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 7/152 (5%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKP--GVAFSVLTR--ENGTETLTV  444
            R + F G  ++G+++   L +     + +  N R   P  G ++SVLT    +  E++T 
Sbjct  13   RSSVFLGETLKGNLSTKFLTSPKFSQIHIN-NLRSFNPRNGASYSVLTSGINDFEESMTF  71

Query  445  -EAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINS  621
             E P  +  +A+PK+VA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINS
Sbjct  72   HEGPYFDTPKADPKSVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINS  131

Query  622  GVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            G+ KIF+LTQFNS SLNRH+SR+Y FGN  +F
Sbjct  132  GIRKIFILTQFNSFSLNRHLSRSYNFGNVSTF  163



>dbj|BAA23490.1| ADP glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
Length=519

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = +1

Query  307  RGSVNNNVLVNQSRKSLKLEENKRKIKPGV------AFSVLTRENGTETLTVEAPILERR  468
             GS ++ + +  S  S+K +   R++  G       A  VLT + G +TL V      R 
Sbjct  23   EGSASDRLKIGDS-SSIKHDRAVRRMCLGYRGTKNGAQCVLTSDAGPDTLHVRTS-FRRN  80

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
             A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYRLIDIPMSNC NSG+NKIF++T
Sbjct  81   FADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRLIDIPMSNCFNSGINKIFIMT  140

Query  649  QFNSASLNRHISRTYFGNGVSF  714
            QFNSASLNRHI RTY G G++F
Sbjct  141  QFNSASLNRHIHRTYLGGGINF  162



>gb|AAD39597.1|AC007858_11 10A19I.12 [Oryza sativa Japonica Group]
Length=529

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 98/142 (69%), Gaps = 8/142 (6%)
 Frame = +1

Query  307  RGSVNNNVLVNQSRKSLKLEENKRKIKPGV------AFSVLTRENGTETLTVEAPILERR  468
             GS ++ + +  S  S+K +   R++  G       A  VLT + G +TL V      R 
Sbjct  23   EGSASDRLKIGDS-SSIKHDRAVRRMCLGYRGTKNGAQCVLTSDAGPDTLHVRTS-FRRN  80

Query  469  RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLT  648
             A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYRLIDIPMSNC NSG+NKIF++T
Sbjct  81   FADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRLIDIPMSNCFNSGINKIFIMT  140

Query  649  QFNSASLNRHISRTYFGNGVSF  714
            QFNSASLNRHI RTY G G++F
Sbjct  141  QFNSASLNRHIHRTYLGGGINF  162



>ref|XP_006654841.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Oryza brachyantha]
Length=519

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT + G +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  58   AQCVLTSDAGPDTLHVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  116

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIF++TQFNSASLNRHI RTY G G++F
Sbjct  117  CYRLIDIPMSNCFNSGINKIFIMTQFNSASLNRHIHRTYLGGGINF  162



>ref|XP_011039886.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039894.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=530

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + +T +A + E++ A+PK VAAIILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSN
Sbjct  78   DFMTFQASMFEKQAADPKTVAAIILGGGAGTRLFPLTRRRAKPAVPIGGCYRLIDVPMSN  137

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CINSG+NKI++LTQFNS SLNRHI+RTY  GNGV F
Sbjct  138  CINSGINKIYILTQFNSQSLNRHIARTYNQGNGVDF  173



>ref|XP_002320247.2| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 ref|XP_006375412.1| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 gb|EEE98562.2| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 gb|ERP53209.1| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
Length=530

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + +T +A + E++ A+PK VAAIILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSN
Sbjct  78   DFMTFQASMFEKQAADPKTVAAIILGGGAGTRLFPLTRRRAKPAVPIGGCYRLIDVPMSN  137

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CINSG+NKI++LTQFNS SLNRHI+RTY  GNGV F
Sbjct  138  CINSGINKIYILTQFNSQSLNRHIARTYNQGNGVDF  173



>ref|NP_001233947.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40724.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 107/163 (66%), Gaps = 10/163 (6%)
 Frame = +1

Query  241  FCA-TLKSSAHLPRETGFFGGKIRGS--VNNNVLVNQSRKSLKLEENKRKIKPGVAFSVL  411
             CA T +S A   +E+ F+G KI G   +N    V   +     +  K      V  +VL
Sbjct  4    LCAGTAQSVAICNQESTFWGQKISGRRLINKGFGVRWCKSFTTQQRGKN-----VTSAVL  58

Query  412  TRENGTETLTVEAPILERR-RANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRL  588
            TR+   E L  E  + E +  A PK VA++ILGGG GT+LFPLT+R A PAVP+GGCYR+
Sbjct  59   TRDINKEMLPFENSMFEEQPTAEPKAVASVILGGGVGTRLFPLTSRRAKPAVPIGGCYRV  118

Query  589  IDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            ID+PMSNCINSG+ KIF+LTQFNS SLNRH++RTY FGNGV F
Sbjct  119  IDVPMSNCINSGIRKIFILTQFNSFSLNRHLARTYNFGNGVGF  161



>ref|NP_001105717.1| glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic/amyloplastic 
[Zea mays]
 sp|P55234.1|GLGL2_MAIZE RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Zea mays]
 emb|CAA86227.1| ADP-glucose pyrophosphorylase [Zea mays]
Length=521

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  406  VLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYR  585
            VLT + G +TL        R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYR
Sbjct  60   VLTSDAGPDTLVRPNHPFRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYR  119

Query  586  LIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            LIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  120  LIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  162



>ref|XP_006491439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like [Citrus sinensis]
Length=526

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + +T +AP+ E+  A+PK VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSN
Sbjct  74   DYMTFQAPVFEKPEADPKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSN  133

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CINSG+ KI++LTQFNS SLNRHISRTY  G+G++F
Sbjct  134  CINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNF  169



>gb|KDO86722.1| hypothetical protein CISIN_1g043870mg [Citrus sinensis]
Length=526

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + +T +AP+ E+  A+PK VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSN
Sbjct  74   DYMTFQAPVFEKPEADPKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSN  133

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CINSG+ KI++LTQFNS SLNRHISRTY  G+G++F
Sbjct  134  CINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNF  169



>ref|XP_006444661.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
 gb|ESR57901.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
Length=526

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + +T +AP+ E+  A+PK VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSN
Sbjct  74   DYMTFQAPVFEKPEADPKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSN  133

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CINSG+ KI++LTQFNS SLNRHISRTY  G+G++F
Sbjct  134  CINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNF  169



>ref|XP_010499251.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +1

Query  376  RKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAAT  555
            +KI+  +  SVLT     E+     P+L  + A+PKNVA+IILGGGAGT+LFPLT++ A 
Sbjct  53   QKIQTNLIRSVLTPFVDQES---NEPLLRTQNADPKNVASIILGGGAGTRLFPLTSKRAK  109

Query  556  PAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            PAVP+GGCYRLIDIPMSNCINSG+ KIF+LTQFNS SLNRH+SRTY FGNGV+F
Sbjct  110  PAVPIGGCYRLIDIPMSNCINSGIRKIFILTQFNSFSLNRHLSRTYNFGNGVNF  163



>ref|XP_003567817.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Brachypodium distachyon]
 ref|XP_010230974.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Brachypodium distachyon]
Length=522

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT +   +TL V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  61   AQCVLTSDASPDTLVVRTS-FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  119

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  120  CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  165



>ref|XP_002890743.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67002.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 105/147 (71%), Gaps = 11/147 (7%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R + F+G ++   V  N L  Q  +S      ++KI+  +  SVLT     ++     P+
Sbjct  25   RVSAFWGTQV---VKANNLTTQKIRSAP----QKKIQTNLIRSVLTPFVDQDS---HEPL  74

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L  + A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+ KI
Sbjct  75   LRTQNADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKI  134

Query  637  FVLTQFNSASLNRHISRTY-FGNGVSF  714
            F+LTQFNS SLNRH+S TY FGNGV+F
Sbjct  135  FILTQFNSFSLNRHLSCTYNFGNGVNF  161



>ref|XP_006841529.1| hypothetical protein AMTR_s00003p00152830 [Amborella trichopoda]
 gb|ERN03204.1| hypothetical protein AMTR_s00003p00152830 [Amborella trichopoda]
Length=531

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 4/160 (3%)
 Frame = +1

Query  241  FCATLKSSAHLP-RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTR  417
            F     SS   P R   FFG K+      N  +  ++ + ++E  K+++      S +  
Sbjct  17   FSTAQTSSDRDPVRGPEFFGSKVFNKTMKNQFLG-AKINAQVENVKKQLPKIAVTSCILA  75

Query  418  ENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDI  597
            +   E + ++ P     +ANP +VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLID+
Sbjct  76   DVEKELMAIQEPT-ASPQANPNSVASIILGGGAGTRLFPLTRRRAKPAVPIGGCYRLIDV  134

Query  598  PMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            PMSNCINSG+NKIF+LTQFNS SLNRHISRTY  GNGV+F
Sbjct  135  PMSNCINSGINKIFILTQFNSQSLNRHISRTYNIGNGVNF  174



>ref|XP_010540326.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Tarenaya hassleriana]
Length=522

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  448  APILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGV  627
            AP+L+  +A+PKNVA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG+
Sbjct  76   APVLKSEKADPKNVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGI  135

Query  628  NKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
             KIF+LTQFNS SLNRH+SR Y FG+GV+F
Sbjct  136  RKIFILTQFNSFSLNRHLSRAYNFGSGVNF  165



>ref|XP_003545270.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=523

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 95/137 (69%), Gaps = 5/137 (4%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            +GF+G   RGS+N     +  RKSLK        KPG A +V T +   E    + PI +
Sbjct  27   SGFWGENTRGSLNIR-FCSTPRKSLK----ATTFKPGFAQAVYTPDVNKEPQIFQGPIFQ  81

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +ANP+NV AIILGGGAGT+LFPLT+  A  AVP+ GCYRLIDIPMSNCINSG+ K++V
Sbjct  82   SPKANPENVVAIILGGGAGTRLFPLTSTRAKQAVPIAGCYRLIDIPMSNCINSGIRKVYV  141

Query  643  LTQFNSASLNRHISRTY  693
            LTQFNS SLN H+SRTY
Sbjct  142  LTQFNSFSLNGHLSRTY  158



>ref|XP_007051343.1| ADPGLC-PPase large subunit [Theobroma cacao]
 gb|EOX95500.1| ADPGLC-PPase large subunit [Theobroma cacao]
Length=524

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +1

Query  403  SVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCY  582
            S +  +   + +  +A IL ++ A+PK VA+IILGGGAGT+LFPLT R A PAVP+GGCY
Sbjct  63   SAVLADVAKDFMAFQANILPKQEADPKTVASIILGGGAGTRLFPLTRRRAKPAVPIGGCY  122

Query  583  RLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            RLID+PMSNCINSG+NKI++LTQFNS SLNRHI+RTY  GNGV+F
Sbjct  123  RLIDVPMSNCINSGINKIYILTQFNSQSLNRHIARTYNLGNGVNF  167



>ref|XP_007160732.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
 gb|ESW32726.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
Length=520

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 98/139 (71%), Gaps = 7/139 (5%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPI  456
            R +GF+G   RGS+N      Q  KS+K     R    G+A++V T +  TE+      I
Sbjct  24   RGSGFWGENTRGSLNVRFHSTQPCKSVK----ARSSNSGIAYAVYTPDINTES---PRSI  76

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            ++  + NP+NVAAIILGGGAGT LFPLT+  A PAVP+GGCYRLID+PMSNCINSG+ K+
Sbjct  77   IQSPKTNPENVAAIILGGGAGTPLFPLTSTRAKPAVPIGGCYRLIDVPMSNCINSGIRKV  136

Query  637  FVLTQFNSASLNRHISRTY  693
            +VLTQFNS SLN H+SRTY
Sbjct  137  YVLTQFNSFSLNGHLSRTY  155



>gb|AFK46347.1| unknown [Medicago truncatula]
Length=189

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
            L   +   K +  +  GGG G QLFPLT RAATPAVPVGGCYRLIDIPMSNCINSG+NKI
Sbjct  14   LSEEKLTQKMLLPLYWGGGPGVQLFPLTKRAATPAVPVGGCYRLIDIPMSNCINSGINKI  73

Query  637  FVLTQFNSASLNRHISRTYFGNGVSF  714
            FVLTQFNSASLNRHI+RTYFGNG++F
Sbjct  74   FVLTQFNSASLNRHIARTYFGNGINF  99



>gb|ABF69950.1| ADP-glucose pyrophosphorylase (glucose-1-phosphate adenylyltransferase) 
large subunit, putative [Musa acuminata]
Length=445

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
            RR A+PK+VA+IILGGGAGTQL PLT+  ATPAVP+GGCYRLIDIPMSNCINSG+NKIF+
Sbjct  4    RRTADPKSVASIILGGGAGTQLVPLTSTRATPAVPIGGCYRLIDIPMSNCINSGINKIFI  63

Query  643  LTQFNSASLNRHISRTY-FGNGVSF  714
            +TQFNSASLNRHIS TY FGNG++F
Sbjct  64   MTQFNSASLNRHISGTYNFGNGINF  88



>gb|KHN20962.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=523

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 94/137 (69%), Gaps = 5/137 (4%)
 Frame = +1

Query  283  TGFFGGKIRGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILE  462
            +GF+G   RGS+N     +  RKSLK        KPG A +V T +   E    + PI +
Sbjct  27   SGFWGENTRGSLNIR-FCSTPRKSLK----ATTFKPGFAQAVYTPDVNKEPQIFQGPIFQ  81

Query  463  RRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFV  642
              +ANP+NV AIILGGGAGT+LFPLT+  A  AVP+ GCYRLIDIPMSNCINSG  K++V
Sbjct  82   SPKANPENVVAIILGGGAGTRLFPLTSTRAKQAVPIAGCYRLIDIPMSNCINSGTRKVYV  141

Query  643  LTQFNSASLNRHISRTY  693
            LTQFNS SLN H+SRTY
Sbjct  142  LTQFNSFSLNGHLSRTY  158



>gb|KDP28372.1| hypothetical protein JCGZ_14143 [Jatropha curcas]
Length=472

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + +  +AP+L +  A+PK VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSN
Sbjct  20   DFMNFQAPVLAKPEADPKTVASIILGGGAGTRLFPLTLRRAKPAVPIGGCYRLIDVPMSN  79

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTYF-GNGVSF  714
            CINSG+NKI++LTQFNS SLNRHI+RTY  GNGV+F
Sbjct  80   CINSGINKIYILTQFNSQSLNRHIARTYNPGNGVNF  115



>ref|XP_010652349.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Vitis vinifera]
Length=486

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            G + + L  +   + +T++AP L +  A+PK VA+IILGGGAGT+LFPLT   A PAVP+
Sbjct  49   GSSAACLLADVYKDFMTLDAPELAKPEADPKTVASIILGGGAGTRLFPLTKSRAKPAVPI  108

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GGCYRLID+PMSNCINSG+NKI++LTQFNS SLNRHI+RTY  G+GV+F
Sbjct  109  GGCYRLIDVPMSNCINSGINKIYILTQFNSQSLNRHIARTYNLGSGVNF  157



>ref|XP_002994500.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
 gb|EFJ04435.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
Length=447

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 81/90 (90%), Gaps = 1/90 (1%)
 Frame = +1

Query  448  APILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGV  627
            AP + + RA+P+ V ++ILGGGAGT+LFPLTNR A PAVP+GG YRLID+PMSNCINSG+
Sbjct  1    APAIGKPRADPRTVVSLILGGGAGTRLFPLTNRRAKPAVPIGGAYRLIDVPMSNCINSGI  60

Query  628  NKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            NKIF+LTQFNSASLNRH++RTY FGNGV+F
Sbjct  61   NKIFILTQFNSASLNRHLARTYNFGNGVNF  90



>ref|XP_002274245.2| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
 ref|XP_010652348.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
Length=514

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            G + + L  +   + +T++AP L +  A+PK VA+IILGGGAGT+LFPLT   A PAVP+
Sbjct  49   GSSAACLLADVYKDFMTLDAPELAKPEADPKTVASIILGGGAGTRLFPLTKSRAKPAVPI  108

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            GGCYRLID+PMSNCINSG+NKI++LTQFNS SLNRHI+RTY  G+GV+F
Sbjct  109  GGCYRLIDVPMSNCINSGINKIYILTQFNSQSLNRHIARTYNLGSGVNF  157



>ref|XP_007163265.1| hypothetical protein PHAVU_001G219900g [Phaseolus vulgaris]
 gb|ESW35259.1| hypothetical protein PHAVU_001G219900g [Phaseolus vulgaris]
Length=530

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 15/123 (12%)
 Frame = +1

Query  391  GVAFSVLTRENGT--------------ETLTVEAPILERRRANPKNVAAIILGGGAGTQL  528
            G  FSV+TR   T              + + +++PIL  R ANPK VA+IILGGGAGT+L
Sbjct  51   GKFFSVVTRRKTTRRFLAMSTLADVANDFMALQSPILTGREANPKTVASIILGGGAGTRL  110

Query  529  FPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNG  705
            FPLT R A PAVP GGCYRL+DIPMSNCINSG+NKI+VLTQFNS SLNRHI+RTY  G  
Sbjct  111  FPLTQRRAKPAVPFGGCYRLVDIPMSNCINSGINKIYVLTQFNSQSLNRHIARTYNLGGC  170

Query  706  VSF  714
            ++F
Sbjct  171  INF  173



>ref|XP_003553688.2| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like [Glycine max]
Length=529

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + + +++PIL  R ANPK VA+IILGGGAGT+LFPLT R A PAVP GGCYRL+DIPMSN
Sbjct  77   DFMALQSPILTGREANPKTVASIILGGGAGTRLFPLTQRRAKPAVPFGGCYRLVDIPMSN  136

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CINSG+NKI+VLTQFNS SLNRHI+RTY +G  ++F
Sbjct  137  CINSGINKIYVLTQFNSQSLNRHIARTYNWGGCINF  172



>gb|KHN43393.1| Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic 
[Glycine soja]
Length=520

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = +1

Query  430  ETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSN  609
            + + +++PIL  R ANPK VA+IILGGGAGT+LFPLT R A PAVP GGCYRL+DIPMSN
Sbjct  77   DFMALQSPILTGREANPKTVASIILGGGAGTRLFPLTQRRAKPAVPFGGCYRLVDIPMSN  136

Query  610  CINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            CINSG+NKI+VLTQFNS SLNRHI+RTY +G  ++F
Sbjct  137  CINSGINKIYVLTQFNSQSLNRHIARTYNWGGCINF  172



>emb|CAN67125.1| hypothetical protein VITISV_040166 [Vitis vinifera]
Length=452

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +1

Query  439  TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCIN  618
            T++AP L +  A+PK VA+IILGGGAGT+LFPLT   A PAVP+GGCYRLID+PMSNCIN
Sbjct  3    TLDAPELAKPEADPKTVASIILGGGAGTRLFPLTKSRAKPAVPIGGCYRLIDVPMSNCIN  62

Query  619  SGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            SG+NKI++LTQFNS SLNRHI+RTY  G+GV+F
Sbjct  63   SGINKIYILTQFNSQSLNRHIARTYNLGSGVNF  95



>ref|XP_008799957.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
 ref|XP_008799959.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
Length=536

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +1

Query  442  VEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINS  621
            +EAP  ER  A+P  VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSNCINS
Sbjct  88   LEAPAFERPLADPGTVASIILGGGAGTRLFPLTRRRAKPAVPIGGCYRLIDVPMSNCINS  147

Query  622  GVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            G+NKI+VLTQFNS SLNRH++RTY  GNGV+F
Sbjct  148  GINKIYVLTQFNSQSLNRHLARTYNLGNGVNF  179



>ref|XP_009396671.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +1

Query  379  KIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATP  558
            + K G     +T     ET+ ++AP   + + + ++VA+IILGGGAG QLFPLT+  ATP
Sbjct  56   EFKAGAGVFAITSAVNKETV-IQAPRFGKHKPDARSVASIILGGGAGAQLFPLTSTRATP  114

Query  559  AVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            AVPVGGCYRLIDIPMSNCINSG+NKIF++TQFNSASLNRHI RT+ FGNG++F
Sbjct  115  AVPVGGCYRLIDIPMSNCINSGINKIFIMTQFNSASLNRHIYRTFNFGNGINF  167



>emb|CAD98749.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
Length=522

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +1

Query  307  RGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKN  486
            R  V ++  +   R S ++    R      A  VLT +       V      R  A+P  
Sbjct  30   RLKVGDSSSIRHDRASRRMCNGGRGPAATGAQCVLTSDASPADTLVLRTSFRRNYADPNE  89

Query  487  VAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSAS  666
            VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYRLIDIPMSNC NSG+NKIFV+TQFNSAS
Sbjct  90   VAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRLIDIPMSNCFNSGINKIFVMTQFNSAS  149

Query  667  LNRHISRTYFGNGVSF  714
            LNRHI RTY G G++F
Sbjct  150  LNRHIHRTYLGGGINF  165



>emb|CBI37074.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +1

Query  439  TVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCIN  618
            T++AP L +  A+PK VA+IILGGGAGT+LFPLT   A PAVP+GGCYRLID+PMSNCIN
Sbjct  11   TLDAPELAKPEADPKTVASIILGGGAGTRLFPLTKSRAKPAVPIGGCYRLIDVPMSNCIN  70

Query  619  SGVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            SG+NKI++LTQFNS SLNRHI+RTY  G+GV+F
Sbjct  71   SGINKIYILTQFNSQSLNRHIARTYNLGSGVNF  103



>ref|XP_006644406.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1, chloroplastic/amyloplastic-like [Oryza brachyantha]
Length=518

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  391  GVAFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPV  570
            G A  V T +   +TL ++    ++  A+   V+A+ILGGG G QLFPLT+  ATPAVPV
Sbjct  54   GTARCVFTSDADGDTLHLQTQSSQKNYADASRVSAVILGGGTGVQLFPLTSTMATPAVPV  113

Query  571  GGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            GGCYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  114  GGCYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  161



>sp|P12299.2|GLGL2_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Triticum aestivum]
 emb|CAA79980.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
 gb|ABG88200.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
Length=522

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +1

Query  307  RGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKN  486
            R  V ++  +   R S ++    R      A  VLT +       V      R  A+P  
Sbjct  30   RLKVGDSSSIRHERASRRMCNGGRGPAATGAQCVLTSDASPADTLVLRTSFRRNYADPNE  89

Query  487  VAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSAS  666
            VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYRLIDIPMSNC NSG+NKIFV+TQFNSAS
Sbjct  90   VAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRLIDIPMSNCFNSGINKIFVMTQFNSAS  149

Query  667  LNRHISRTYFGNGVSF  714
            LNRHI RTY G G++F
Sbjct  150  LNRHIHRTYLGGGINF  165



>gb|EMT32758.1| hypothetical protein F775_52189 [Aegilops tauschii]
Length=574

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +1

Query  307  RGSVNNNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKN  486
            R  V ++  +   R S ++    R      A  VLT +       V      R  A+P  
Sbjct  27   RLKVGDSSSIRHERASRRMCNGGRGPAATGAQCVLTSDASPADTLVLRTSFRRNYADPNE  86

Query  487  VAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSAS  666
            VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYRLIDIPMSNC NSG+NKIFV+TQFNSAS
Sbjct  87   VAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRLIDIPMSNCFNSGINKIFVMTQFNSAS  146

Query  667  LNRHISRTYFGNGVSF  714
            LNRHI RTY G G++F
Sbjct  147  LNRHIHRTYLGGGINF  162



>sp|P30524.2|GLGL1_HORVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; AltName: Full=BEPL; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA47626.1| glucose-1-phosphate adenylyltransferase [Hordeum vulgare subsp. 
vulgare]
 emb|CAX51355.1| large subunit of ADP-glucose pyrophosphorylase [Hordeum vulgare 
subsp. vulgare]
 dbj|BAK04629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93393.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93437.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AHA11390.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT +       V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  61   AQCVLTSDASPADTLVLRTSFRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  120

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  121  CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  166



>gb|AHA11391.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  397  AFSVLTRENGTETLTVEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGG  576
            A  VLT +       V      R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GG
Sbjct  61   AQCVLTSDASPADTLVLRTSFRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGG  120

Query  577  CYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHISRTYFGNGVSF  714
            CYRLIDIPMSNC NSG+NKIFV+TQFNSASLNRHI RTY G G++F
Sbjct  121  CYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGINF  166



>gb|EMS53815.1| Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic/amyloplastic 
[Triticum urartu]
Length=458

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  457  LERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKI  636
              R  A+P  VAA+ILGGG GTQLFPLT+  ATPAVP+GGCYRLIDIPMSNC NSG+NKI
Sbjct  29   FRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPAVPIGGCYRLIDIPMSNCFNSGINKI  88

Query  637  FVLTQFNSASLNRHISRTYFGNGVSF  714
            FV+TQFNSASLNRHI RTY G G++F
Sbjct  89   FVMTQFNSASLNRHIHRTYLGGGINF  114



>gb|KEH36175.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=530

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 101/151 (67%), Gaps = 12/151 (8%)
 Frame = +1

Query  277  RETGFFGGKIRGSVNNN-VLVNQSRKSLKLEENKRKIKPGVAFSVLTR---ENGTETLTV  444
            R + F G   +GS++    L  QS KS          K G   +VLT    ++   T   
Sbjct  30   RNSVFLGETTKGSLSTTRFLTIQSPKSFNP-------KNGAEHNVLTSGINDHQDSTTFQ  82

Query  445  EAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSG  624
            E P  E  +A+PK+VA+IILGGGAGT+LFPLT++ A PAVP+GGCYRLIDIPMSNCINSG
Sbjct  83   EGPYFETPKADPKSVASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSG  142

Query  625  VNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            + KIF+LTQ+NS SLNRH+SR Y FGN  +F
Sbjct  143  IRKIFILTQYNSFSLNRHLSRAYNFGNVSTF  173



>ref|XP_002515141.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF47125.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=528

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 80/91 (88%), Gaps = 1/91 (1%)
 Frame = +1

Query  445  EAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSG  624
            +A +L ++ A+PK VA+IILGGGAGT+LFPLT   A PAVP+GGCYRLID+PMSNCINSG
Sbjct  81   QATVLRKQEADPKTVASIILGGGAGTRLFPLTRTRAKPAVPIGGCYRLIDVPMSNCINSG  140

Query  625  VNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            +NKI++LTQFNS SLNRHI+RTY  GNGV+F
Sbjct  141  INKIYILTQFNSQSLNRHIARTYNSGNGVNF  171



>gb|AHG12640.1| ADP-glucose pyrophosphorylase large subunit [Nicotiana tabacum]
Length=515

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = +1

Query  322  NNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAII  501
            N  L+ +  K  K +     +KP +  S+     G   L      LE  +A+ + V AII
Sbjct  36   NGELMGKKLKFTKFQLRSNVVKPNICMSLTADVAGEAKLKD----LEPEKADTRTVVAII  91

Query  502  LGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHI  681
            LGGGAGT+LFPLT R A PAVP+GG YRLID+PMSNCINSG+NK+++LTQFNSASLNRHI
Sbjct  92   LGGGAGTRLFPLTKRRAKPAVPIGGAYRLIDVPMSNCINSGINKVYILTQFNSASLNRHI  151

Query  682  SRTY-FGNGVSF  714
            +R Y FGNGV+F
Sbjct  152  ARAYNFGNGVTF  163



>ref|XP_010914842.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Elaeis guineensis]
Length=481

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +1

Query  442  VEAPILERRRANPKNVAAIILGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINS  621
            V+AP  ER   +P  VA+IILGGGAGT+LFPLT R A PAVP+GGCYRLID+PMSNCINS
Sbjct  89   VDAPAFERPLVDPGTVASIILGGGAGTRLFPLTRRRAKPAVPIGGCYRLIDVPMSNCINS  148

Query  622  GVNKIFVLTQFNSASLNRHISRTY-FGNGVSF  714
            G+NKI+VLTQFNS SLN H++RTY  GNGV+F
Sbjct  149  GINKIYVLTQFNSQSLNHHLARTYNLGNGVNF  180



>ref|XP_009760082.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic/amyloplastic [Nicotiana sylvestris]
Length=520

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = +1

Query  322  NNVLVNQSRKSLKLEENKRKIKPGVAFSVLTRENGTETLTVEAPILERRRANPKNVAAII  501
            N  L+ +  K  K +     +KP +  S+     G   L      LE  +A+ + V AII
Sbjct  36   NGELMGKKLKFTKFQLRSNVVKPNICMSLTADVAGEAKLKD----LEPEKADTRTVVAII  91

Query  502  LGGGAGTQLFPLTNRAATPAVPVGGCYRLIDIPMSNCINSGVNKIFVLTQFNSASLNRHI  681
            LGGGAGT+LFPLT R A PAVP+GG YRLID+PMSNCINSG+NK+++LTQFNSASLNRHI
Sbjct  92   LGGGAGTRLFPLTKRRAKPAVPIGGAYRLIDVPMSNCINSGINKVYILTQFNSASLNRHI  151

Query  682  SRTY-FGNGVSF  714
            +R Y FGNGV+F
Sbjct  152  ARAYNFGNGVTF  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395