BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043K13

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13254.1|  unnamed protein product                                390   5e-130   Coffea canephora [robusta coffee]
ref|XP_009765489.1|  PREDICTED: uncharacterized protein LOC104217035    389   4e-129   Nicotiana sylvestris
ref|XP_002515055.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    387   3e-128   Ricinus communis
gb|KHG05074.1|  Endoglucanase                                           387   3e-128   Gossypium arboreum [tree cotton]
gb|KJB15656.1|  hypothetical protein B456_002G188600                    387   3e-128   Gossypium raimondii
gb|KDO82155.1|  hypothetical protein CISIN_1g008330mg                   381   1e-127   Citrus sinensis [apfelsine]
ref|XP_011034023.1|  PREDICTED: uncharacterized protein LOC105132312    385   1e-127   Populus euphratica
ref|XP_004245178.1|  PREDICTED: uncharacterized protein LOC101258288    385   1e-127   
ref|XP_002312657.2|  hypothetical protein POPTR_0008s18380g             385   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_007223308.1|  hypothetical protein PRUPE_ppa003807mg             384   3e-127   Prunus persica
ref|XP_006378253.1|  hypothetical protein POPTR_0010s059502g            378   6e-127   
ref|XP_006367511.1|  PREDICTED: uncharacterized protein LOC102589547    382   1e-126   
ref|XP_008221942.1|  PREDICTED: uncharacterized protein LOC103321869    383   2e-126   
ref|XP_002285424.1|  PREDICTED: uncharacterized protein LOC100244027    381   5e-126   Vitis vinifera
ref|XP_006438205.1|  hypothetical protein CICLE_v10031098mg             381   5e-126   Citrus clementina [clementine]
ref|XP_006483983.1|  PREDICTED: uncharacterized protein LOC102624331    381   1e-125   Citrus sinensis [apfelsine]
gb|KDO82151.1|  hypothetical protein CISIN_1g008330mg                   380   1e-125   Citrus sinensis [apfelsine]
ref|XP_002315653.2|  hypothetical protein POPTR_0010s05960g             373   3e-125   
ref|XP_004239150.1|  PREDICTED: uncharacterized protein LOC101248575    379   3e-125   Solanum lycopersicum
ref|XP_009359244.1|  PREDICTED: uncharacterized protein LOC103949843    379   4e-125   Pyrus x bretschneideri [bai li]
ref|XP_010250986.1|  PREDICTED: uncharacterized protein LOC104593039    379   4e-125   Nelumbo nucifera [Indian lotus]
ref|XP_011042368.1|  PREDICTED: uncharacterized protein LOC105138075    378   5e-125   Populus euphratica
ref|XP_011042367.1|  PREDICTED: uncharacterized protein LOC105138074    377   1e-124   Populus euphratica
gb|KDP26669.1|  hypothetical protein JCGZ_17827                         376   4e-124   Jatropha curcas
ref|XP_010248702.1|  PREDICTED: uncharacterized protein LOC104591536    374   4e-123   Nelumbo nucifera [Indian lotus]
ref|XP_007044872.1|  Cellulase protein                                  372   2e-122   
gb|EYU30606.1|  hypothetical protein MIMGU_mgv1a018920mg                370   3e-122   Erythranthe guttata [common monkey flower]
ref|XP_007159685.1|  hypothetical protein PHAVU_002G258500g             370   1e-121   Phaseolus vulgaris [French bean]
ref|XP_010100346.1|  hypothetical protein L484_027655                   369   2e-121   
ref|XP_010904543.1|  PREDICTED: uncharacterized protein LOC105031942    368   6e-121   Elaeis guineensis
ref|XP_008389746.1|  PREDICTED: uncharacterized protein LOC103452050    368   7e-121   
ref|XP_008446127.1|  PREDICTED: uncharacterized protein LOC103488945    368   8e-121   Cucumis melo [Oriental melon]
gb|KEH20742.1|  cellulase (glycosyl hydrolase family 5)                 367   2e-120   Medicago truncatula
gb|KGN51727.1|  hypothetical protein Csa_5G593400                       365   6e-120   Cucumis sativus [cucumbers]
ref|XP_004135502.1|  PREDICTED: uncharacterized protein LOC101217177    365   6e-120   
ref|XP_008793719.1|  PREDICTED: uncharacterized protein LOC103709945    364   1e-119   
ref|XP_010682344.1|  PREDICTED: uncharacterized protein LOC104897211    363   6e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003539156.1|  PREDICTED: uncharacterized protein LOC100816102    362   6e-119   Glycine max [soybeans]
ref|XP_007132485.1|  hypothetical protein PHAVU_011G098000g             362   6e-119   Phaseolus vulgaris [French bean]
ref|XP_004504142.1|  PREDICTED: uncharacterized protein LOC101503968    362   9e-119   Cicer arietinum [garbanzo]
ref|XP_008236799.1|  PREDICTED: uncharacterized protein LOC103335561    362   1e-118   Prunus mume [ume]
gb|KJB78033.1|  hypothetical protein B456_012G173600                    359   3e-117   Gossypium raimondii
ref|XP_010044528.1|  PREDICTED: uncharacterized protein LOC104433472    358   5e-117   Eucalyptus grandis [rose gum]
ref|XP_010249431.1|  PREDICTED: uncharacterized protein LOC104591975    357   9e-117   Nelumbo nucifera [Indian lotus]
ref|XP_004309996.1|  PREDICTED: uncharacterized protein LOC101307271    357   9e-117   Fragaria vesca subsp. vesca
gb|AES72136.2|  cellulase (glycosyl hydrolase family 5)                 359   1e-116   Medicago truncatula
ref|XP_003601885.1|  Endoglucanase                                      359   2e-116   
ref|XP_008389747.1|  PREDICTED: uncharacterized protein LOC103452051    354   1e-115   
gb|KHN29014.1|  Endoglucanase                                           354   1e-115   Glycine soja [wild soybean]
ref|XP_003532808.1|  PREDICTED: uncharacterized protein LOC100818309    354   3e-115   Glycine max [soybeans]
ref|XP_009387346.1|  PREDICTED: uncharacterized protein LOC103974285    348   1e-114   
gb|KHN06534.1|  Endoglucanase                                           352   2e-114   Glycine soja [wild soybean]
ref|XP_004504189.1|  PREDICTED: uncharacterized protein LOC101490831    350   2e-114   Cicer arietinum [garbanzo]
ref|XP_003524249.1|  PREDICTED: uncharacterized protein LOC100789885    352   2e-114   Glycine max [soybeans]
ref|XP_011086688.1|  PREDICTED: uncharacterized protein LOC105168334    345   1e-111   Sesamum indicum [beniseed]
gb|KCW59703.1|  hypothetical protein EUGRSUZ_H02464                     341   2e-111   Eucalyptus grandis [rose gum]
emb|CDY40992.1|  BnaA02g27820D                                          338   4e-111   Brassica napus [oilseed rape]
ref|XP_010250979.1|  PREDICTED: uncharacterized protein LOC104593...    342   5e-111   
ref|XP_009385963.1|  PREDICTED: uncharacterized protein LOC103973...    342   9e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385956.1|  PREDICTED: uncharacterized protein LOC103973...    342   2e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010458756.1|  PREDICTED: uncharacterized protein LOC104739...    340   2e-110   
gb|AAD31066.1|AC007357_15  F3F19.15                                     340   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292902.1|  hypothetical protein CARUB_v10019167mg             339   2e-110   
ref|NP_172772.2|  Cellulase (glycosyl hydrolase family 5) protein       340   3e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395579.1|  hypothetical protein EUTSA_v10003968mg             339   4e-110   
ref|XP_010495004.1|  PREDICTED: uncharacterized protein LOC104772051    340   4e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006307168.1|  hypothetical protein CARUB_v10008758mg             340   5e-110   Capsella rubella
ref|XP_006395580.1|  hypothetical protein EUTSA_v10003968mg             339   6e-110   Eutrema salsugineum [saltwater cress]
ref|XP_010458755.1|  PREDICTED: uncharacterized protein LOC104739...    339   6e-110   Camelina sativa [gold-of-pleasure]
ref|XP_002876948.1|  glycosyl hydrolase family 5 protein                338   7e-110   
ref|XP_006417151.1|  hypothetical protein EUTSA_v10007253mg             340   7e-110   Eutrema salsugineum [saltwater cress]
ref|XP_003552802.1|  PREDICTED: uncharacterized protein LOC100805196    338   9e-110   Glycine max [soybeans]
ref|XP_010514260.1|  PREDICTED: uncharacterized protein LOC104790246    337   1e-109   
ref|XP_010026597.1|  PREDICTED: uncharacterized protein LOC104416968    337   1e-109   
ref|XP_010425288.1|  PREDICTED: uncharacterized protein LOC104710406    338   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010026600.1|  PREDICTED: uncharacterized protein LOC104416972    341   2e-109   Eucalyptus grandis [rose gum]
ref|XP_010026596.1|  PREDICTED: uncharacterized protein LOC104416965    336   4e-109   
ref|NP_189245.1|  Cellulase (glycosyl hydrolase family 5) protein       336   6e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159684.1|  hypothetical protein PHAVU_002G258400g             338   7e-109   Phaseolus vulgaris [French bean]
ref|XP_010691763.1|  PREDICTED: uncharacterized protein LOC104905020    336   7e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010476303.1|  PREDICTED: uncharacterized protein LOC104755594    337   8e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010502524.1|  PREDICTED: uncharacterized protein LOC104779826    335   2e-108   
ref|XP_002889989.1|  glycosyl hydrolase family 5 protein                335   3e-108   Arabidopsis lyrata subsp. lyrata
ref|XP_010249430.1|  PREDICTED: uncharacterized protein LOC104591974    335   4e-108   
emb|CDY16066.1|  BnaC08g40570D                                          335   4e-108   Brassica napus [oilseed rape]
dbj|BAK05121.1|  predicted protein                                      335   5e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009152076.1|  PREDICTED: uncharacterized protein LOC103875318    334   9e-108   Brassica rapa
emb|CDY13613.1|  BnaA06g33100D                                          334   1e-107   Brassica napus [oilseed rape]
ref|XP_010250982.1|  PREDICTED: uncharacterized protein LOC104593...    333   2e-107   
emb|CDY19395.1|  BnaC05g09040D                                          333   2e-107   Brassica napus [oilseed rape]
gb|KFK43579.1|  hypothetical protein AALP_AA1G144700                    336   2e-107   Arabis alpina [alpine rockcress]
ref|NP_001130915.1|  hydrolase, hydrolyzing O-glycosyl compound p...    333   2e-107   Zea mays [maize]
gb|ACF79301.1|  unknown                                                 333   2e-107   Zea mays [maize]
emb|CDX83590.1|  BnaC07g23300D                                          333   3e-107   
ref|XP_010556350.1|  PREDICTED: uncharacterized protein LOC104825676    332   1e-106   Tarenaya hassleriana [spider flower]
ref|XP_009148543.1|  PREDICTED: uncharacterized protein LOC103871957    331   3e-106   Brassica rapa
ref|XP_006395581.1|  hypothetical protein EUTSA_v10003934mg             330   4e-106   
emb|CDX98009.1|  BnaA06g07600D                                          329   9e-106   
ref|XP_009152075.1|  PREDICTED: uncharacterized protein LOC103875317    328   1e-105   Brassica rapa
ref|XP_010026595.1|  PREDICTED: uncharacterized protein LOC104416964    328   2e-105   Eucalyptus grandis [rose gum]
gb|KCW59699.1|  hypothetical protein EUGRSUZ_H02457                     327   2e-105   Eucalyptus grandis [rose gum]
ref|XP_002446675.1|  hypothetical protein SORBIDRAFT_06g020270          328   4e-105   Sorghum bicolor [broomcorn]
ref|XP_010528075.1|  PREDICTED: uncharacterized protein LOC104805267    327   8e-105   Tarenaya hassleriana [spider flower]
ref|XP_010026599.1|  PREDICTED: uncharacterized protein LOC104416971    322   1e-104   Eucalyptus grandis [rose gum]
ref|XP_010535458.1|  PREDICTED: uncharacterized protein LOC104810759    320   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_006648806.1|  PREDICTED: uncharacterized protein LOC102721430    318   2e-104   
ref|XP_002284888.2|  PREDICTED: uncharacterized protein LOC100258876    324   3e-104   Vitis vinifera
ref|XP_004975985.1|  PREDICTED: uncharacterized protein LOC101760765    325   4e-104   Setaria italica
ref|XP_006290844.1|  hypothetical protein CARUB_v10016955mg             325   4e-104   
gb|KFK33555.1|  hypothetical protein AALP_AA5G028800                    324   7e-104   Arabis alpina [alpine rockcress]
ref|XP_010240029.1|  PREDICTED: uncharacterized protein LOC100839976    323   3e-103   Brachypodium distachyon [annual false brome]
ref|NP_189244.1|  Cellulase (glycosyl hydrolase family 5) protein       322   4e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556349.1|  PREDICTED: uncharacterized protein LOC104825675    322   5e-103   Tarenaya hassleriana [spider flower]
dbj|BAB02432.1|  unnamed protein product                                322   7e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876947.1|  predicted protein                                  321   1e-102   
gb|EMT10461.1|  Endoglucanase E1                                        318   3e-102   
ref|XP_010514258.1|  PREDICTED: uncharacterized protein LOC104790245    320   4e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002284895.1|  PREDICTED: uncharacterized protein LOC100253729    318   4e-102   Vitis vinifera
ref|XP_002284881.1|  PREDICTED: uncharacterized protein LOC100264047    318   6e-102   Vitis vinifera
ref|NP_001047320.1|  Os02g0596200                                       315   1e-101   
gb|AIZ06017.1|  hypothetical protein                                    318   2e-101   Zea nicaraguensis
gb|EEE61202.1|  hypothetical protein OsJ_15212                          318   3e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010502521.1|  PREDICTED: uncharacterized protein LOC104779823    315   3e-100   Camelina sativa [gold-of-pleasure]
gb|EEC77495.1|  hypothetical protein OsI_16343                          315   3e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_002446674.1|  hypothetical protein SORBIDRAFT_06g020260          314   5e-100   Sorghum bicolor [broomcorn]
gb|EAZ23667.1|  hypothetical protein OsJ_07369                          315   6e-100   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132121.1|  hypothetical protein precursor                     312   4e-99    Zea mays [maize]
gb|EAY86525.1|  hypothetical protein OsI_07905                          311   2e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_003579979.1|  PREDICTED: uncharacterized protein LOC100845861    310   2e-98    Brachypodium distachyon [annual false brome]
gb|AFW62836.1|  hypothetical protein ZEAMMB73_750687                    304   4e-98    
ref|XP_006400290.1|  hypothetical protein EUTSA_v10015581mg             307   2e-97    Eutrema salsugineum [saltwater cress]
dbj|BAK00694.1|  predicted protein                                      307   3e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008678767.1|  PREDICTED: uncharacterized protein LOC100501...    305   2e-96    Zea mays [maize]
ref|XP_002871770.1|  glycosyl hydrolase family 5 protein                303   5e-96    
ref|XP_006289374.1|  hypothetical protein CARUB_v10002868mg             303   5e-96    Capsella rubella
ref|XP_002452393.1|  hypothetical protein SORBIDRAFT_04g024910          303   1e-95    
ref|XP_008793758.1|  PREDICTED: uncharacterized protein LOC103709981    303   1e-95    
ref|XP_010492706.1|  PREDICTED: uncharacterized protein LOC104770057    301   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010248706.1|  PREDICTED: uncharacterized protein LOC104591...    301   4e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010248705.1|  PREDICTED: uncharacterized protein LOC104591...    301   4e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010420476.1|  PREDICTED: uncharacterized protein LOC104706046    300   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_004955049.1|  PREDICTED: uncharacterized protein LOC101776534    301   7e-95    Setaria italica
ref|XP_010492589.1|  PREDICTED: uncharacterized protein LOC104769...    298   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010549752.1|  PREDICTED: uncharacterized protein LOC104820833    299   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_009107523.1|  PREDICTED: uncharacterized protein LOC103833179    298   2e-94    Brassica rapa
ref|XP_010453833.1|  PREDICTED: uncharacterized protein LOC104735704    297   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010492588.1|  PREDICTED: uncharacterized protein LOC104769...    298   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_004975980.1|  PREDICTED: uncharacterized protein LOC101758857    299   3e-94    Setaria italica
ref|XP_004975262.1|  PREDICTED: uncharacterized protein LOC101779133    299   9e-94    Setaria italica
ref|NP_197252.1|  Glycosyl hydrolase superfamily protein                296   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437048.1|  PREDICTED: uncharacterized protein LOC104720...    295   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010437042.1|  PREDICTED: uncharacterized protein LOC104720...    295   3e-93    Camelina sativa [gold-of-pleasure]
gb|KHN43979.1|  Endoglucanase E1                                        293   9e-93    Glycine soja [wild soybean]
ref|XP_006652422.1|  PREDICTED: uncharacterized protein LOC102702088    295   9e-93    Oryza brachyantha
ref|XP_010904544.1|  PREDICTED: uncharacterized protein LOC105031943    294   3e-92    Elaeis guineensis
gb|EAY94563.1|  hypothetical protein OsI_16341                          294   3e-92    Oryza sativa Indica Group [Indian rice]
gb|KHN06535.1|  Endoglucanase                                           290   1e-91    Glycine soja [wild soybean]
gb|EMT27118.1|  hypothetical protein F775_19072                         293   2e-91    
emb|CDX94333.1|  BnaC01g18510D                                          285   2e-91    
ref|XP_010420372.1|  PREDICTED: uncharacterized protein LOC104705962    290   3e-91    Camelina sativa [gold-of-pleasure]
ref|NP_001053105.1|  Os04g0480900                                       291   3e-91    
ref|NP_197172.1|  glycosyl hydrolase family protein                     289   4e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CDY38435.1|  BnaA10g17230D                                          290   5e-91    Brassica napus [oilseed rape]
gb|KCW59700.1|  hypothetical protein EUGRSUZ_H02458                     290   5e-91    Eucalyptus grandis [rose gum]
emb|CDY16914.1|  BnaC09g40410D                                          290   5e-91    Brassica napus [oilseed rape]
emb|CDX69429.1|  BnaA10g17780D                                          290   6e-91    
gb|EEC77494.1|  hypothetical protein OsI_16340                          290   7e-91    Oryza sativa Indica Group [Indian rice]
emb|CAH67676.1|  H0510A06.1                                             290   9e-91    Oryza sativa [red rice]
ref|XP_009121461.1|  PREDICTED: uncharacterized protein LOC103846308    288   1e-90    Brassica rapa
emb|CAH66880.1|  OSIGBa0158F13.11                                       290   1e-90    Oryza sativa [red rice]
ref|XP_009126336.1|  PREDICTED: uncharacterized protein LOC103851244    280   2e-90    Brassica rapa
ref|XP_006400209.1|  hypothetical protein EUTSA_v10015466mg             287   2e-90    Eutrema salsugineum [saltwater cress]
gb|KFK25904.1|  hypothetical protein AALP_AA8G177600                    288   2e-90    Arabis alpina [alpine rockcress]
ref|XP_009121460.1|  PREDICTED: uncharacterized protein LOC103846306    288   3e-90    Brassica rapa
emb|CAD41089.2|  OSJNBb0011N17.6                                        289   3e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002871731.1|  glycosyl hydrolase family 5 protein                286   5e-90    
ref|XP_009142284.1|  PREDICTED: uncharacterized protein LOC103866155    286   7e-90    Brassica rapa
ref|XP_009142293.1|  PREDICTED: uncharacterized protein LOC103866164    286   8e-90    Brassica rapa
ref|XP_009126137.1|  PREDICTED: uncharacterized protein LOC103851062    286   9e-90    Brassica rapa
emb|CDY38091.1|  BnaC02g06820D                                          286   9e-90    Brassica napus [oilseed rape]
emb|CAH67677.1|  H0510A06.2                                             287   1e-89    Oryza sativa [red rice]
emb|CDX89335.1|  BnaA01g15580D                                          286   2e-89    
gb|ACU18247.1|  unknown                                                 275   2e-89    Glycine max [soybeans]
gb|KHN19917.1|  hypothetical protein glysoja_032397                     284   3e-89    Glycine soja [wild soybean]
gb|EYU23408.1|  hypothetical protein MIMGU_mgv1a020519mg                286   3e-89    Erythranthe guttata [common monkey flower]
emb|CAD41090.2|  OSJNBb0011N17.7                                        285   8e-89    Oryza sativa Japonica Group [Japonica rice]
gb|EYU23411.1|  hypothetical protein MIMGU_mgv1a004205mg                285   1e-88    Erythranthe guttata [common monkey flower]
gb|AFW62835.1|  hypothetical protein ZEAMMB73_750687                    278   4e-88    
gb|EPS62091.1|  hypothetical protein M569_12701                         280   4e-87    Genlisea aurea
ref|XP_011080895.1|  PREDICTED: uncharacterized protein LOC105164045    280   6e-87    Sesamum indicum [beniseed]
ref|XP_008678768.1|  PREDICTED: uncharacterized protein LOC100501...    279   1e-86    Zea mays [maize]
ref|XP_002272422.2|  PREDICTED: uncharacterized protein LOC100245045    275   2e-85    Vitis vinifera
ref|XP_010658499.1|  PREDICTED: uncharacterized protein LOC100267...    274   4e-85    
gb|ABR17494.1|  unknown                                                 275   5e-85    Picea sitchensis
ref|XP_002272454.2|  PREDICTED: uncharacterized protein LOC100267...    274   3e-84    
gb|EMS46776.1|  hypothetical protein TRIUR3_23304                       264   7e-84    Triticum urartu
ref|XP_002272491.1|  PREDICTED: uncharacterized protein LOC100262188    271   9e-84    Vitis vinifera
ref|XP_009381699.1|  PREDICTED: uncharacterized protein LOC103969775    269   2e-83    
gb|ACF85134.1|  unknown                                                 270   2e-83    Zea mays [maize]
ref|XP_002272534.1|  PREDICTED: uncharacterized protein LOC100257079    270   4e-83    Vitis vinifera
emb|CBI34404.3|  unnamed protein product                                270   7e-83    Vitis vinifera
ref|XP_010053198.1|  PREDICTED: uncharacterized protein LOC104441706    268   3e-82    Eucalyptus grandis [rose gum]
ref|XP_002893942.1|  predicted protein                                  264   5e-82    
ref|XP_002272386.2|  PREDICTED: uncharacterized protein LOC100250178    267   5e-82    Vitis vinifera
ref|XP_006439449.1|  hypothetical protein CICLE_v10023534mg             266   1e-81    
emb|CBI34405.3|  unnamed protein product                                275   1e-81    Vitis vinifera
emb|CDX83591.1|  BnaC07g23310D                                          261   1e-80    
ref|XP_008467257.1|  PREDICTED: uncharacterized protein LOC103504654    262   3e-80    Cucumis melo [Oriental melon]
ref|XP_011080894.1|  PREDICTED: uncharacterized protein LOC105164044    256   3e-79    
gb|KGN50395.1|  hypothetical protein Csa_5G171770                       258   1e-78    Cucumis sativus [cucumbers]
gb|KGN50394.1|  hypothetical protein Csa_5G171760                       258   2e-78    Cucumis sativus [cucumbers]
emb|CDY13614.1|  BnaA06g33090D                                          255   3e-78    Brassica napus [oilseed rape]
gb|EYU23409.1|  hypothetical protein MIMGU_mgv1a004243mg                257   3e-78    Erythranthe guttata [common monkey flower]
ref|XP_008459280.1|  PREDICTED: uncharacterized protein LOC103498458    261   5e-78    Cucumis melo [Oriental melon]
ref|XP_008810943.1|  PREDICTED: uncharacterized protein LOC103722247    254   6e-77    
ref|XP_004168760.1|  PREDICTED: uncharacterized protein LOC101223816    251   7e-76    
ref|XP_009773950.1|  PREDICTED: uncharacterized protein LOC104224082    251   8e-76    Nicotiana sylvestris
ref|XP_009605826.1|  PREDICTED: uncharacterized protein LOC104100317    250   1e-75    Nicotiana tomentosiformis
gb|EYU23410.1|  hypothetical protein MIMGU_mgv1a004297mg                247   2e-74    Erythranthe guttata [common monkey flower]
ref|XP_010325669.1|  PREDICTED: uncharacterized protein LOC101257885    244   1e-73    Solanum lycopersicum
ref|XP_001767510.1|  predicted protein                                  240   2e-73    
gb|KDP25366.1|  hypothetical protein JCGZ_20522                         245   2e-73    Jatropha curcas
emb|CDP12092.1|  unnamed protein product                                250   7e-73    Coffea canephora [robusta coffee]
gb|KFK38059.1|  hypothetical protein AALP_AA3G064700                    240   1e-72    Arabis alpina [alpine rockcress]
ref|XP_002509879.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    241   5e-72    Ricinus communis
ref|XP_002509878.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    239   1e-71    
gb|KDP25365.1|  hypothetical protein JCGZ_20521                         245   4e-71    Jatropha curcas
ref|XP_007159232.1|  hypothetical protein PHAVU_002G220300g             238   5e-71    Phaseolus vulgaris [French bean]
ref|XP_003621386.1|  Endoglucanase E1                                   235   5e-71    
emb|CDY16991.1|  BnaC09g41180D                                          236   2e-70    Brassica napus [oilseed rape]
ref|XP_003621369.1|  Endoglucanase E1                                   236   3e-70    
ref|XP_010261410.1|  PREDICTED: uncharacterized protein LOC104600255    233   4e-70    Nelumbo nucifera [Indian lotus]
emb|CBI34407.3|  unnamed protein product                                234   5e-70    Vitis vinifera
gb|AES77604.2|  hydrolyzing O-glycosyl compounds hydrolase              236   5e-70    Medicago truncatula
ref|XP_007135020.1|  hypothetical protein PHAVU_010G095100g             234   8e-70    Phaseolus vulgaris [French bean]
ref|XP_001769398.1|  predicted protein                                  230   1e-69    
gb|KEH18775.1|  hydrolyzing O-glycosyl compounds hydrolase              233   5e-69    Medicago truncatula
ref|XP_004510834.1|  PREDICTED: uncharacterized protein LOC101496378    232   1e-68    
ref|XP_010916958.1|  PREDICTED: uncharacterized protein LOC105041671    229   5e-68    
ref|XP_003621392.1|  Endoglucanase E1                                   230   5e-68    
gb|AES77610.2|  hydrolyzing O-glycosyl compounds hydrolase              230   5e-68    Medicago truncatula
gb|KGN45940.1|  hypothetical protein Csa_6G028440                       229   2e-67    Cucumis sativus [cucumbers]
ref|XP_003621368.1|  Endoglucanase                                      226   3e-67    
ref|XP_002509877.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    228   8e-67    
gb|KHN45741.1|  Endoglucanase                                           227   1e-66    Glycine soja [wild soybean]
gb|KEH28356.1|  hydrolyzing O-glycosyl compounds hydrolase              226   2e-66    Medicago truncatula
ref|XP_004170746.1|  PREDICTED: endoglucanase E1-like                   226   3e-66    
gb|KHG22500.1|  Endoglucanase E1                                        225   3e-66    Gossypium arboreum [tree cotton]
ref|XP_003608279.1|  Endoglucanase                                      223   2e-65    Medicago truncatula
emb|CBI16819.3|  unnamed protein product                                216   4e-65    Vitis vinifera
ref|XP_004158142.1|  PREDICTED: uncharacterized LOC101213113            219   6e-65    
ref|XP_004143723.1|  PREDICTED: uncharacterized protein LOC101213113    219   2e-63    Cucumis sativus [cucumbers]
ref|XP_003617143.1|  Oligoribonuclease                                  227   2e-63    
ref|XP_008467306.1|  PREDICTED: uncharacterized protein LOC103504686    218   4e-63    Cucumis melo [Oriental melon]
ref|XP_002298005.2|  hypothetical protein POPTR_0001s10020g             210   3e-60    
ref|XP_011026965.1|  PREDICTED: uncharacterized protein LOC105127394    208   1e-59    Populus euphratica
ref|XP_006653527.1|  PREDICTED: uncharacterized protein LOC102709173    203   2e-59    
ref|XP_006341815.1|  PREDICTED: uncharacterized protein LOC102587665    204   6e-59    
gb|KGN50047.1|  hypothetical protein Csa_5G151630                       204   7e-58    Cucumis sativus [cucumbers]
ref|XP_004143963.1|  PREDICTED: uncharacterized protein LOC101211910    203   1e-57    
gb|KDP25367.1|  hypothetical protein JCGZ_20523                         201   3e-57    Jatropha curcas
ref|XP_006344017.1|  PREDICTED: uncharacterized protein LOC102582487    200   5e-57    Solanum tuberosum [potatoes]
gb|EEC73517.1|  hypothetical protein OsI_07900                          194   7e-57    Oryza sativa Indica Group [Indian rice]
gb|EPS64690.1|  hypothetical protein M569_10090                         197   9e-57    Genlisea aurea
ref|XP_008437726.1|  PREDICTED: uncharacterized protein LOC103483073    199   4e-56    Cucumis melo [Oriental melon]
ref|XP_004170960.1|  PREDICTED: uncharacterized LOC101217177            196   8e-56    
ref|XP_008437728.1|  PREDICTED: uncharacterized protein LOC103483074    195   4e-55    Cucumis melo [Oriental melon]
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       197   4e-54    Glycine soja [wild soybean]
gb|AFK46453.1|  unknown                                                 181   2e-53    Lotus japonicus
gb|KGN57439.1|  hypothetical protein Csa_3G186170                       183   2e-53    Cucumis sativus [cucumbers]
gb|KDO82152.1|  hypothetical protein CISIN_1g008330mg                   187   1e-52    Citrus sinensis [apfelsine]
emb|CDX69431.1|  BnaA10g17800D                                          187   2e-52    
ref|XP_004143962.1|  PREDICTED: uncharacterized protein LOC101211675    187   3e-52    Cucumis sativus [cucumbers]
gb|EPS61076.1|  hypothetical protein M569_13724                         186   4e-52    Genlisea aurea
ref|XP_010497223.1|  PREDICTED: uncharacterized protein LOC104774279    183   7e-52    Camelina sativa [gold-of-pleasure]
gb|KGN57438.1|  hypothetical protein Csa_3G185670                       184   2e-51    Cucumis sativus [cucumbers]
emb|CDP16213.1|  unnamed protein product                                185   3e-51    Coffea canephora [robusta coffee]
gb|KHN04647.1|  Endoglucanase                                           183   8e-51    Glycine soja [wild soybean]
emb|CBI20317.3|  unnamed protein product                                173   3e-50    Vitis vinifera
gb|EKG14335.1|  Glycoside hydrolase family 5                            178   3e-49    
emb|CBI20315.3|  unnamed protein product                                170   3e-49    
emb|CDY34588.1|  BnaC03g56880D                                          176   4e-49    
ref|XP_010494994.1|  PREDICTED: uncharacterized protein LOC104772040    176   6e-49    
dbj|GAM34669.1|  hypothetical protein TCE0_015f02391                    177   9e-49    
ref|XP_002340189.1|  cellulase family protein                           173   2e-47    
ref|XP_007910862.1|  putative cellulase family protein                  173   2e-47    
ref|XP_007357340.1|  glycosyl hydrolase family 5 protein/cellulase      172   4e-47    
emb|CBI20318.3|  unnamed protein product                                171   5e-47    
ref|XP_007834259.1|  hypothetical protein PFICI_07487                   172   7e-47    
ref|XP_002145195.1|  cellulase family protein                           172   7e-47    
ref|XP_006671920.1|  cellulase family protein                           172   2e-46    
ref|XP_007585086.1|  putative cellulase family protein                  169   4e-46    
ref|XP_007814668.1|  cellulase family protein                           167   3e-45    
ref|XP_003663765.1|  glycoside hydrolase family 5 protein               166   1e-44    
gb|KHO00841.1|  cellulase family protein                                166   1e-44    
gb|ENH81172.1|  cellulase family protein                                165   2e-44    
gb|KEY64284.1|  hypothetical protein S7711_06330                        165   3e-44    
gb|KIY63779.1|  glycoside hydrolase family 5 protein                    165   3e-44    
gb|KHM98801.1|  Chaperone protein ClpB3, chloroplastic                  170   3e-44    
gb|KFA75266.1|  hypothetical protein S40288_00156                       164   4e-44    
ref|XP_003717168.1|  cellulase                                          163   1e-43    
gb|AFK48266.1|  unknown                                                 157   2e-43    
ref|XP_009224314.1|  hypothetical protein GGTG_08211                    162   2e-43    
ref|XP_008597845.1|  cellulase-like protein                             162   3e-43    
gb|KIH93867.1|  cellulase family protein                                162   3e-43    
ref|XP_001836746.2|  glycosyl hydrolase family 5 protein/cellulase      162   4e-43    
ref|XP_007590702.1|  beta-1,6-galactanase                               162   5e-43    
ref|XP_008445780.1|  PREDICTED: uncharacterized protein LOC103488703    162   7e-43    
ref|XP_003662646.1|  glycoside hydrolase family 5 protein               161   7e-43    
emb|CDX85491.1|  BnaA02g03220D                                          160   8e-43    
gb|KFA63501.1|  hypothetical protein S40285_00384                       161   8e-43    
gb|EMT72253.1|  Endoglucanase                                           161   1e-42    
dbj|GAD95395.1|  cellulase family protein                               161   1e-42    
emb|CDY38093.1|  BnaC02g06800D                                          160   1e-42    
ref|XP_007792420.1|  putative cellulase family protein                  160   1e-42    
ref|XP_003655929.1|  glycoside hydrolase family 5 protein               160   2e-42    
gb|KFH44162.1|  Endoglucanase-like protein                              160   2e-42    
gb|ERS98824.1|  hypothetical protein HMPREF1624_04014                   160   2e-42    
gb|ENH72329.1|  Endoglucanase                                           159   3e-42    
ref|XP_007819785.1|  cellulase family protein                           159   3e-42    
gb|EFQ33294.1|  cellulase                                               159   5e-42    
gb|EXK27375.1|  hypothetical protein FOMG_16183                         159   6e-42    
gb|KIE00366.1|  cellulase family protein                                159   6e-42    
gb|EWZ43433.1|  hypothetical protein FOZG_04542                         159   6e-42    
gb|EWZ81068.1|  hypothetical protein FOWG_15056                         159   7e-42    
ref|XP_007594136.1|  cellulase                                          158   8e-42    
gb|EXM17989.1|  hypothetical protein FOTG_13958                         158   9e-42    
gb|EXK80342.1|  hypothetical protein FOQG_15124                         158   1e-41    
gb|EWY97310.1|  hypothetical protein FOYG_02170                         158   1e-41    
ref|XP_007273044.1|  cellulase family protein                           158   1e-41    
gb|KID89157.1|  cellulase family protein                                157   2e-41    
gb|KDN66432.1|  putative cellulase                                      157   2e-41    
ref|XP_006289055.1|  hypothetical protein CARUB_v10002452mg             154   2e-41    
gb|EQB46738.1|  cellulase                                               157   2e-41    
emb|CCF37606.1|  beta-1,6-galactanase                                   157   2e-41    
gb|EQK97843.1|  cellulase family protein                                158   2e-41    
gb|KFG83308.1|  cellulase family protein                                157   2e-41    
gb|KFH46053.1|  hypothetical protein ACRE_031990                        157   2e-41    
ref|XP_007286355.1|  beta-1,6-galactanase                               157   3e-41    
gb|EXA33415.1|  hypothetical protein FOVG_15480                         157   3e-41    
gb|EXL60764.1|  hypothetical protein FOCG_00055                         157   3e-41    
gb|KGQ09067.1|  hypothetical protein BBAD15_g5599                       156   4e-41    
gb|KID73106.1|  cellulase family protein                                156   4e-41    
ref|XP_004168759.1|  PREDICTED: uncharacterized protein LOC101223591    158   4e-41    
gb|KDN63966.1|  putative beta-1,6-galactanase                           156   5e-41    
ref|XP_001228860.1|  hypothetical protein CHGG_02344                    156   5e-41    
ref|XP_009853760.1|  hypothetical protein NEUTE1DRAFT_148368            155   1e-40    
emb|CCF32701.1|  cellulase                                              155   1e-40    
gb|EQB54091.1|  beta-1,6-galactanase                                    155   2e-40    
ref|XP_007788083.1|  putative beta- -galactanase protein                155   2e-40    
gb|ERS96619.1|  hypothetical protein HMPREF1624_06828                   154   3e-40    
gb|KIY64332.1|  glycoside hydrolase family 5 protein                    154   4e-40    
ref|XP_959873.1|  cellulase                                             154   5e-40    
gb|KHE83132.1|  glycoside hydrolase family 5 protein                    153   7e-40    
ref|XP_003346057.1|  hypothetical protein SMAC_08559                    153   8e-40    
gb|EPE02619.1|  beta- -galactanase                                      153   1e-39    
gb|ENH76760.1|  beta-galactanase                                        153   1e-39    
ref|XP_003716571.1|  beta-1,6-galactanase                               150   9e-39    
emb|CEJ81391.1|  hypothetical protein VHEMI01518                        150   1e-38    
gb|ESZ94649.1|  hypothetical protein SBOR_4958                          150   1e-38    
ref|XP_007602986.1|  endo-beta-1                                        151   1e-38    
gb|EFQ30340.1|  beta-1,6-galactanase                                    149   2e-38    
ref|XP_001908470.1|  hypothetical protein                               149   3e-38    
gb|KIH89233.1|  glycosyl hydrolase family 5 protein/cellulase           149   3e-38    
ref|XP_001589233.1|  hypothetical protein SS1G_09866                    149   4e-38    
gb|EPE03278.1|  cellulase family protein                                148   6e-38    
ref|XP_007797018.1|  putative beta- -galactanase protein                152   6e-38    
ref|XP_007829998.1|  hypothetical protein PFICI_03226                   148   7e-38    
gb|KDO76363.1|  hypothetical protein CISIN_1g039248mg                   147   1e-37    
gb|AFW58605.1|  hypothetical protein ZEAMMB73_652830                    140   1e-37    
ref|XP_001558669.1|  hypothetical protein BC1G_02740                    147   2e-37    
ref|XP_682435.1|  hypothetical protein AN9166.2                         146   2e-37    
gb|AFW58606.1|  hypothetical protein ZEAMMB73_652830                    139   3e-37    
ref|XP_001727126.2|  cellulase family protein                           143   3e-36    
ref|XP_002375352.1|  cellulase family protein                           143   3e-36    
gb|KDN70454.1|  putative endo-beta-1                                    144   4e-36    
ref|XP_007916764.1|  putative beta- -galactanase protein                142   1e-35    
ref|XP_009254229.1|  hypothetical protein FPSE_02835                    142   1e-35    
gb|EFQ25644.1|  endo-beta-1                                             141   1e-35    
gb|EAY94564.1|  hypothetical protein OsI_16342                          140   2e-35    
gb|EYB22881.1|  hypothetical protein FG05_11184                         141   2e-35    
ref|NP_001053106.2|  Os04g0481000                                       133   2e-35    
ref|XP_011325159.1|  hypothetical protein FGSG_11184                    141   2e-35    
gb|KEZ38898.1|  hypothetical protein SAPIO_CDS10213                     141   3e-35    
ref|XP_009218474.1|  cellulase                                          141   3e-35    
ref|XP_001218590.1|  conserved hypothetical protein                     142   4e-35    
ref|XP_003049455.1|  hypothetical protein NECHADRAFT_45063              140   4e-35    
ref|XP_008437725.1|  PREDICTED: uncharacterized protein LOC103483072    135   5e-35    
ref|XP_003719440.1|  cellulase                                          140   9e-35    
ref|XP_009221743.1|  beta-1,6-galactanase                               139   1e-34    
gb|EWG53981.1|  hypothetical protein FVEG_12299                         139   1e-34    
dbj|BAF42338.1|  beta-1,6-galactanase                                   139   2e-34    
ref|XP_003654775.1|  glycoside hydrolase family 5 protein               139   2e-34    
gb|EMT67612.1|  Endoglucanase E1                                        139   2e-34    
gb|EWY82241.1|  hypothetical protein FOYG_14356                         138   2e-34    
gb|ENH63669.1|  Endoglucanase E1                                        138   2e-34    
ref|XP_007828900.1|  hypothetical protein PFICI_02128                   139   2e-34    
gb|KIL93951.1|  hypothetical protein FAVG1_02513                        142   3e-34    
ref|XP_007880014.1|  hypothetical protein PFL1_04296                    138   4e-34    
gb|EWZ31143.1|  hypothetical protein FOZG_15552                         137   4e-34    
gb|EXL52466.1|  hypothetical protein FOCG_08258                         137   4e-34    
gb|EGU84192.1|  hypothetical protein FOXB_05301                         137   5e-34    
gb|EXM21364.1|  hypothetical protein FOTG_10887                         137   5e-34    
gb|KGN50359.1|  hypothetical protein Csa_5G168955                       131   6e-34    
gb|EIT75924.1|  hypothetical protein Ao3042_07759                       137   1e-33    
ref|XP_003834169.1|  similar to glycosyl hydrolase family 5 prote...    136   1e-33    
dbj|BAE60287.1|  unnamed protein product                                136   1e-33    
gb|KEQ69124.1|  glycosyl hydrolase family 5 protein-like protein/...    136   1e-33    
ref|XP_009652661.1|  beta-1,6-galactanase                               136   1e-33    
ref|XP_003710230.1|  beta-1,6-galactanase                               135   3e-33    
ref|XP_001221670.1|  hypothetical protein CHGG_05575                    134   7e-33    
ref|XP_003000334.1|  beta-1,6-galactanase                               134   1e-32    
gb|EGU83355.1|  hypothetical protein FOXB_06135                         131   2e-32    
ref|XP_001390007.2|  cellulase family protein                           133   2e-32    
emb|CAK38078.1|  unnamed protein product                                133   2e-32    
ref|XP_007673934.1|  glycoside hydrolase family 5 protein               132   3e-32    
dbj|GAA92545.1|  cellulase family protein                               132   4e-32    
gb|EMF10750.1|  glycoside hydrolase family 5 protein                    132   4e-32    
gb|KEQ65714.1|  glycosyl hydrolase family 5 protein-like protein/...    132   4e-32    
ref|XP_753201.1|  cellulase family protein                              131   4e-32    
gb|KIM98514.1|  glycoside hydrolase family 5 protein                    132   6e-32    
ref|XP_001259223.1|  cellulase, putative                                130   1e-31    
ref|XP_008079151.1|  (Trans)glycosidase                                 130   3e-31    
gb|EHL01724.1|  putative endoglucanase E1                               129   3e-31    
ref|XP_003852017.1|  hypothetical protein MYCGRDRAFT_71681              129   4e-31    
gb|EQB45939.1|  endo-beta-1                                             129   4e-31    
ref|XP_007290132.1|  putative glycosyl hydrolase family 5 protein...    129   5e-31    
ref|XP_007695874.1|  glycoside hydrolase family 5 protein               128   1e-30    
gb|EMD93538.1|  glycoside hydrolase family 5 protein                    127   1e-30    
gb|ELQ40532.1|  cellulase family protein                                128   1e-30    
gb|KEQ97289.1|  glycoside hydrolase family 5 protein                    126   5e-30    
gb|EUN23705.1|  glycoside hydrolase family 5 protein                    126   5e-30    
gb|KFA65247.1|  hypothetical protein S40285_01463                       125   1e-29    
gb|KFY97953.1|  hypothetical protein V498_01781                         125   1e-29    
emb|CCF49355.1|  related to cellulase                                   125   1e-29    
gb|KDN62736.1|  putative beta-1,6-galactanase                           125   2e-29    
gb|KFY54743.1|  hypothetical protein V496_07185                         125   2e-29    
gb|ENH86025.1|  beta-galactanase                                        125   2e-29    
ref|XP_007714643.1|  glycoside hydrolase family 5 protein               124   4e-29    
dbj|GAC98490.1|  glycoside hydrolase                                    123   5e-29    
gb|KDN53057.1|  glycoside hydrolase family 5 protein                    123   6e-29    
gb|KEQ88759.1|  putative endoglucanase E1                               123   6e-29    
ref|XP_008020410.1|  glycoside hydrolase family 5 protein               123   7e-29    
ref|XP_007283182.1|  cellulase family protein                           123   7e-29    
gb|EFW98553.1|  cellulase family protein                                122   7e-29    
ref|XP_003299126.1|  hypothetical protein PTT_10061                     123   7e-29    
ref|XP_007788248.1|  putative beta- -galactanase protein                123   1e-28    
gb|KEY74323.1|  hypothetical protein S7711_00479                        122   1e-28    
gb|KFA77893.1|  hypothetical protein S40288_02553                       122   1e-28    
ref|XP_009221446.1|  hypothetical protein GGTG_05380                    122   1e-28    
ref|XP_003841187.1|  hypothetical protein LEMA_P091170.1                122   1e-28    
gb|EQB45951.1|  beta-1,6-galactanase                                    122   2e-28    
ref|XP_007698919.1|  glycoside hydrolase family 5 protein               121   3e-28    
ref|XP_007601021.1|  beta-1,6-galactanase                               121   3e-28    
ref|XP_008031104.1|  glycoside hydrolase family 5 protein               121   5e-28    
gb|EYF06416.1|  Hypothetical protein CAP_1946                           120   5e-28    
ref|XP_007715431.1|  glycoside hydrolase family 5 protein               120   6e-28    
emb|CBQ69840.1|  related to cellulase                                   120   6e-28    
ref|XP_007688994.1|  glycoside hydrolase family 5 protein               119   1e-27    
ref|XP_007690633.1|  glycoside hydrolase family 5 protein               119   2e-27    
ref|XP_001937210.1|  beta-1,6-galactanase                               119   2e-27    
emb|CDI55906.1|  related to cellulase                                   118   3e-27    
gb|KFY18769.1|  hypothetical protein V493_08357                         118   4e-27    
ref|XP_011391775.1|  hypothetical protein UMAG_12007                    118   4e-27    
gb|ETS60461.1|  hypothetical protein PaG_05301                          118   4e-27    
gb|KFY05071.1|  hypothetical protein O988_00287                         117   6e-27    
emb|CCF42701.1|  endo-beta-1                                            115   8e-27    
dbj|GAC77343.1|  hypothetical protein PANT_26c00006                     117   8e-27    
gb|KIN05076.1|  glycoside hydrolase family 5 protein                    117   8e-27    
dbj|GAK66794.1|  beta- -galactanase protein                             117   9e-27    
gb|ENH81328.1|  beta-galactanase                                        117   1e-26    
gb|EMD89616.1|  glycoside hydrolase family 5 protein                    117   1e-26    
ref|XP_001796881.1|  hypothetical protein SNOG_06513                    114   6e-26    
gb|EST08742.1|  glycoside hydrolase                                     113   2e-25    
gb|KEQ91282.1|  glycoside hydrolase family 5 protein                    112   3e-25    
gb|KEQ69326.1|  Exo-beta-1,3-glucanase                                  112   4e-25    
gb|KEQ66985.1|  Exo-beta-1,3-glucanase                                  112   6e-25    
gb|KFZ08766.1|  hypothetical protein V501_05827                         111   7e-25    
ref|XP_007280273.1|  beta-1,6-galactanase                               111   8e-25    
gb|KFZ18118.1|  hypothetical protein V502_04277                         111   8e-25    
gb|KFX85816.1|  hypothetical protein V490_09391                         112   3e-24    
ref|WP_020706673.1|  hypothetical protein                               109   3e-24    
gb|KGN50048.1|  hypothetical protein Csa_5G152130                       106   3e-24    
emb|CDY26627.1|  BnaA09g46500D                                          108   4e-24    
gb|KEQ82680.1|  Exo-beta-1,3-glucanase                                  109   4e-24    
gb|KFY38525.1|  hypothetical protein V495_06511                         111   5e-24    
gb|KFY79089.1|  hypothetical protein V499_01878                         108   6e-24    
ref|XP_003850716.1|  Exo-beta-1,3-glucanase                             108   1e-23    
ref|XP_007285746.1|  cellulase family protein                           107   3e-23    
ref|WP_037440274.1|  hypothetical protein                               104   3e-23    
gb|ACN33507.1|  unknown                                                 105   8e-23    
ref|XP_007927008.1|  glycoside hydrolase family 5 protein               105   2e-22    
gb|EFQ34997.1|  beta-1,6-galactanase                                    105   2e-22    
ref|XP_003006645.1|  cellulase family protein                           103   5e-22    
gb|AFG69336.1|  hypothetical protein 2_5099_01                        98.6    7e-22    
gb|AEW08277.1|  hypothetical protein 2_5099_01                        98.6    7e-22    
emb|CAD19084.1|  cellulase                                              102   4e-21    
ref|WP_002615846.1|  glycosyl hydrolase family 5                        101   1e-20    
ref|XP_001796728.1|  hypothetical protein SNOG_06354                  99.8    2e-20    
ref|WP_002631146.1|  hypothetical protein                               100   3e-20    



>emb|CDP13254.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            + QPL TNSRWIVN SG+RVKLACVNW THLEVVVAEGLSKQPVDVIS+ IVDMGFNCVR
Sbjct  1    MGQPLYTNSRWIVNGSGQRVKLACVNWATHLEVVVAEGLSKQPVDVISRSIVDMGFNCVR  60

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LTWPLFLFTND+LASL+VRQSF+ LGL ESIAG QANNPSIVDL LI AYQAVV SLA  
Sbjct  61   LTWPLFLFTNDTLASLSVRQSFQKLGLTESIAGFQANNPSIVDLSLINAYQAVVASLASN  120

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             VMIILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT+VA MF G +NVVG+SLRN
Sbjct  121  NVMIILDNHISKPGWCCSNFDGNGFFGDRYFNPDLWIRGLTEVAAMFCGINNVVGISLRN  180

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRGPKQNV+DWYRYMQ+GAEAVHAANPD+L+I SGL++DKD SFL
Sbjct  181  ELRGPKQNVDDWYRYMQKGAEAVHAANPDVLIILSGLNYDKDFSFL  226



>ref|XP_009765489.1| PREDICTED: uncharacterized protein LOC104217035 [Nicotiana sylvestris]
Length=562

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            TV +QPL T SRWIVN +G+RVKLACVNWV+H+EV+VAEGL++QPVD IS+ I++MGFNC
Sbjct  27   TVSSQPLYTKSRWIVNSTGQRVKLACVNWVSHMEVMVAEGLNQQPVDAISRAIINMGFNC  86

Query  254  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            VRLTWPLFLFTNDSL S+TVRQSFKNLGL  SI GLQANNPSIVDL ++ AYQAVV SLA
Sbjct  87   VRLTWPLFLFTNDSLGSITVRQSFKNLGLFASIVGLQANNPSIVDLSVLDAYQAVVASLA  146

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            K  VMIILDNHISKPGWCCS +DGNGFFGD YFDP LW+ GLTKVAT+F GT+NVVGMSL
Sbjct  147  KNNVMIILDNHISKPGWCCSRFDGNGFFGDKYFDPDLWLQGLTKVATIFKGTNNVVGMSL  206

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNELRGP QN +DWYRYMQ+GAEAVHAANP++L+I SGLSFDKDLSFL
Sbjct  207  RNELRGPLQNAHDWYRYMQKGAEAVHAANPNVLIILSGLSFDKDLSFL  254



>ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=566

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 208/227 (92%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V A PLSTNSRWIV+E+G+RVKLACVNWV+HLE VVAEGLSKQP+D+I+KKIV MGFNCV
Sbjct  29   VTALPLSTNSRWIVDENGQRVKLACVNWVSHLEAVVAEGLSKQPMDMIAKKIVSMGFNCV  88

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL+L TND+LASL+VRQSF+ LGLLESI+G+QANNPSI+DLPLI AYQAVV SL  
Sbjct  89   RLTWPLYLVTNDTLASLSVRQSFQGLGLLESISGIQANNPSIIDLPLIKAYQAVVSSLGD  148

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG +NV+GMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDTYFNPDLWIKGLTQMATLFNGVTNVIGMSLR  208

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRG KQNVNDWYRYM++GAEAVH+ANPD+LVI SGL++DKD SFL
Sbjct  209  NELRGQKQNVNDWYRYMEKGAEAVHSANPDVLVILSGLNYDKDFSFL  255



>gb|KHG05074.1| Endoglucanase [Gossypium arboreum]
Length=563

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 207/233 (89%), Gaps = 2/233 (1%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  238
            H  P   ++ PLSTNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+D+ISK+IV 
Sbjct  22   HAKP--AMSLPLSTNSRWIVDEEGRRVKLACVNWVSHLEPVVAEGLSKQPMDMISKRIVT  79

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVR TWPLFL TNDSLASLTVRQSF+ LGLLESIAG+Q+NNPSI+D+ LI AYQAV
Sbjct  80   MGFNCVRFTWPLFLITNDSLASLTVRQSFQRLGLLESIAGIQSNNPSIIDVSLIKAYQAV  139

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL K  VM+ILDNH+SKPGWCCS +DGNGFFGD YF+P LW+ GLT++AT+FNG +NV
Sbjct  140  VSSLGKNDVMVILDNHLSKPGWCCSDFDGNGFFGDQYFNPDLWITGLTRMATLFNGVTNV  199

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRG KQNVNDWYRYMQ+GAEAVH+ANPD+LVI SGLS+D DLSF+
Sbjct  200  VGMSLRNELRGHKQNVNDWYRYMQKGAEAVHSANPDVLVILSGLSYDSDLSFI  252



>gb|KJB15656.1| hypothetical protein B456_002G188600 [Gossypium raimondii]
Length=563

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 209/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  238
            H  P   ++ PLSTNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+D+I+K+IV 
Sbjct  22   HAKP--AMSLPLSTNSRWIVDEEGRRVKLACVNWVSHLEPVVAEGLSKQPMDMIAKRIVT  79

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVR TWPLFL TNDSLAS+TVRQSF+ LGLLESIAG+Q+NNPSI+D+ LI AYQAV
Sbjct  80   MGFNCVRFTWPLFLITNDSLASITVRQSFQRLGLLESIAGIQSNNPSIIDVSLIKAYQAV  139

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL K  VM+ILDNH+SKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG ++V
Sbjct  140  VSSLGKNDVMVILDNHLSKPGWCCSNFDGNGFFGDQYFNPDLWITGLTRMATLFNGVTHV  199

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGPKQNVNDWYRYMQ+GAEAVH+ANPD+LVI SGLS+D DLSF+
Sbjct  200  VGMSLRNELRGPKQNVNDWYRYMQKGAEAVHSANPDVLVILSGLSYDSDLSFI  252



>gb|KDO82155.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=435

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCVR
Sbjct  35   IGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVR  94

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL   
Sbjct  95   LTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNN  154

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLRN
Sbjct  155  NVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRN  214

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRGPKQNV DWYRYMQ GAEAVHAANP++LVI SGL+FDKDLSF+
Sbjct  215  ELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFV  260



>ref|XP_011034023.1| PREDICTED: uncharacterized protein LOC105132312 [Populus euphratica]
Length=566

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 208/227 (92%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V+A PLSTNSRWIV+E+G+RVKLACVNWV+HLEV+VAEGLS+QP+D I+K+IV MGFNCV
Sbjct  29   VMALPLSTNSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCV  88

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWP+FL TND+L SLTVRQS ++LGLLESI+G+QANNPSI+DLPL+  YQAVV +L  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLDVYQAVVSNLGD  148

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDWYRYMQ+GAEAVH+ANPD++VI SGL++DKDLSFL
Sbjct  209  NELRGPKQNVNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFL  255



>ref|XP_004245178.1| PREDICTED: uncharacterized protein LOC101258288 [Solanum lycopersicum]
Length=561

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/229 (79%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = +2

Query  71   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  250
            P      LSTNSRWIVNE G+RVKL+CVNWV+HLEV+VAEGLSKQP+D ISK I +MGFN
Sbjct  27   PQYSHATLSTNSRWIVNEGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFN  86

Query  251  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            CVRLTWPLFLFTNDSL+SL+VRQSF NLGL+ESIAGLQ NNPSI+DL L+ AYQAVV  L
Sbjct  87   CVRLTWPLFLFTNDSLSSLSVRQSFNNLGLVESIAGLQVNNPSILDLSLLQAYQAVVSGL  146

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  610
                VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LWV GLTKVAT F   +NVVGMS
Sbjct  147  GNNNVMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWVQGLTKVATTFINVTNVVGMS  206

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQNVNDWYRYMQ+GAEAVHAANPD+LVI SGL+FDKDLSFL
Sbjct  207  LRNELRGPKQNVNDWYRYMQKGAEAVHAANPDVLVILSGLNFDKDLSFL  255



>ref|XP_002312657.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
 gb|EEE90024.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
Length=566

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V A PLSTNSRWIV+E+G+RVKLACVNWV+HLEV+VAEGLS+QP+D I+K+IV MGFNCV
Sbjct  29   VTALPLSTNSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSEQPMDAIAKRIVSMGFNCV  88

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWP+FL TND+L SLTVRQS ++LGLLESI+G+QANNPSI+DLPL+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLRSLGLLESISGIQANNPSIIDLPLLNVYQAVVSSLGD  148

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDWYRYMQ+GAEAVH+ANPD++VI SGL++DKDLSFL
Sbjct  209  NELRGPKQNVNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFL  255



>ref|XP_007223308.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
 gb|EMJ24507.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
Length=547

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 206/230 (90%), Gaps = 0/230 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P TV A PLST+SRWIV+ESG+RVKLACVNWV+HLE VVAEGLSKQPVD ISK+I  +GF
Sbjct  29   PATVSAVPLSTSSRWIVDESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGF  88

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NCVRLTWP FL TND+LAS+TVRQSF++LGL ESIAGLQ+NNPSI+DL LI AYQAVV S
Sbjct  89   NCVRLTWPTFLATNDTLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSS  148

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L K  VM+ILDN +SKPGWCCSS+DGNGFFGD YF P +W+ GLT++AT+F G +NVVGM
Sbjct  149  LGKNNVMVILDNQVSKPGWCCSSFDGNGFFGDQYFSPDIWIKGLTRMATLFKGVANVVGM  208

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNELRGPKQNV+DWY+YMQ+GAEAVH+ANPD+LVI SGLS+DKDLSFL
Sbjct  209  SLRNELRGPKQNVDDWYKYMQRGAEAVHSANPDVLVILSGLSYDKDLSFL  258



>ref|XP_006378253.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
 gb|ERP56050.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
Length=396

 Score =   378 bits (970),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VMALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPLDGIAKRILSMGFNCV  88

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDWYRYMQ+GAEAVH+ANPD++VI SGL++DKDLSFL
Sbjct  209  NELRGPKQNVNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFL  255



>ref|XP_006367511.1| PREDICTED: uncharacterized protein LOC102589547 [Solanum tuberosum]
Length=560

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  71   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  250
            P      LSTNSRWIVNE G+RVKL+CVNWV+HLEV+VAEGLSKQP+D ISK I +MGFN
Sbjct  26   PQYSHATLSTNSRWIVNEGGQRVKLSCVNWVSHLEVMVAEGLSKQPIDTISKSITNMGFN  85

Query  251  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            CVRLTWPLFLFTNDSL+SLTVRQSF NLGL+ESIAGLQ NNPSI+DL L+ AYQAVV  L
Sbjct  86   CVRLTWPLFLFTNDSLSSLTVRQSFSNLGLVESIAGLQVNNPSILDLSLLHAYQAVVSGL  145

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  610
                VM+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT VAT F   +NVVGMS
Sbjct  146  GNNNVMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIQGLTNVATTFINVTNVVGMS  205

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQNVNDWYRYMQ+GAEAVHAANPD+LVI SGL+FDKDLSFL
Sbjct  206  LRNELRGPKQNVNDWYRYMQKGAEAVHAANPDVLVILSGLNFDKDLSFL  254



>ref|XP_008221942.1| PREDICTED: uncharacterized protein LOC103321869 [Prunus mume]
Length=584

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 206/230 (90%), Gaps = 0/230 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P TV A PLST+SRWIV+ESG+RVKLACVNWV+HLE VVAEGLSKQPVD ISK+I  +GF
Sbjct  66   PATVSAVPLSTSSRWIVDESGQRVKLACVNWVSHLEPVVAEGLSKQPVDAISKRIASLGF  125

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NCVRLTWP FL TND+LAS+TVRQSF++LGL ESIAGLQ+NNPSI+DL LI AYQAVV S
Sbjct  126  NCVRLTWPTFLATNDTLASVTVRQSFQSLGLSESIAGLQSNNPSIIDLTLIQAYQAVVSS  185

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L K  VM+ILDN +SKPGWCCSS DGNGFFGD YF+P +W+ GLT++AT+F G +NVVGM
Sbjct  186  LGKNNVMVILDNQVSKPGWCCSSSDGNGFFGDQYFNPDIWIKGLTRMATLFKGVANVVGM  245

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNELRGPKQNV+DWY+YMQ+GAEAVH+ANPD+LVI SGLS+DKDLSFL
Sbjct  246  SLRNELRGPKQNVDDWYKYMQRGAEAVHSANPDVLVILSGLSYDKDLSFL  295



>ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera]
Length=552

 Score =   381 bits (978),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVA PL TNSRWIV+E G RVKLACVNW +HLE VVAEGLSKQPV +ISKKI  MGFNCV
Sbjct  24   VVALPLYTNSRWIVDEDGARVKLACVNWPSHLEAVVAEGLSKQPVAMISKKIGSMGFNCV  83

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPLFL TN SLASLTVRQSF+ LGLLESIAG QANNPS+VDLPLI+AYQAVV  LA 
Sbjct  84   RLTWPLFLATNQSLASLTVRQSFQRLGLLESIAGFQANNPSMVDLPLISAYQAVVSGLAD  143

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH+SKPGWCCSS+DGNGFFGD YF+P LWV GLT++ATMF G +NVVGMSLR
Sbjct  144  NNVMVILDNHLSKPGWCCSSFDGNGFFGDQYFNPDLWVQGLTRMATMFRGVTNVVGMSLR  203

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV DWYRYMQ+GAEAVH+ANPD+LVI SGLS+D DLSF+
Sbjct  204  NELRGPKQNVKDWYRYMQKGAEAVHSANPDVLVIVSGLSYDTDLSFV  250



>ref|XP_006438205.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
 gb|ESR51445.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
Length=570

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK+IVDMGFNCV
Sbjct  34   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRIVDMGFNCV  93

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  94   RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  153

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLR
Sbjct  154  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLR  213

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV DWYRYMQ GAEAVHAANP++LVI SGL+FDKDLSF+
Sbjct  214  NELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFV  260



>ref|XP_006483983.1| PREDICTED: uncharacterized protein LOC102624331 [Citrus sinensis]
Length=588

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCV
Sbjct  52   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCV  111

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  112  RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  171

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLR
Sbjct  172  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLR  231

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV DWYRYMQ GAEAVHAANP++LVI SGL+FDKDLSF+
Sbjct  232  NELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFV  278



>gb|KDO82151.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=570

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
             +  PLSTNSRWIV+E+G RVKLACVNWV+HLE VVAEGLSKQP+D++SK++VDMGFNCV
Sbjct  34   AIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCV  93

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL+L TNDSLASLTVRQSF+ LGLLE+I G+Q+NNPSIVDLPLI A+QAVV SL  
Sbjct  94   RLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGN  153

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS+ DGNGFFGD YF+P LW+ GLTK+AT+FNG  NVVGMSLR
Sbjct  154  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLR  213

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV DWYRYMQ GAEAVHAANP++LVI SGL+FDKDLSF+
Sbjct  214  NELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFV  260



>ref|XP_002315653.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
 gb|EEF01824.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
Length=377

 Score =   373 bits (957),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEG+SKQP+D I+K+I+ MGFNCV
Sbjct  7    VMALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGISKQPMDGIAKRILSMGFNCV  66

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  67   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  126

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MF G  NVVGMSLR
Sbjct  127  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFKGVPNVVGMSLR  186

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDWYRYMQ+GAEAVH+ANPD++VI SGL++DKDLSFL
Sbjct  187  NELRGPKQNVNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFL  233



>ref|XP_004239150.1| PREDICTED: uncharacterized protein LOC101248575 [Solanum lycopersicum]
Length=572

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 203/233 (87%), Gaps = 0/233 (0%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  238
            H+    V +QPL TNSRWIVN  G+RVKL CVNWV+H++V++AEGL+ QP+D ISK I++
Sbjct  31   HVVVVIVSSQPLYTNSRWIVNSKGQRVKLTCVNWVSHMDVMLAEGLNHQPIDAISKSIIN  90

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLTWPL+LFTNDSL+S++VRQSFKNLGL  SI GLQANNPSIVDL ++ AY+AV
Sbjct  91   MGFNCVRLTWPLYLFTNDSLSSISVRQSFKNLGLFSSILGLQANNPSIVDLSVLDAYKAV  150

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SLAK  VMIILDNHISKPGWCCS +DGNGFFGD YFDP LW+ GLTKVAT F  T+NV
Sbjct  151  VASLAKNNVMIILDNHISKPGWCCSRFDGNGFFGDEYFDPHLWIQGLTKVATTFKATTNV  210

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGP QNV+DWYRYMQ+GAEAVHAAN D+L+I SGLSFDKDLSFL
Sbjct  211  VGMSLRNELRGPLQNVDDWYRYMQKGAEAVHAANSDVLIILSGLSFDKDLSFL  263



>ref|XP_009359244.1| PREDICTED: uncharacterized protein LOC103949843 [Pyrus x bretschneideri]
Length=552

 Score =   379 bits (972),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = +2

Query  71   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  250
            P V A PLST+SRWIV+ESG+RVKLACVNWV+HL+ VVAEGLSKQPVD I+K+I  +GFN
Sbjct  22   PAVSALPLSTSSRWIVDESGQRVKLACVNWVSHLDTVVAEGLSKQPVDAIAKRITSLGFN  81

Query  251  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            CVRLTWPLFL TN++LA++TVRQSF++LGLL+SI+G+Q+NNP++VDLPL+ AYQAVV SL
Sbjct  82   CVRLTWPLFLATNETLAAVTVRQSFQSLGLLDSISGIQSNNPALVDLPLLKAYQAVVSSL  141

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  610
                VM+ILDNH+SKPGWCCS+ DGNGFFGD YF+P LW+ GLT++AT+F G SNVVGMS
Sbjct  142  GSNNVMVILDNHLSKPGWCCSNTDGNGFFGDQYFNPDLWITGLTRMATLFKGVSNVVGMS  201

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQNVNDWY+YMQ+GAEAVH+AN D+LVI SGLSFD DLSFL
Sbjct  202  LRNELRGPKQNVNDWYKYMQRGAEAVHSANADVLVILSGLSFDTDLSFL  250



>ref|XP_010250986.1| PREDICTED: uncharacterized protein LOC104593039 [Nelumbo nucifera]
Length=583

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 203/232 (88%), Gaps = 0/232 (0%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            ++P   VA PL TNSRWIV+E G+RVKLACVNW +HLE +VAEGLSK+P+DVISK+IV M
Sbjct  16   VSPVVAVALPLYTNSRWIVDEDGQRVKLACVNWASHLEAMVAEGLSKRPLDVISKRIVSM  75

Query  242  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  421
            GFNCVRLTWPLFL TNDSLAS+TVRQSF++LGL E+I G+Q NNPS+VDLPLI AYQAVV
Sbjct  76   GFNCVRLTWPLFLATNDSLASVTVRQSFRSLGLSETIVGIQVNNPSLVDLPLIQAYQAVV  135

Query  422  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  601
             +L +  +M+ILDNHISKPGWCCSS+DGNGFFGD YFDP +W+ GLT +ATMFN T NVV
Sbjct  136  SNLGENNLMVILDNHISKPGWCCSSFDGNGFFGDKYFDPGVWIKGLTSMATMFNATPNVV  195

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GMSLRNELRG KQNV DWYRYMQQG EAVH+ANPD+LVI SGL++DKD SFL
Sbjct  196  GMSLRNELRGNKQNVKDWYRYMQQGGEAVHSANPDVLVILSGLNYDKDFSFL  247



>ref|XP_011042368.1| PREDICTED: uncharacterized protein LOC105138075 [Populus euphratica]
Length=542

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VIALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCV  88

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNSDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDWYRYMQ+GAEAVH+ANPD++VI SGL++DKDLSFL
Sbjct  209  NELRGPKQNVNDWYRYMQKGAEAVHSANPDVIVILSGLNYDKDLSFL  255



>ref|XP_011042367.1| PREDICTED: uncharacterized protein LOC105138074 [Populus euphratica]
Length=561

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V+A PLST+SRWIV+E+G+RVKLACVNWV+HLEV+VAEGLSKQP+D I+K+I+ MGFNCV
Sbjct  29   VIALPLSTDSRWIVDENGQRVKLACVNWVSHLEVMVAEGLSKQPMDGIAKRILSMGFNCV  88

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWP+FL TND+L SLTVRQS ++ GLLESI+G+QANNPSI+DL L+  YQAVV SL  
Sbjct  89   RLTWPVFLVTNDTLGSLTVRQSLQSHGLLESISGIQANNPSIIDLSLLDVYQAVVSSLGN  148

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS++DGNGFFGD YFDP LW+ GLT++A+MFNG  NVVGMSLR
Sbjct  149  NNVMVILDNHISKPGWCCSNFDGNGFFGDQYFDPDLWITGLTRMASMFNGVPNVVGMSLR  208

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDWYRYMQ+GAEAVH+ANPD+++I SGL++DKDLS+L
Sbjct  209  NELRGPKQNVNDWYRYMQKGAEAVHSANPDVVIILSGLNYDKDLSYL  255



>gb|KDP26669.1| hypothetical protein JCGZ_17827 [Jatropha curcas]
Length=563

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V A PLST+SRWIV+E G+RVKLACVNWV+HLE VVAEGLS++P+D+I+KKIV MGFNCV
Sbjct  28   VSAVPLSTDSRWIVDEKGQRVKLACVNWVSHLEAVVAEGLSREPMDLIAKKIVSMGFNCV  87

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL+L TN++ ASLTV+QSF+NLGLLESI+G+QANNP+I+DLPLI AYQAVV SL  
Sbjct  88   RLTWPLYLVTNETYASLTVKQSFQNLGLLESISGIQANNPAIIDLPLIKAYQAVVSSLGD  147

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              V++ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++AT+FNG  NVVG+SLR
Sbjct  148  NNVLVILDNHISKPGWCCSNFDGNGFFGDSYFNPDLWINGLTQMATIFNGVPNVVGLSLR  207

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRG KQNVNDWYRYM++GAEAVH+ANPD+LVI SGL++DKDLSFL
Sbjct  208  NELRGQKQNVNDWYRYMEKGAEAVHSANPDVLVILSGLNYDKDLSFL  254



>ref|XP_010248702.1| PREDICTED: uncharacterized protein LOC104591536 [Nelumbo nucifera]
Length=555

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V A PL TNSRWIV+E+G+RVKLACVNW +HLE +VAEGLSKQP+DVISK+IV MGFNCV
Sbjct  28   VTALPLYTNSRWIVDETGQRVKLACVNWASHLESMVAEGLSKQPLDVISKQIVSMGFNCV  87

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPLFL TN SLAS+TVRQSFK+LGL+E+IAG++ NNPS+VDLPLI AYQ VV +LA 
Sbjct  88   RLTWPLFLVTNSSLASITVRQSFKSLGLIETIAGIEVNNPSLVDLPLIRAYQVVVANLAD  147

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILDNHISK GWCCSS DGNGFFGD YFDP LW+ GLT++ATMF GT+NVVGMSLR
Sbjct  148  NNLMVILDNHISKSGWCCSSVDGNGFFGDKYFDPSLWINGLTRMATMFRGTANVVGMSLR  207

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRG +Q+VNDWYRYMQ+GAEAVH ANP++LVIFSGL++DKD +FL
Sbjct  208  NELRGARQSVNDWYRYMQKGAEAVHLANPNVLVIFSGLNYDKDFTFL  254



>ref|XP_007044872.1| Cellulase protein [Theobroma cacao]
 gb|EOY00704.1| Cellulase protein [Theobroma cacao]
Length=563

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTNSRWIV+E G+RVKLACVNWV+HLE +VAEGLSK P+DVI+K+IV  GFNCVRLTW
Sbjct  30   PLSTNSRWIVDEKGQRVKLACVNWVSHLEPMVAEGLSKLPMDVIAKRIVSTGFNCVRLTW  89

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            PLFL TNDSLASLTVRQSF+ LGLLESIAG+Q NNPSI+D+ L+ AYQAVV SL +  VM
Sbjct  90   PLFLVTNDSLASLTVRQSFQRLGLLESIAGIQTNNPSIIDVSLLKAYQAVVCSLGENNVM  149

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDNHISKPGWCCS++DGNGFFGD YF+P +W+ GLT++AT+ N  +NVVGMSLRNELR
Sbjct  150  VILDNHISKPGWCCSNFDGNGFFGDQYFNPDIWITGLTRMATLVNAVTNVVGMSLRNELR  209

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GPKQ VNDWYRYMQ+GAEAVH+ANPD+LVI SGL++DKDLSF+
Sbjct  210  GPKQTVNDWYRYMQKGAEAVHSANPDVLVILSGLNYDKDLSFI  252



>gb|EYU30606.1| hypothetical protein MIMGU_mgv1a018920mg, partial [Erythranthe 
guttata]
Length=504

 Score =   370 bits (949),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 196/223 (88%), Gaps = 1/223 (0%)
 Frame = +2

Query  92   LSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            LST SRWIV+ES GRRVKL CVNW +HL+ VVAEGLSKQPVD IS++I++MGFNCVRLTW
Sbjct  4    LSTESRWIVDESSGRRVKLVCVNWPSHLDAVVAEGLSKQPVDEISQEIINMGFNCVRLTW  63

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            PLFLFTND+LASLTVRQSF NLGL ES+AG Q NNPSI+DL LI AYQ VV SL + KVM
Sbjct  64   PLFLFTNDTLASLTVRQSFTNLGLSESVAGFQTNNPSIIDLSLIDAYQEVVASLGRKKVM  123

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            IILDNH SKPGWCCS+ DGNGFFGD YF+P+LW+ GLT+VAT FN T NVV MSLRNELR
Sbjct  124  IILDNHTSKPGWCCSNSDGNGFFGDEYFNPQLWLKGLTRVATTFNNTKNVVAMSLRNELR  183

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            G +QNVNDWYRYMQ+GAEAVHAANP+LLVI SGL FD+DLSFL
Sbjct  184  GRRQNVNDWYRYMQKGAEAVHAANPNLLVILSGLKFDRDLSFL  226



>ref|XP_007159685.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
 gb|ESW31679.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
Length=565

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/233 (74%), Positives = 199/233 (85%), Gaps = 0/233 (0%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  238
             + P      PL T+SRWIV + GRRVKLACVNWV+HLEVVVAEGLSK+PVD ISK I  
Sbjct  27   EVRPVAATGLPLRTDSRWIVGQDGRRVKLACVNWVSHLEVVVAEGLSKKPVDAISKGIKS  86

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLTWP+ L TNDSLASLTVR SF+NLGLLES+AG+Q NNPSI+DLPLI A+Q V
Sbjct  87   MGFNCVRLTWPILLVTNDSLASLTVRSSFQNLGLLESVAGVQTNNPSIIDLPLIQAFQVV  146

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL    VM+ILDNHI++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NV
Sbjct  147  VKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKYFDPNLWMLGLTKMATLFNGVTNV  206

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRG KQNV+DWY+YM +GAE +HAANPD+LVI SGL+FDKDLSF+
Sbjct  207  VGMSLRNELRGAKQNVDDWYKYMVKGAETIHAANPDVLVILSGLNFDKDLSFI  259



>ref|XP_010100346.1| hypothetical protein L484_027655 [Morus notabilis]
 gb|EXB82480.1| hypothetical protein L484_027655 [Morus notabilis]
Length=559

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A+PL TNSRWIV+E GRRVKLACVNWV+HLE VVAEGLSKQP+DVI+ +I  +GFNCVRL
Sbjct  35   AEPLYTNSRWIVDEGGRRVKLACVNWVSHLEPVVAEGLSKQPLDVIAAQISALGFNCVRL  94

Query  263  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            TWP++L TNDSLASLTVR SF+ LGL ESIAGLQ  NPSIVDL LI AYQAVV SL    
Sbjct  95   TWPIYLATNDSLASLTVRDSFQRLGLEESIAGLQTYNPSIVDLSLIQAYQAVVSSLGSKN  154

Query  443  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  622
            VM++LDNH++KPGWCCS++DGNGFFGD YFDP LW+ GLT +AT+F G  NV+GMSLRNE
Sbjct  155  VMVVLDNHVTKPGWCCSNFDGNGFFGDQYFDPDLWIKGLTHMATLFKGVQNVIGMSLRNE  214

Query  623  LRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRGPKQNVNDW++YMQ+GAEAVH+ANPD+LVI SGLS+D DLSFL
Sbjct  215  LRGPKQNVNDWFKYMQRGAEAVHSANPDVLVILSGLSYDTDLSFL  259



>ref|XP_010904543.1| PREDICTED: uncharacterized protein LOC105031942 [Elaeis guineensis]
Length=563

 Score =   368 bits (945),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 202/232 (87%), Gaps = 1/232 (0%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            L  PT  A PL T+SRWIV+ESG+RVKLACVNW +HL+ V+AEG+ KQP+D ISKKI  M
Sbjct  21   LQKPTT-ALPLFTSSRWIVDESGQRVKLACVNWPSHLDTVLAEGMGKQPLDTISKKIASM  79

Query  242  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  421
            GFNCVRLTWPLFL TNDSLA+LTVRQSF++LGL ES A +Q NNP++VDLPLI A+QAVV
Sbjct  80   GFNCVRLTWPLFLATNDSLANLTVRQSFQSLGLAESFAAIQVNNPALVDLPLIQAFQAVV  139

Query  422  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  601
             +L +  +M+ILDNHISKPGWCCS++DGNGFFGD YFDP +WV GLT++ATMFNGT+NVV
Sbjct  140  TNLGENNIMVILDNHISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATMFNGTTNVV  199

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GMSLRNELRG +QN  DWYRYMQ+GAEAVH+ANP++LVI SGLSFD DLSFL
Sbjct  200  GMSLRNELRGARQNATDWYRYMQRGAEAVHSANPNVLVILSGLSFDTDLSFL  251



>ref|XP_008389746.1| PREDICTED: uncharacterized protein LOC103452050 [Malus domestica]
Length=552

 Score =   368 bits (944),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = +2

Query  71   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  250
            P   A PLST+SRWIV+ESG+RVKLACVNWV+HL+ VVAEGLSKQPVD I+K+I  +GFN
Sbjct  22   PAASALPLSTSSRWIVDESGQRVKLACVNWVSHLDAVVAEGLSKQPVDAIAKRIASLGFN  81

Query  251  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            CVRLTWPL L TN++LA++TVRQSF++LGLLESI+G+Q+NNP++VDLPL+ AYQAVV SL
Sbjct  82   CVRLTWPLLLATNETLAAVTVRQSFQSLGLLESISGIQSNNPALVDLPLLKAYQAVVSSL  141

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  610
                VM+ILDNH+S PGWCC++ D NGFFGD YF+P LW+ GLT++AT+F G SNVVGMS
Sbjct  142  GSNNVMVILDNHLSTPGWCCNNNDDNGFFGDKYFNPDLWITGLTRMATLFKGVSNVVGMS  201

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQNV+DWY+YMQ+GAEAVH+AN D+LVI SGLSFD DLSFL
Sbjct  202  LRNELRGPKQNVDDWYKYMQRGAEAVHSANADVLVILSGLSFDTDLSFL  250



>ref|XP_008446127.1| PREDICTED: uncharacterized protein LOC103488945 [Cucumis melo]
Length=554

 Score =   368 bits (944),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 201/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            +A    V  PL T++RWIV+  G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  14   VAASAAVGLPLHTDTRWIVDGEGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIEGL  73

Query  242  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  421
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  74   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLTEAIAGIQANNPFIIDLPLLKAFEAVV  133

Query  422  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  601
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  134  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRMATMFNGVNHVV  193

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             MSLRNELRGPKQNVNDWYRYMQ+GAEAVH+ANPD+L+I SGLSFD+DLSFL
Sbjct  194  AMSLRNELRGPKQNVNDWYRYMQRGAEAVHSANPDILIILSGLSFDRDLSFL  245



>gb|KEH20742.1| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=558

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PL T+SRWIVN+ G RVKLAC+NWV+HL+ VVAEGLSK+PVDVIS  I  MGFNCVRLTW
Sbjct  29   PLGTSSRWIVNQDGERVKLACLNWVSHLDAVVAEGLSKKPVDVISNGIKSMGFNCVRLTW  88

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            P+ L TND+L+SLTVRQSF+NLGLL+S+A  Q+NNPSI+D+ LI A+QAVV SL    VM
Sbjct  89   PILLLTNDTLSSLTVRQSFQNLGLLQSVAAFQSNNPSIIDVSLIQAFQAVVKSLGDNDVM  148

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDNHI++PGWCCS+ DGNGFFGD YFDP LW+ GLTK+AT+FNG SNVVGMSLRNELR
Sbjct  149  VILDNHITQPGWCCSNSDGNGFFGDQYFDPNLWIQGLTKMATLFNGVSNVVGMSLRNELR  208

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GPKQNVNDWYRYM QGAEAVHAANPD+LVI SGL+FDKDLS++
Sbjct  209  GPKQNVNDWYRYMVQGAEAVHAANPDVLVILSGLNFDKDLSYI  251



>gb|KGN51727.1| hypothetical protein Csa_5G593400 [Cucumis sativus]
Length=550

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 202/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            +A    V  PL T++RWIV+ +G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  12   VAASAAVGLPLHTDTRWIVDGAGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWL  71

Query  242  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  421
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  72   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVV  131

Query  422  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  601
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  132  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVV  191

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             MSLRNELRGPKQNVNDWYRYMQ+GAEAVH+ANPD+L+I SGLS+D+DLSFL
Sbjct  192  AMSLRNELRGPKQNVNDWYRYMQRGAEAVHSANPDILIILSGLSYDRDLSFL  243



>ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus]
Length=549

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 202/232 (87%), Gaps = 0/232 (0%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            +A    V  PL T++RWIV+ +G RVKL CVNWV+HLE VVAEGLSKQP++ IS +I  +
Sbjct  11   VAASAAVGLPLHTDTRWIVDGAGERVKLRCVNWVSHLEAVVAEGLSKQPIEEISNRIQWL  70

Query  242  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  421
            GFNCVRLTWPLFL TN+SL SLTVRQSF+ LGL E+IAG+QANNP I+DLPL+ A++AVV
Sbjct  71   GFNCVRLTWPLFLATNESLNSLTVRQSFQRLGLAEAIAGIQANNPFIIDLPLLKAFEAVV  130

Query  422  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  601
            G L + K+M+ILDNHISKPGWCCS++DGNGFFGD YF+P LW+ GLT++ATMFNG ++VV
Sbjct  131  GKLGEGKLMVILDNHISKPGWCCSNFDGNGFFGDQYFNPDLWIKGLTRIATMFNGVNHVV  190

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             MSLRNELRGPKQNVNDWYRYMQ+GAEAVH+ANPD+L+I SGLS+D+DLSFL
Sbjct  191  AMSLRNELRGPKQNVNDWYRYMQRGAEAVHSANPDILIILSGLSYDRDLSFL  242



>ref|XP_008793719.1| PREDICTED: uncharacterized protein LOC103709945 [Phoenix dactylifera]
Length=530

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            ++A PLST+SRWIV+ESG+RVKLACVNW +HLE V+AEG+ KQP+D ISK+I  MGFNCV
Sbjct  1    MIALPLSTSSRWIVDESGQRVKLACVNWPSHLETVLAEGMGKQPLDTISKEIASMGFNCV  60

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPLFL TNDSLA+LTV+QSF+ LGL ES+A ++ NN ++VDLPLI A++AVV +L  
Sbjct  61   RLTWPLFLATNDSLANLTVQQSFQALGLAESLAAIRVNNQALVDLPLIQAFKAVVTNLGD  120

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILDNHISKPGWCCS++DGNGFFGD YFDP +WV GLT++AT FNGT+NVVGMSLR
Sbjct  121  NNIMVILDNHISKPGWCCSNFDGNGFFGDKYFDPDVWVKGLTRMATTFNGTTNVVGMSLR  180

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRG +QNVNDWYRYMQ+GAEAVH+ANPD+LVI SGLSFD DLS+L
Sbjct  181  NELRGARQNVNDWYRYMQRGAEAVHSANPDILVILSGLSFDNDLSYL  227



>ref|XP_010682344.1| PREDICTED: uncharacterized protein LOC104897211 [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A PLST+SRWIV+E G RVKLACVNW +HLE+VVAEGL +QPVDVISKKI D+GFNCVRL
Sbjct  30   ALPLSTSSRWIVDEEGHRVKLACVNWASHLELVVAEGLGQQPVDVISKKIKDLGFNCVRL  89

Query  263  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            TWPL+L TN+SLA LTVR+SF N GL +SI+GLQANNPSIVDL LI A+QAVV SL   K
Sbjct  90   TWPLYLATNESLACLTVRESFVNAGLSDSISGLQANNPSIVDLSLINAFQAVVASLTNNK  149

Query  443  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  622
            VM+ILDNHIS PGWCCS YDGNGFFGD YF+P LW+ GLTK+AT+F     V+GMSLRNE
Sbjct  150  VMVILDNHISTPGWCCSKYDGNGFFGDQYFNPDLWINGLTKMATLFKDNPFVIGMSLRNE  209

Query  623  LRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRGPKQNVNDWYR MQ+GAEAVH ANP++LVI SGLS+DKD SFL
Sbjct  210  LRGPKQNVNDWYRCMQRGAEAVHGANPNVLVILSGLSYDKDFSFL  254



>ref|XP_003539156.1| PREDICTED: uncharacterized protein LOC100816102 [Glycine max]
Length=544

 Score =   362 bits (930),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P  V   PL T+ RWIV+ESG+RVKLACVNWV+HL+ VVAEGLS+QP+D ISK+I  MGF
Sbjct  24   PVVVKGFPLHTSERWIVDESGKRVKLACVNWVSHLDAVVAEGLSQQPLDEISKRIKTMGF  83

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NCVRLTWPLFL TNDS+ASLT+R SF+NLGL++S+ G+QA NPSI+DLPLI AYQAVV S
Sbjct  84   NCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAVVKS  143

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L +  VM+ILDNH+S+PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+F G +NVV M
Sbjct  144  LGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNVVAM  203

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNELRGP+QNVN WYRYM +GAEAVHAANPD+LVI SGL+FD +LSF+
Sbjct  204  SLRNELRGPRQNVNVWYRYMPKGAEAVHAANPDVLVILSGLNFDTNLSFI  253



>ref|XP_007132485.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
 gb|ESW04479.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
Length=530

 Score =   362 bits (929),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 194/228 (85%), Gaps = 0/228 (0%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            TV   PL T+ RWIVNE+G+RVKLACVNWV+HL+ VVAEGLS+QP+D ISK+I  MGFNC
Sbjct  21   TVKGFPLHTSDRWIVNENGKRVKLACVNWVSHLDTVVAEGLSQQPLDTISKRIKSMGFNC  80

Query  254  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            VRLTWPL L TN SLASLTVR SFKNL LL+SI  +QA NPSI+DLPLI AYQ VV SL 
Sbjct  81   VRLTWPLLLLTNHSLASLTVRNSFKNLALLQSIDAVQAINPSIIDLPLIKAYQEVVKSLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCCSS DGNGFFGD YFDP LW+IGLT +AT+F G SNVVGMSL
Sbjct  141  ENDVMVILDNHVTVPGWCCSSMDGNGFFGDQYFDPDLWIIGLTNMATLFKGVSNVVGMSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNELRGPKQ+VN WYRYM +GAEAVHAANP++LVI SGL+FD DLSF+
Sbjct  201  RNELRGPKQDVNQWYRYMPKGAEAVHAANPEVLVILSGLNFDTDLSFI  248



>ref|XP_004504142.1| PREDICTED: uncharacterized protein LOC101503968 [Cicer arietinum]
Length=554

 Score =   362 bits (930),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 199/235 (85%), Gaps = 3/235 (1%)
 Frame = +2

Query  62   LAPPTVV---AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKI  232
            +A P V    A  L T+SRWIVN+ G RVKLACVNWV+HL+ VVAEGLSK+PVDVIS  I
Sbjct  18   VAEPVVAVSDALSLKTSSRWIVNQDGERVKLACVNWVSHLDAVVAEGLSKKPVDVISHGI  77

Query  233  VDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  412
              MGFNCVRLTWP+ L TN SL+SLTVRQSF+NLGLL++IAG Q+NNPSI+DL LI A+Q
Sbjct  78   KSMGFNCVRLTWPILLLTNQSLSSLTVRQSFQNLGLLDTIAGFQSNNPSIIDLSLIHAFQ  137

Query  413  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  592
            AVV SL    VM+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG  
Sbjct  138  AVVKSLGDNDVMVILDNHMTQPGWCCSNTDGNGFFGDQYFDPNLWILGLTKMATLFNGVP  197

Query  593  NVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             VV MSLRNELRGPKQNVNDWYRYM QGAEAVHA+NPD+LVI SGL+FDKDLSF+
Sbjct  198  TVVAMSLRNELRGPKQNVNDWYRYMVQGAEAVHASNPDILVILSGLNFDKDLSFI  252



>ref|XP_008236799.1| PREDICTED: uncharacterized protein LOC103335561 [Prunus mume]
Length=544

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = +2

Query  71   PTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFN  250
            P  V+  LSTNSRWIV+  G+RVKLACVNWV+HLE V+AEGLSKQPVD ISK+I  +GFN
Sbjct  28   PATVSATLSTNSRWIVDYKGQRVKLACVNWVSHLEAVIAEGLSKQPVDTISKRIASLGFN  87

Query  251  CVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            CV+LTWP FL TND+LAS+TV+QSF++L L ESIAGLQ+NNPSI++L L+ AYQAVV SL
Sbjct  88   CVKLTWPTFLATNDTLASVTVQQSFQSLNLSESIAGLQSNNPSIINLTLLQAYQAVVNSL  147

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  610
             K  VM+ILDNH+SKPGWCCSS DGNGFFGD YF+P +W+ GLT++AT+FNG   VVGMS
Sbjct  148  GKNNVMVILDNHVSKPGWCCSSSDGNGFFGDQYFNPDVWIKGLTRMATLFNGVGFVVGMS  207

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQNV+DWY+ MQ+GAEAVH+ANPD+LVI SGLS DKDLSFL
Sbjct  208  LRNELRGPKQNVDDWYKDMQRGAEAVHSANPDVLVILSGLSDDKDLSFL  256



>gb|KJB78033.1| hypothetical protein B456_012G173600 [Gossypium raimondii]
Length=579

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 205/234 (88%), Gaps = 3/234 (1%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            H+ P T +  PLSTNSRWIV+ ++ RRVKLACVNW +HLE V AEGLSK+ +D I+++IV
Sbjct  16   HVNPTTSL--PLSTNSRWIVDDQTDRRVKLACVNWPSHLEPVFAEGLSKRSMDSIAEQIV  73

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             MGFNCVRLTWPL+L TNDSL+SLTVR+SF+NLGL+E IAG+QANNPS++D+ LI A+QA
Sbjct  74   SMGFNCVRLTWPLYLVTNDSLSSLTVRRSFQNLGLMEPIAGIQANNPSVIDVSLIQAFQA  133

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV SL K  VM+ILDNH+SKPGWCC  +DG+GFF D YF+P LWV GLT++AT+FNG +N
Sbjct  134  VVSSLGKNNVMVILDNHLSKPGWCCGYFDGDGFFSDPYFNPDLWVTGLTRMATLFNGVTN  193

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGPKQN++DWYRYMQ+GAEAVHAANP++L+I SGLSFDKDLSF+
Sbjct  194  VVGMSLRNELRGPKQNIDDWYRYMQKGAEAVHAANPNVLIILSGLSFDKDLSFI  247



>ref|XP_010044528.1| PREDICTED: uncharacterized protein LOC104433472 [Eucalyptus grandis]
 gb|KCW86615.1| hypothetical protein EUGRSUZ_B03243 [Eucalyptus grandis]
Length=560

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              A PLST+SRWIV+ SGRRVKLAC NWV+HLE VVAEGLSKQP+  IS +I  +GFNCV
Sbjct  26   AAASPLSTSSRWIVDGSGRRVKLACANWVSHLEPVVAEGLSKQPLGAISARIASLGFNCV  85

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPLFL TNDSLASLTVRQSF+ LGL ++I+G+QANNP I+DL LI  +QAVV SL  
Sbjct  86   RLTWPLFLATNDSLASLTVRQSFQGLGLADAISGIQANNPDILDLSLIETFQAVVSSLGD  145

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC   DGNGFFGD YFDP LW+ GLT++AT+F G  NVVGMSLR
Sbjct  146  NDVMVILDNHLTKPGWCCGYSDGNGFFGDQYFDPDLWIHGLTRMATLFRGVGNVVGMSLR  205

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRG +QNV DWY+YMQ+GAEAVHA+NPD+LVI SGLS+DKDLSFL
Sbjct  206  NELRGARQNVKDWYKYMQRGAEAVHASNPDVLVILSGLSYDKDLSFL  252



>ref|XP_010249431.1| PREDICTED: uncharacterized protein LOC104591975 [Nelumbo nucifera]
Length=541

 Score =   357 bits (916),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P    A PL T+SRWIV+ESG+RVKLAC NWV+HL+ V+AEGL++QP+DVISK IV MGF
Sbjct  26   PAIATALPLYTDSRWIVDESGKRVKLACANWVSHLQPVLAEGLNRQPLDVISKWIVSMGF  85

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NC+RLTWPL++ TND+LASLTV+QSF++LGLLESI  ++ NNPS+++L +I A+QAVV +
Sbjct  86   NCIRLTWPLWVATNDTLASLTVQQSFESLGLLESIGAIRVNNPSMLNLTIIQAFQAVVSN  145

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L K  VM+I+DNHIS+PGWCC++ DGNGFFGDIYFDP LW+ GLT++AT+FNGTSNV+GM
Sbjct  146  LGKNGVMVIIDNHISQPGWCCANRDGNGFFGDIYFDPDLWIKGLTRMATLFNGTSNVIGM  205

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNELRGPKQNV+ WY+YMQQGAEAVH ANPD+L I SGL +DKDL FL
Sbjct  206  SLRNELRGPKQNVSVWYKYMQQGAEAVHRANPDVLTILSGLDYDKDLHFL  255



>ref|XP_004309996.1| PREDICTED: uncharacterized protein LOC101307271 [Fragaria vesca 
subsp. vesca]
Length=550

 Score =   357 bits (916),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST+SRWIV+E+G+RVKLACVNWV+HL+ VVAEGLSKQP+D ISK+I  +GFNCVRLTW
Sbjct  25   PLSTSSRWIVDENGQRVKLACVNWVSHLDPVVAEGLSKQPLDSISKRITSLGFNCVRLTW  84

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            PL+L TNDSLA++TVRQSF++LGL ESIAG+Q+NNPS++DLPL+ A+Q VV +L    VM
Sbjct  85   PLYLATNDSLAAVTVRQSFQSLGLQESIAGVQSNNPSLIDLPLLKAFQEVVTNLGNNNVM  144

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDNH+SKPGWCCS+ D NGFFGD YF+P LW+ GLT++AT+F G SNVVGMSLRNELR
Sbjct  145  VILDNHVSKPGWCCSNNDDNGFFGDKYFNPDLWIKGLTQMATLFKGVSNVVGMSLRNELR  204

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GPKQNV DWY+YM +GAEAVH+ANPD+LVI SGL FD DLSF+
Sbjct  205  GPKQNVEDWYKYMPRGAEAVHSANPDVLVILSGLYFDTDLSFV  247



>gb|AES72136.2| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=608

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V A PL TN RWIVNES +RVKLACVNW +HL+  VAEGLS QP+DVISK I  MGFNCV
Sbjct  27   VTALPLHTNGRWIVNESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCV  86

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL L TNDS AS+ VR S  NLGLL+SI+G+QANNPSI+DLPLI AYQ VV SL  
Sbjct  87   RLTWPLLLLTNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGD  146

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NVVGMSLR
Sbjct  147  MDLMVILDNHVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGMSLR  206

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QN+NDWYRYM +GAE VHAAN ++LVI SGL+FD DLSF+
Sbjct  207  NELRGPRQNLNDWYRYMPKGAEVVHAANSNVLVILSGLNFDTDLSFI  253



>ref|XP_003601885.1| Endoglucanase [Medicago truncatula]
Length=655

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V A PL TN RWIVNES +RVKLACVNW +HL+  VAEGLS QP+DVISK I  MGFNCV
Sbjct  17   VTALPLHTNGRWIVNESEKRVKLACVNWASHLDTSVAEGLSHQPLDVISKGIKSMGFNCV  76

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL L TNDS AS+ VR S  NLGLL+SI+G+QANNPSI+DLPLI AYQ VV SL  
Sbjct  77   RLTWPLLLLTNDSFASIKVRHSLHNLGLLQSISGIQANNPSIIDLPLIKAYQTVVKSLGD  136

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILDNH+++PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+FNG +NVVGMSLR
Sbjct  137  MDLMVILDNHVTQPGWCCSNSDGNGFFGDQYFDPDLWLMGLTKMATLFNGVTNVVGMSLR  196

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QN+NDWYRYM +GAE VHAAN ++LVI SGL+FD DLSF+
Sbjct  197  NELRGPRQNLNDWYRYMPKGAEVVHAANSNVLVILSGLNFDTDLSFI  243



>ref|XP_008389747.1| PREDICTED: uncharacterized protein LOC103452051 [Malus domestica]
Length=545

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V A PLST+ RWIV+E+GRRVKLACVNWV+HL+ V+AEGLSKQPV+ I K+I  +GFNCV
Sbjct  20   VSALPLSTHKRWIVDENGRRVKLACVNWVSHLDTVLAEGLSKQPVNAIIKRITSLGFNCV  79

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPLFL TN +LA +TVRQSF++LGLL SI+GLQ+NNP  +DL LI A+QAVV SL K
Sbjct  80   RLTWPLFLATNSTLAEVTVRQSFQSLGLLGSISGLQSNNPGFLDLSLIKAFQAVVSSLGK  139

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM++LDNH+SKPGWCCS+ DGNGFFGD YF+P  W++GLT++A +F+G  NVVGMSLR
Sbjct  140  NNVMVVLDNHLSKPGWCCSNTDGNGFFGDEYFNPDNWIVGLTRMAALFHGVRNVVGMSLR  199

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDWY YMQ+GAEAVH ANP +LVI SGL FD DLSFL
Sbjct  200  NELRGPKQNVNDWYTYMQRGAEAVHKANPVVLVILSGLKFDTDLSFL  246



>gb|KHN29014.1| Endoglucanase [Glycine soja]
Length=533

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            L T+SRWI+N+ G+RVKLACVNWV+HLEV VAEGLSK+PVD ISK I  MGFNCVRLTWP
Sbjct  7    LHTDSRWILNQDGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWP  66

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
              L TNDSLASL+VR+SF++LGLLES+AG+Q NNPSI+DLPLI A+QAVV SL    VM+
Sbjct  67   TLLATNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMV  126

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH++ PGWCC   DGNGFFGD +F+P  W+ GLTK+AT+FNG +NVVGMSLRNELRG
Sbjct  127  ILDNHLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGMSLRNELRG  186

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            PKQNVNDWY+YM +GAEAVHAANPD+LVI SG++FD  LSF+
Sbjct  187  PKQNVNDWYKYMVKGAEAVHAANPDVLVILSGINFDTSLSFI  228



>ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max]
Length=574

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            L T+SRWI+N+ G+RVKLACVNWV+HLEV VAEGLSK+PVD ISK I  MGFNCVRLTWP
Sbjct  48   LHTDSRWILNQGGQRVKLACVNWVSHLEVAVAEGLSKKPVDAISKGIKSMGFNCVRLTWP  107

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
              L TNDSLASL+VR+SF++LGLLES+AG+Q NNPSI+DLPLI A+QAVV SL    VM+
Sbjct  108  TLLATNDSLASLSVRRSFQSLGLLESVAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMV  167

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH++ PGWCC   DGNGFFGD +F+P  W+ GLTK+AT+FNG +NVVGMSLRNELRG
Sbjct  168  ILDNHLTNPGWCCGYSDGNGFFGDKFFNPDQWIFGLTKMATLFNGVTNVVGMSLRNELRG  227

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            PKQNVNDWY+YM +GAEAVHAANPD+LVI SG++FD  LSF+
Sbjct  228  PKQNVNDWYKYMVKGAEAVHAANPDVLVILSGINFDTSLSFI  269



>ref|XP_009387346.1| PREDICTED: uncharacterized protein LOC103974285 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = +2

Query  107  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  286
            RWIV+ESG RVKLACVNWV+HLE VV EG+ KQP+D ISKKI  MGFNCVRLTWPLFL T
Sbjct  36   RWIVDESGLRVKLACVNWVSHLEPVVVEGMGKQPLDTISKKIAAMGFNCVRLTWPLFLVT  95

Query  287  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  466
            NDSLA LTVRQSF+ LGL+ESIA +Q NNP +++L LI A++AVV +LA   VM+ILDNH
Sbjct  96   NDSLAGLTVRQSFQALGLMESIAAIQVNNPDLLNLTLIQAFKAVVSNLADNNVMVILDNH  155

Query  467  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  646
            ISKPGWCCS++DGNGFFGD YFD + W+ GLTK+ATMFNG+ NVVGMSLRNELRGPKQ V
Sbjct  156  ISKPGWCCSNFDGNGFFGDKYFDAEEWIKGLTKMATMFNGSPNVVGMSLRNELRGPKQGV  215

Query  647  NDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             +WYRYMQ+GAEAVH+ANP++LVI SGLSFD DL +L
Sbjct  216  TEWYRYMQRGAEAVHSANPNVLVILSGLSFDNDLGYL  252



>gb|KHN06534.1| Endoglucanase [Glycine soja]
Length=566

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            L T+SRWI+++ GRRVKLACVNWV+HLE VVAEGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  43   LHTDSRWILDQDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWP  102

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
              L TNDSLASLTVR+SF++LGLLESIAG+Q NNPSI+DL LI A+QAVV SL    VM+
Sbjct  103  TLLVTNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMV  162

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH+++PGWCC + DGNGFFGD +FDP  W++GLTK+AT+F G + VVG+SLRNELRG
Sbjct  163  ILDNHVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGISLRNELRG  222

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             +QNVNDWY+YM +GAEA HAANPD+LVI SGL+FD DLSFL
Sbjct  223  SRQNVNDWYKYMVKGAEAAHAANPDVLVILSGLNFDTDLSFL  264



>ref|XP_004504189.1| PREDICTED: uncharacterized protein LOC101490831 [Cicer arietinum]
Length=527

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PL T+SRWIVN++G RVKLACVNWV+HL+ VVAEGLSK+PVD IS  I  MGFNCVRLTW
Sbjct  28   PLKTSSRWIVNQNGVRVKLACVNWVSHLDAVVAEGLSKKPVDAISNIIKSMGFNCVRLTW  87

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            P+ L TN SL+SLTVRQSF+N GLL++IAG Q+NNPSI+DL LI A+QAVV SL    VM
Sbjct  88   PIHLLTNQSLSSLTVRQSFQNHGLLDTIAGFQSNNPSIIDLSLIQAFQAVVKSLGDNNVM  147

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDNH+++PGWCC++ DGNGFFGD YFDP LW+ GLTK+AT+FNG   VV MSLRNELR
Sbjct  148  VILDNHVTQPGWCCTNTDGNGFFGDQYFDPSLWITGLTKMATLFNGVPTVVAMSLRNELR  207

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GPKQ+VN+WYRYM QGAEAVHAANP++LVI SGL+FD DLSF+
Sbjct  208  GPKQDVNNWYRYMVQGAEAVHAANPNVLVILSGLNFDTDLSFI  250



>ref|XP_003524249.1| PREDICTED: uncharacterized protein LOC100789885 [Glycine max]
Length=571

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            L T+SRWI+++ GRRVKLACVNWV+HLE VVAEGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  45   LHTDSRWILDQDGRRVKLACVNWVSHLEAVVAEGLSKKPVDVISKGIKSMGFNCVRLTWP  104

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
              L TNDSLASLTVR+SF++LGLLESIAG+Q NNPSI+DL LI A+QAVV SL    VM+
Sbjct  105  TLLVTNDSLASLTVRRSFQSLGLLESIAGVQTNNPSIIDLSLIQAFQAVVKSLGDNDVMV  164

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH+++PGWCC + DGNGFFGD +FDP  W++GLTK+AT+F G + VVG+SLRNELRG
Sbjct  165  ILDNHVTQPGWCCGNTDGNGFFGDKFFDPNQWILGLTKMATLFKGVTAVVGISLRNELRG  224

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             +QNVNDWY+YM +GAEA HAANPD+LVI SGL+FD DLSFL
Sbjct  225  SRQNVNDWYKYMVKGAEAAHAANPDVLVILSGLNFDTDLSFL  266



>ref|XP_011086688.1| PREDICTED: uncharacterized protein LOC105168334 [Sesamum indicum]
Length=574

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 199/232 (86%), Gaps = 0/232 (0%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            +A  TV AQPLST+SRWIV+E+G+RVKL+CVNW +HLEVVVAEGLSKQPVD IS++I  +
Sbjct  34   IAVSTVAAQPLSTDSRWIVDETGQRVKLSCVNWPSHLEVVVAEGLSKQPVDKISEEIRSL  93

Query  242  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  421
            GFNCVRLTWPLFLFTND+LA+LTVRQS  NLGL E++AG Q NNP I+DL L+ AYQAVV
Sbjct  94   GFNCVRLTWPLFLFTNDTLAALTVRQSLTNLGLFEAVAGFQTNNPDIIDLSLMDAYQAVV  153

Query  422  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  601
            GSL K  VM++LDNH SKPGWCC   DGNGFFGD YF+P LWV GLT+VAT F  T +VV
Sbjct  154  GSLGKKNVMVVLDNHTSKPGWCCGDGDGNGFFGDEYFNPDLWVKGLTRVATTFKDTKHVV  213

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GMSLRNELRG +QNV DWYRYMQ+GAEAVH+ANP++L+I SGL +D+DLSFL
Sbjct  214  GMSLRNELRGRRQNVYDWYRYMQKGAEAVHSANPNVLIILSGLKYDRDLSFL  265



>gb|KCW59703.1| hypothetical protein EUGRSUZ_H02464 [Eucalyptus grandis]
Length=470

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 191/227 (84%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVAQ L  NSRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  27   VVAQKLYANSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  86

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL L  N++LAS TV QSF+NLGLLES+AG+++NNPS+++LP++ AY++V+ SL  
Sbjct  87   RLTWPLELPINETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRN  146

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  147  NQVMVILDNHITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGMSLR  206

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QNV+ WY+YMQQGAE VHAANPD+LVI SG +FD DLSFL
Sbjct  207  NELRGPRQNVDAWYKYMQQGAETVHAANPDVLVILSGFNFDTDLSFL  253



>emb|CDY40992.1| BnaA02g27820D [Brassica napus]
Length=418

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 193/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLSTNSRWI+NE G+RVKLACVNW  HL++VVAEGLSKQP+D +SKKI+ MGFNCVR
Sbjct  25   MAYPLSTNSRWIINEKGQRVKLACVNWPAHLQLVVAEGLSKQPLDAVSKKIMAMGFNCVR  84

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + IAG Q  NPS++DLPLI AY++VV +L  
Sbjct  85   LTWPLDLATNETLATNVTVRQSFQSLGLSDDIAGFQTKNPSMIDLPLIEAYKSVVTTLGN  144

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
            + +M++LDNH++KPGWCC   D NGFFGD +F+P  W+ GLTK+AT+F   S VVGMSLR
Sbjct  145  HNLMVVLDNHLTKPGWCCRFNDSNGFFGDTFFEPGSWIAGLTKIATLFKDASYVVGMSLR  204

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QNV+DW++YMQQGAEAVH ANP++LVI SGL++D DLSF+
Sbjct  205  NELRGPRQNVDDWFKYMQQGAEAVHGANPNVLVILSGLTYDTDLSFV  251



>ref|XP_010250979.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250981.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   342 bits (876),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A PL T+SRWIV+E+G+RVKL CVNW +HL+ ++AEGL+KQP+DVISK+IV MGFNCVR 
Sbjct  29   ALPLYTDSRWIVDETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRF  88

Query  263  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            TWPL++ TND+L+S+TV+QSF++LGLLESI  ++ NNPS+++L ++ A+Q VV +L +  
Sbjct  89   TWPLWMATNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENG  148

Query  443  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  622
            VM+ILDNHISKPGWCCS+ DGNG+FGDIYFDP LW+ GLT++AT+FNGTSNV+GMSLRNE
Sbjct  149  VMVILDNHISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGMSLRNE  208

Query  623  LRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRGP Q+V+ WY+YMQ GAEAVH ANP++L I SGL FDKDL FL
Sbjct  209  LRGPNQDVSIWYKYMQLGAEAVHKANPNVLTILSGLDFDKDLHFL  253



>ref|XP_009385963.1| PREDICTED: uncharacterized protein LOC103973176 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=556

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = +2

Query  65   APPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  244
            A P  +A PLST+SRW+V+  GRRVKLACVNW  HLE  VAEGLSKQP+D ISK +  MG
Sbjct  25   ASPAPIALPLSTSSRWVVDGEGRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMG  84

Query  245  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            FNCVRLTWPL+L T+ S  S+TVRQS + LGL ES AG++ NNP ++DL L+ A+QAVV 
Sbjct  85   FNCVRLTWPLYLLTDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVS  144

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +LA   +M+ILDN ISKPGWCCS YD NGFFGD YFDP  W+ GL  +ATMFN +++VVG
Sbjct  145  NLASNSLMVILDNQISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVG  204

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNELRGPKQN++ WYRYMQ+GAE VH+ANPD+LVI SGL +DKDLSFL
Sbjct  205  MSLRNELRGPKQNISLWYRYMQRGAEIVHSANPDILVILSGLDYDKDLSFL  255



>ref|XP_009385956.1| PREDICTED: uncharacterized protein LOC103973176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = +2

Query  65   APPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  244
            A P  +A PLST+SRW+V+  GRRVKLACVNW  HLE  VAEGLSKQP+D ISK +  MG
Sbjct  25   ASPAPIALPLSTSSRWVVDGEGRRVKLACVNWAAHLEPAVAEGLSKQPLDAISKSVAAMG  84

Query  245  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            FNCVRLTWPL+L T+ S  S+TVRQS + LGL ES AG++ NNP ++DL L+ A+QAVV 
Sbjct  85   FNCVRLTWPLYLLTDSSFGSVTVRQSLERLGLAESAAGVRVNNPGLLDLTLVQAFQAVVS  144

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +LA   +M+ILDN ISKPGWCCS YD NGFFGD YFDP  W+ GL  +ATMFN +++VVG
Sbjct  145  NLASNSLMVILDNQISKPGWCCSKYDDNGFFGDKYFDPDEWLRGLEMMATMFNSSTSVVG  204

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNELRGPKQN++ WYRYMQ+GAE VH+ANPD+LVI SGL +DKDLSFL
Sbjct  205  MSLRNELRGPKQNISLWYRYMQRGAEIVHSANPDILVILSGLDYDKDLSFL  255



>ref|XP_010458756.1| PREDICTED: uncharacterized protein LOC104739968 isoform X2 [Camelina 
sativa]
Length=516

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E G+R+KL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN ++LVI SGLSFD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDSDLSFV  257



>gb|AAD31066.1|AC007357_15 F3F19.15 [Arabidopsis thaliana]
Length=522

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            ++ PLST+SRWIV+E+G RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  1    MSYPLSTSSRWIVDENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  60

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DLPLI AY+ VV +L  
Sbjct  61   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGN  120

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  FNG SNVVGMSLR
Sbjct  121  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLR  180

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN  +LVI SGLSFD DLSF+
Sbjct  181  NELRGPKQNVNDWFKYMQQGAEAVHSANNKVLVILSGLSFDADLSFV  227



>ref|XP_006292902.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
 gb|EOA25800.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
Length=511

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST SRWI++E+G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKIV+MGFNCVR
Sbjct  1    MAFPLSTKSRWIIDENGQRVKLACVNWPSHLQPVVAEGLSKQRVDDVAKKIVEMGFNCVR  60

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL++ I+G Q  NPS++DLPL+ AY+ VV  L  
Sbjct  61   LTWPLDLATNETLANNVTVRQSFQSLGLIDDISGFQTKNPSMIDLPLMEAYKTVVAKLGN  120

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC   DGNGFFGD YFDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  121  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTYFDPATWIAGLTKIATTFKGTSNVVGMSLR  180

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRG +QNV+DW++YMQQGAEAVH ANP+ LVI SGLS+D DLSF+
Sbjct  181  NELRGARQNVDDWFKYMQQGAEAVHKANPNALVILSGLSYDVDLSFV  227



>ref|NP_172772.2| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AAU05478.1| At1g13130 [Arabidopsis thaliana]
 gb|AEE28973.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=552

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            ++ PLST+SRWIV+E+G RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MSYPLSTSSRWIVDENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DLPLI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  FNG SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN  +LVI SGLSFD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSANNKVLVILSGLSFDADLSFV  257



>ref|XP_006395579.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32865.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=507

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 190/227 (84%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST SRWI++E G+RVKLAC NW  HL+ VVAEGLSKQPVD ++K IV MGFNCVR
Sbjct  26   MAYPLSTKSRWIIDEKGQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVR  85

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL   ++G Q NNPS++DLPLI AY+ +V +L  
Sbjct  86   LTWPLDLATNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGN  145

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
            + VM+ILDNH +KPGWCC + DGNGFFGD +FDP  W+ GLTK+AT+F   SNVVGMSLR
Sbjct  146  HNVMVILDNHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGMSLR  205

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+DW++YMQQGAEAVH ANP++LVI SGLSFD DLSF+
Sbjct  206  NELRGPKQNVDDWFKYMQQGAEAVHGANPNVLVIISGLSFDTDLSFV  252



>ref|XP_010495004.1| PREDICTED: uncharacterized protein LOC104772051 [Camelina sativa]
Length=550

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E G+RVKL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRVKLTCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TND+LA+ +TVRQSF++LGL + I G Q NNPSI+D+ LI AY+ VV +L  
Sbjct  91   LTWPLELMTNDTLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDISLIEAYKTVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN ++LVI SGLSFD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDSDLSFV  257



>ref|XP_006307168.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
 gb|EOA40066.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
Length=552

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E G+RVKL CVNW +HL+ +VAEGLSKQPVD ++KKIVDMGFNCVR
Sbjct  31   MAHPLSTSSRWIVDEKGQRVKLVCVNWPSHLQPIVAEGLSKQPVDALAKKIVDMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC + DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCDNNDGNGFFGDQFFDPTVWVAALKKMAGTFDGVSNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN ++LVI SGLSFD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDCDLSFV  257



>ref|XP_006395580.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32866.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=534

 Score =   339 bits (869),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 190/227 (84%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST SRWI++E G+RVKLAC NW  HL+ VVAEGLSKQPVD ++K IV MGFNCVR
Sbjct  26   MAYPLSTKSRWIIDEKGQRVKLACANWPAHLQPVVAEGLSKQPVDAVAKMIVAMGFNCVR  85

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL   ++G Q NNPS++DLPLI AY+ +V +L  
Sbjct  86   LTWPLDLATNETLATNVTVRQSFQSLGLNADMSGFQTNNPSMIDLPLIEAYKRLVATLGN  145

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
            + VM+ILDNH +KPGWCC + DGNGFFGD +FDP  W+ GLTK+AT+F   SNVVGMSLR
Sbjct  146  HNVMVILDNHSTKPGWCCGNDDGNGFFGDTFFDPATWIAGLTKMATIFKDVSNVVGMSLR  205

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+DW++YMQQGAEAVH ANP++LVI SGLSFD DLSF+
Sbjct  206  NELRGPKQNVDDWFKYMQQGAEAVHGANPNVLVIISGLSFDTDLSFV  252



>ref|XP_010458755.1| PREDICTED: uncharacterized protein LOC104739968 isoform X1 [Camelina 
sativa]
Length=550

 Score =   339 bits (870),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E G+R+KL C NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDEKGQRIKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNITVRQSFQSLGLYDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NNVMVILDNHLTKPGWCCANNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN ++LVI SGLSFD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSANKNVLVILSGLSFDSDLSFV  257



>ref|XP_002876948.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53207.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   338 bits (867),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 190/227 (84%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLSTNSRWI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKIV MGFNCVR
Sbjct  1    MAYPLSTNSRWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQGVDDLAKKIVAMGFNCVR  60

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + I+G +  NPS++DLPLI AY+ VV  L  
Sbjct  61   LTWPLDLATNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGN  120

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GL K+AT F G SNVVGMSLR
Sbjct  121  KNVMVILDNHVTKPGWCCGYNDGNGFFGDTFFDPATWISGLIKIATTFKGASNVVGMSLR  180

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+DW++YMQQGAEAVH ANP++LVI SGLS+D DLSF+
Sbjct  181  NELRGPKQNVDDWFKYMQQGAEAVHEANPNVLVILSGLSYDTDLSFV  227



>ref|XP_006417151.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
 gb|ESQ35504.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
Length=561

 Score =   340 bits (871),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+DL LI A++ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +W   L+K+AT F+G +NVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANNDGNGFFGDRFFDPTVWTAALSKMATTFDGVTNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN ++LV+ SGLSFD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSANKNVLVVLSGLSFDADLSFV  257



>ref|XP_003552802.1| PREDICTED: uncharacterized protein LOC100805196 [Glycine max]
Length=533

 Score =   338 bits (868),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 190/232 (82%), Gaps = 0/232 (0%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            L    V A PL T +RWIV+ +  RVKLACVNWV+HLE +VAEGL ++P+D I+K+I  M
Sbjct  24   LQTKVVKAFPLYTQNRWIVDGNATRVKLACVNWVSHLEYMVAEGLGERPLDGIAKEIKSM  83

Query  242  GFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVV  421
            GFNCVRLTWP++L TNDSLA+LTVRQSF NLGL ++I+ LQ NNPS++DLPLI AYQ VV
Sbjct  84   GFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISALQVNNPSLIDLPLIKAYQDVV  143

Query  422  GSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVV  601
              L    +M+ILDNH+SKP WCCS+ DGNGFFGD YFDP LW+ GLTK+AT+F G +NVV
Sbjct  144  KGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDPDLWIKGLTKMATLFKGVTNVV  203

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             MSLRNELRGP+QN NDW++YM +GAEAVH ANPD+LVI SGL++D DLSFL
Sbjct  204  AMSLRNELRGPRQNANDWFKYMPKGAEAVHGANPDVLVIMSGLNYDLDLSFL  255



>ref|XP_010514260.1| PREDICTED: uncharacterized protein LOC104790246 [Camelina sativa]
Length=511

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 189/227 (83%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST S WI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI++MGFNCVR
Sbjct  49   MAFPLSTKSHWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVR  108

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  109  LTWPLDLATNETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  168

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  169  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLR  228

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+ W++YMQQGAEAVH ANP++LVI SGLS+D DLSF+
Sbjct  229  NELRGPKQNVDAWFKYMQQGAEAVHEANPEVLVILSGLSYDTDLSFV  275



>ref|XP_010026597.1| PREDICTED: uncharacterized protein LOC104416968 [Eucalyptus grandis]
 gb|KCW59702.1| hypothetical protein EUGRSUZ_H02462 [Eucalyptus grandis]
Length=514

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  7    VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  66

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY++V+ SL  
Sbjct  67   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRN  126

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  127  NQVMVILDNHITTPGWCCSGEDGNGFFGDKYFDPQVWIQGLHKMATMATGFSNVIGMSLR  186

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QNV+DWY+YMQQGAE+VHAANPD+LVI SGL +DK LSFL
Sbjct  187  NELRGPRQNVDDWYKYMQQGAESVHAANPDVLVILSGLHYDKVLSFL  233



>ref|XP_010425288.1| PREDICTED: uncharacterized protein LOC104710406 [Camelina sativa]
Length=555

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 189/227 (83%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST SRWI++  G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI++MGFNCVR
Sbjct  48   MAFPLSTKSRWIIDVKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAKKILEMGFNCVR  107

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TND+LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  108  LTWPLDLATNDTLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  167

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  168  RNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLR  227

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+ W++YMQQGAEAVH ANP++LVI SGLS+D DLSF+
Sbjct  228  NELRGPKQNVDAWFKYMQQGAEAVHEANPEVLVILSGLSYDTDLSFV  274



>ref|XP_010026600.1| PREDICTED: uncharacterized protein LOC104416972 [Eucalyptus grandis]
Length=647

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 191/227 (84%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVAQ L  NSRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  139  VVAQKLYANSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  198

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTWPL L  N++LAS TV QSF+NLGLLES+AG+++NNPS+++LP++ AY++V+ SL  
Sbjct  199  RLTWPLELPINETLASFTVTQSFQNLGLLESLAGIKSNNPSLINLPVMEAYKSVITSLRN  258

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  259  NQVMVILDNHITTPGWCCSEKDGNGFFGDTYFDPQVWMQGLHKMATMATGFSNVIGMSLR  318

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QNV+ WY+YMQQGAE VHAANPD+LVI SG +FD DLSFL
Sbjct  319  NELRGPRQNVDAWYKYMQQGAETVHAANPDVLVILSGFNFDTDLSFL  365



>ref|XP_010026596.1| PREDICTED: uncharacterized protein LOC104416965 [Eucalyptus grandis]
Length=515

 Score =   336 bits (862),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  7    VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  66

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY++V+ SL  
Sbjct  67   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKSVMTSLRN  126

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
             +VM+ILDNHI+ PGWCCS  DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSLR
Sbjct  127  NQVMVILDNHITTPGWCCSGEDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGMSLR  186

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QNV+DWY+YMQQGAE+VHAANPD+LVI SGL +DK LSF+
Sbjct  187  NELRGPRQNVDDWYKYMQQGAESVHAANPDVLVILSGLHYDKVLSFI  233



>ref|NP_189245.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 dbj|BAB02434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77125.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=508

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 189/227 (83%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLSTNSRWI++E G+RVKLACVNW +HL+ VVAEGLSKQ VD ++KKI+ MGFNCVR
Sbjct  1    MAYPLSTNSRWIIDEKGQRVKLACVNWPSHLQPVVAEGLSKQSVDDLAKKIMAMGFNCVR  60

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
             TWPL L TN++LA+ +TVRQSF++LGL + I+G +  NPS++DLPLI AY+ VV  L  
Sbjct  61   FTWPLDLATNETLANNVTVRQSFQSLGLNDDISGFETKNPSMIDLPLIEAYKKVVAKLGN  120

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+A  F G +NVVGMSLR
Sbjct  121  NNVMVILDNHVTKPGWCCGYNDGNGFFGDTFFDPTTWIAGLTKIAMTFKGATNVVGMSLR  180

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+DW++YMQQGAEAVH ANP++LVI SGLS+D DLSF+
Sbjct  181  NELRGPKQNVDDWFKYMQQGAEAVHEANPNVLVILSGLSYDTDLSFV  227



>ref|XP_007159684.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
 gb|ESW31678.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
Length=573

 Score =   338 bits (866),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 185/222 (83%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            L T+SRWIV + GRRVKLACVNWV+HLEV V EGLSK+PVDVISK I  MGFNCVRLTWP
Sbjct  47   LHTDSRWIVGQDGRRVKLACVNWVSHLEVAVPEGLSKKPVDVISKGIKSMGFNCVRLTWP  106

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
              L TNDSLASL+VR SF+ LGLLE +AG+Q NNPSI+DLPLI A++A+V +L    VM+
Sbjct  107  TLLVTNDSLASLSVRSSFQKLGLLEPVAGVQTNNPSIIDLPLIQAFEAMVKNLGDNDVMV  166

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH+++PGWCC + DGNGFF D +F+P  W+ GLTK+AT+F G   VVGMSLRNELRG
Sbjct  167  ILDNHLTQPGWCCGNTDGNGFFTDKFFNPDQWISGLTKMATLFKGVKTVVGMSLRNELRG  226

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             KQNVNDWY+YM +GAEAVHAAN D+LVI SGL+FD DLSF+
Sbjct  227  SKQNVNDWYKYMVKGAEAVHAANSDVLVILSGLNFDTDLSFI  268



>ref|XP_010691763.1| PREDICTED: uncharacterized protein LOC104905020 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            T  A PLST+SRWIV+ESG+RVKLACVNW +H+E++V EGL++QPVD ISKKI DMGFNC
Sbjct  19   TSYALPLSTDSRWIVDESGQRVKLACVNWPSHVELMVTEGLNEQPVDAISKKIRDMGFNC  78

Query  254  VRLTWPLFLFTNDSLASLTVRQSFKNLGLL-ESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            VRLT+P++L TND+LAS++VRQ+F N+GL   +IA  QA NPSI+DLP I A+QAVV SL
Sbjct  79   VRLTYPIYLATNDTLASISVRQTFLNVGLPNRTIAKFQAYNPSIIDLPRIDAFQAVVTSL  138

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  610
             K KVM+ILDNH+SKP WCC   DGNGFFGD YF+P+LW+ GLT +AT F     VVGMS
Sbjct  139  GKNKVMVILDNHVSKPQWCCKQTDGNGFFGDKYFNPELWIKGLTNMATRFRDNPYVVGMS  198

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGP QN NDWY+YMQ+GAEAVH ANP++L I SGLS+D DLSF+
Sbjct  199  LRNELRGPNQNANDWYKYMQRGAEAVHKANPNVLTILSGLSYDSDLSFV  247



>ref|XP_010476303.1| PREDICTED: uncharacterized protein LOC104755594 [Camelina sativa]
Length=559

 Score =   337 bits (864),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 189/227 (83%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E G+RVKL C NW +HL+ VVAEGLSKQPVD ++KKIVDMGFNCVR
Sbjct  43   MAYPLSTSSRWIVDEKGQRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVDMGFNCVR  102

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVR SF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  103  LTWPLDLMTNETLANNVTVRHSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  162

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC + DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  163  NNVMVILDNHLTKPGWCCDNNDGNGFFGDQFFDPTVWVTALKKMAGTFDGVSNVVGMSLR  222

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW+ YMQQGAEAVH+AN ++LVI SGLSFD DLSF+
Sbjct  223  NELRGPKQNVNDWFNYMQQGAEAVHSANKNVLVILSGLSFDSDLSFV  269



>ref|XP_010502524.1| PREDICTED: uncharacterized protein LOC104779826 [Camelina sativa]
Length=534

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 189/227 (83%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST SRWI++  G+RVKLACVNW +HL+ VVAEGLSKQ VD +++KI++MGFNCVR
Sbjct  27   MAFPLSTKSRWIIDVKGQRVKLACVNWPSHLQPVVAEGLSKQRVDDLAEKILEMGFNCVR  86

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF+ LGL + I+G Q  NPS++DLPLI AY+ VV  L  
Sbjct  87   LTWPLDLATNETLANNVTVRQSFQRLGLTDDISGFQTKNPSMIDLPLIEAYKKVVAKLGD  146

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC   DGNGFFGD +FDP  W+ GLTK+AT F GTSNVVGMSLR
Sbjct  147  KNVMVILDNHVTKPGWCCGYDDGNGFFGDTFFDPATWIAGLTKIATTFKGTSNVVGMSLR  206

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+ W++YMQQGAEAVH ANP++LVI SGLS+D DLSF+
Sbjct  207  NELRGPKQNVDAWFKYMQQGAEAVHEANPEVLVILSGLSYDTDLSFV  253



>ref|XP_002889989.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66248.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 191/227 (84%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E+G+RVKL C NW +HL+ VVAEGLSKQP D ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLMCANWPSHLQPVVAEGLSKQPADAVAKKIVEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+DL LI AY+ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLSLIEAYKMVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP +WV  L K+A  F+G SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFDGVSNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH++N  +LVI SGLSFD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSSNKKVLVILSGLSFDADLSFV  257



>ref|XP_010249430.1| PREDICTED: uncharacterized protein LOC104591974 [Nelumbo nucifera]
Length=538

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              A PL TNS+WIV+E+G+RVKLACVNW++HL+ ++AEGL++QP+D ISK IV MGFNCV
Sbjct  28   AAALPLYTNSQWIVDENGQRVKLACVNWISHLQPLLAEGLNRQPLDTISKTIVSMGFNCV  87

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            R TWPLF+ TN+SL SL VRQSF+NLGL ESI  +  NNPS+++L +I A++AVV +L  
Sbjct  88   RFTWPLFMATNESLYSLNVRQSFENLGLNESIGAILVNNPSMLNLTVIQAFKAVVDNLGD  147

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNHISKPGWCCS  DGNGFFGD YFDP+LW+ GLT++AT FNGT+NV+GMSLR
Sbjct  148  NNVMVILDNHISKPGWCCSRTDGNGFFGDTYFDPELWIKGLTQMATWFNGTTNVIGMSLR  207

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRG +QNV+ WY+YMQ GAEA+H ANP +L I SGL FD DLSFL
Sbjct  208  NELRGSRQNVSVWYKYMQAGAEAIHKANPHVLTILSGLEFDHDLSFL  254



>emb|CDY16066.1| BnaC08g40570D [Brassica napus]
Length=553

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 193/235 (82%), Gaps = 3/235 (1%)
 Frame = +2

Query  56   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            +H  P   +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV
Sbjct  24   AHTVPN--MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIV  81

Query  236  DMGFNCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  412
            +MGFNCVRLTWPL L TN++LA+ +TVRQSF++LGL + I G Q NNPSI+D  LI A +
Sbjct  82   EMGFNCVRLTWPLDLMTNETLANNVTVRQSFQSLGLTDDIVGFQTNNPSIIDFSLIEALK  141

Query  413  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  592
             VV  L  + VM ILDNH++K GWCC++ DGNGFFGD +FDP +W   L+K+A  FNG S
Sbjct  142  MVVTKLGNHNVMAILDNHLTKSGWCCANNDGNGFFGDNFFDPTVWTAALSKMAATFNGVS  201

Query  593  NVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NVVGMSLRNELRGPKQNVNDW++YMQQGAEA H+AN ++LVI SGLSFD DLSF+
Sbjct  202  NVVGMSLRNELRGPKQNVNDWFKYMQQGAEAAHSANKNVLVIMSGLSFDTDLSFI  256



>dbj|BAK05121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  238
            H AP   V   LST SRW+V+E G RVKLACVNW +HLE ++AEGL K+PV  I+  +  
Sbjct  28   HHAPAAAVT--LSTASRWVVDEDGDRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAA  85

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++VDL LI A++AV
Sbjct  86   MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPAVVDLKLIDAFKAV  145

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  146  VSSLGENNVMVILDNHVSKPGWCCDNADGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  205

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGP+QN NDWY+YMQ+GAEAVHAANP +LVI SGLSFD DL+FL
Sbjct  206  VGMSLRNELRGPRQNSNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFL  258



>ref|XP_009152076.1| PREDICTED: uncharacterized protein LOC103875318 [Brassica rapa]
Length=559

 Score =   334 bits (857),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 193/229 (84%), Gaps = 4/229 (2%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  25   AFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  84

Query  257  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  85   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  144

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMS  610
            K+++M+ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL ++ATMF N +SNVVGMS
Sbjct  145  KHRLMVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGMS  204

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQN+ DWY+YM++GAEAVH+ NP++LVI SGL+++ DLSFL
Sbjct  205  LRNELRGPKQNIKDWYKYMREGAEAVHSVNPNILVIVSGLNYETDLSFL  253



>emb|CDY13613.1| BnaA06g33100D [Brassica napus]
Length=559

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 193/229 (84%), Gaps = 4/229 (2%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  25   AFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  84

Query  257  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  85   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  144

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMS  610
            K+++M+ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL ++ATMF N +SNVVGMS
Sbjct  145  KHRLMVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKRMATMFANVSSNVVGMS  204

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQN+ DWY+YM++GAEAVH+ NP++LVI SGL+++ DLSFL
Sbjct  205  LRNELRGPKQNIKDWYKYMREGAEAVHSVNPNILVIVSGLNYETDLSFL  253



>ref|XP_010250982.1| PREDICTED: uncharacterized protein LOC104593037 isoform X2 [Nelumbo 
nucifera]
Length=531

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 194/225 (86%), Gaps = 2/225 (1%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A PL T+SRWIV+E+G+RVKL CVNW +HL+ ++AEGL+KQP+DVISK+IV MGFNCVR 
Sbjct  29   ALPLYTDSRWIVDETGKRVKLGCVNWASHLQPLLAEGLNKQPLDVISKQIVAMGFNCVRF  88

Query  263  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            TWPL++ TND+L+S+TV+QSF++LGLLESI  ++ NNPS+++L ++ A+Q VV +L +  
Sbjct  89   TWPLWMATNDTLSSMTVQQSFESLGLLESIGAIRVNNPSMLNLTILQAFQTVVSNLGENG  148

Query  443  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  622
            VM+ILDNHISKPGWCCS+ DGNG+FGDIYFDP LW+ GLT++AT+FNGTSNV+GMSLRNE
Sbjct  149  VMVILDNHISKPGWCCSNTDGNGYFGDIYFDPNLWIEGLTRMATLFNGTSNVIGMSLRNE  208

Query  623  LRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRGP Q+V+ W  YMQ GAEAVH ANP++L I SGL FDKDL FL
Sbjct  209  LRGPNQDVSIW--YMQLGAEAVHKANPNVLTILSGLDFDKDLHFL  251



>emb|CDY19395.1| BnaC05g09040D [Brassica napus]
Length=527

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 191/227 (84%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  1    MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDAVAKKIVEMGFNCVR  60

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  61   LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  120

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGMSLR
Sbjct  121  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLR  180

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQN +DW++YMQQGAEAVHAAN ++LVI SGLSFD DLSF+
Sbjct  181  NELRGPKQNADDWFKYMQQGAEAVHAANKNVLVILSGLSFDADLSFV  227



>gb|KFK43579.1| hypothetical protein AALP_AA1G144700 [Arabis alpina]
Length=646

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 193/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E+G+R+KLAC NW +HL+ VVAEGLSKQPVD ++KKIV+MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRIKLACANWPSHLQPVVAEGLSKQPVDALAKKIVEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+DL LI A++ VV +L  
Sbjct  91   LTWPLDLMTNETLANNVTVRQSFQSFGLNDDIVGFQTNNPSIIDLSLIEAFKMVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCCS+ DGNGFFGD +FDP +W   L+K+A  F+G SNV+GMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCSNNDGNGFFGDRFFDPTVWTAALSKMAATFDGVSNVIGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNVNDW++YMQQGAEAVH+AN ++LVI SG++FD DLSF+
Sbjct  211  NELRGPKQNVNDWFKYMQQGAEAVHSANKNVLVILSGINFDTDLSFV  257



>ref|NP_001130915.1| hydrolase, hydrolyzing O-glycosyl compound precursor [Zea mays]
 gb|ACF85192.1| unknown [Zea mays]
 gb|ACG23910.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
 gb|ACN27949.1| unknown [Zea mays]
 gb|ACN28477.1| unknown [Zea mays]
 gb|ACN34624.1| unknown [Zea mays]
 gb|ACN34788.1| unknown [Zea mays]
 tpg|DAA37297.1| TPA: hydrolase, hydrolyzing O-glycosyl compound [Zea mays]
Length=576

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              A  LST SRW+++ESG RVKLACVNW +HLE V+AEGL K+PV  I+  +  MGFNCV
Sbjct  31   CAAATLSTASRWVLDESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCV  90

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            R TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AVV SL +
Sbjct  91   RFTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGE  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
            + +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NVVGMSLR
Sbjct  151  HNLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QNVNDWY+YMQ+GAEAVHAANP +LVI SGLSFD DL+FL
Sbjct  211  NELRGPRQNVNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFL  257



>gb|ACF79301.1| unknown [Zea mays]
Length=576

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 185/227 (81%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              A  LST SRW+++ESG RVKLACVNW +HLE V+AEGL K+PV  I+  +  MGFNCV
Sbjct  31   CAAATLSTASRWVLDESGSRVKLACVNWPSHLEPVLAEGLGKRPVGAIAADVAAMGFNCV  90

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            R TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AVV SL +
Sbjct  91   RFTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAVVSSLGE  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
            + +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NVVGMSLR
Sbjct  151  HNLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QNVNDWY+YMQ+GAEAVHAANP +LVI SGLSFD DL+FL
Sbjct  211  NELRGPRQNVNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFL  257



>emb|CDX83590.1| BnaC07g23300D [Brassica napus]
Length=557

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 189/228 (83%), Gaps = 3/228 (1%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I  KIV MGFNCV
Sbjct  24   AFPLSTDSRWIVDDGNKGRRVKLTCVNWASHLETAVAEGLSKQPLDSIGAKIVSMGFNCV  83

Query  257  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL+L T++S +  +TVRQS + LGLLE+I+G QANNP I+DLPLI A+Q VV SL 
Sbjct  84   RLTWPLYLATDESFSGIMTVRQSLRKLGLLEAISGFQANNPYILDLPLIKAFQEVVSSLG  143

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            K ++++ILDNHIS+PGWCC+  DGNGFFGD Y +P+LW+ GL  +ATMF   SNVVGMSL
Sbjct  144  KNRLLVILDNHISQPGWCCNDNDGNGFFGDRYLNPQLWIRGLKNMATMFANVSNVVGMSL  203

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNELRGPKQN+ DWY+YM++GAEAVH+ NP++LVI SGL+++ DLSFL
Sbjct  204  RNELRGPKQNIKDWYKYMREGAEAVHSVNPNILVIVSGLNYETDLSFL  251



>ref|XP_010556350.1| PREDICTED: uncharacterized protein LOC104825676 [Tarenaya hassleriana]
Length=560

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 194/226 (86%), Gaps = 1/226 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A PLST+SRWIV+E+G+RVKLAC NW +HL+ VVAEGLSK+PV+ I++KIV MGFNCVRL
Sbjct  29   AYPLSTSSRWIVDETGQRVKLACANWPSHLQPVVAEGLSKKPVEEIAEKIVGMGFNCVRL  88

Query  263  TWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            TWPL L TN +LA ++TVRQSF++LGL + I G Q +NPSI+DLPLI A++ VV +L   
Sbjct  89   TWPLDLATNFTLAHNVTVRQSFQSLGLNDDIVGFQTHNPSIIDLPLIDAFKTVVEALGNK  148

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             VM++LDNHI+KPGWCCS+ DGNGFFGD +FDP +W+ GLT +A++FNG SNVVGMSLRN
Sbjct  149  GVMVVLDNHITKPGWCCSNDDGNGFFGDRFFDPAVWISGLTNMASIFNGVSNVVGMSLRN  208

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRG +QN NDW++YM+QGAEA+H+ANP++LVI SGLSFD DLSF+
Sbjct  209  ELRGSRQNTNDWFKYMEQGAEAIHSANPNVLVILSGLSFDADLSFV  254



>ref|XP_009148543.1| PREDICTED: uncharacterized protein LOC103871957 [Brassica rapa]
Length=574

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 191/227 (84%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD +++KIV+MGFNCVR
Sbjct  48   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKIVEMGFNCVR  107

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  108  LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  167

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGMSLR
Sbjct  168  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLR  227

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQN +DW++YMQQGAEAVHAAN ++LVI SGLSFD DLSF+
Sbjct  228  NELRGPKQNADDWFKYMQQGAEAVHAANKNVLVILSGLSFDADLSFV  274



>ref|XP_006395581.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
 gb|ESQ32867.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
Length=557

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 191/229 (83%), Gaps = 4/229 (2%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGFNCV
Sbjct  26   AFPLSTDSRWIVDDGIKGRRVKLTCVNWPSHLETAVAEGLSKQPIDSIAEKIVLMGFNCV  85

Query  257  RLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL+L T++S +  +TVRQS +  GL E+++G QANNPSI+DLPLI A+Q VV  L 
Sbjct  86   RLTWPLYLATDESFSGIMTVRQSLRKFGLFEAVSGFQANNPSILDLPLIKAFQEVVTCLG  145

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMS  610
             +++M++LDNHIS+PGWCCS  DGNGFFGD + +P LW+ GL K+A+MF N +SNVVGMS
Sbjct  146  NHRLMVVLDNHISQPGWCCSDNDGNGFFGDRHLNPNLWIKGLMKLASMFANVSSNVVGMS  205

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPKQN+ DWY+YM++GAEAVH+ NPD+LVI SGL++D DLSFL
Sbjct  206  LRNELRGPKQNIKDWYKYMRKGAEAVHSVNPDILVIVSGLNYDTDLSFL  254



>emb|CDX98009.1| BnaA06g07600D [Brassica napus]
Length=557

 Score =   329 bits (843),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 191/227 (84%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A PLST+SRWIV+E+G+RVKLACVNW +HL+ VVAEGLSKQPVD +++KI++MGFNCVR
Sbjct  31   MAYPLSTSSRWIVDENGQRVKLACVNWPSHLQPVVAEGLSKQPVDDVARKILEMGFNCVR  90

Query  260  LTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTW L L TN++LA+ +TVRQSF++ GL + I G Q NNPSI+D+ LI A++ VV +L  
Sbjct  91   LTWALDLMTNETLANNVTVRQSFQSFGLKDDIVGFQTNNPSIIDISLIEAFKMVVTTLGN  150

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH++KPGWCC++ DGNGFFGD +FDP  W   L+K+A  F+G SNVVGMSLR
Sbjct  151  NDVMVILDNHLTKPGWCCANNDGNGFFGDKFFDPTEWTAALSKMAATFDGVSNVVGMSLR  210

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQN +DW++YMQQGAEAVHAAN ++LVI SGLSFD DLSF+
Sbjct  211  NELRGPKQNADDWFKYMQQGAEAVHAANKNVLVILSGLSFDADLSFV  257



>ref|XP_009152075.1| PREDICTED: uncharacterized protein LOC103875317 [Brassica rapa]
Length=538

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 184/227 (81%), Gaps = 1/227 (0%)
 Frame = +2

Query  80   VAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            +A  LSTNSRWI++E G R KLACVNW  HL+  VAEGLSKQPVD +++KIV MGFNCVR
Sbjct  26   MAYLLSTNSRWIIDEKGERTKLACVNWPAHLQPAVAEGLSKQPVDAVAQKIVAMGFNCVR  85

Query  260  LTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            LTWPL L TN +LA S+TVR SF++LGL   I+G +  NPS++DLPLI AYQ+VV +L  
Sbjct  86   LTWPLDLATNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQSVVTTLGN  145

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
            Y VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSNVVGMSLR
Sbjct  146  YNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSNVVGMSLR  205

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQNV+DW++YM QGAEAVH ANP  LVI SG S+D DLSF+
Sbjct  206  NELRGPKQNVDDWFKYMLQGAEAVHEANPYALVILSGFSYDTDLSFV  252



>ref|XP_010026595.1| PREDICTED: uncharacterized protein LOC104416964 [Eucalyptus grandis]
Length=535

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 186/234 (79%), Gaps = 0/234 (0%)
 Frame = +2

Query  56   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            S  A P   +  L T SRWIV++ G RVKLACVNW +HLE +VAEGL K+PVD ISK+I 
Sbjct  19   SQHAEPAKASWRLHTESRWIVDKHGHRVKLACVNWASHLEPMVAEGLDKKPVDWISKQIA  78

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             MGFNCVRLTWPLF+ TNDSL S++V QSF++LGL++ I G++ NNPS++D+ ++ A++A
Sbjct  79   SMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRDLGLVDYIGGIRQNNPSLLDVSVLAAFRA  138

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV SL    VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP LW+ GLT++ATM     N
Sbjct  139  VVTSLGDNSVMVILDNHISKPGWCCSNRDGNGFFGDQYFDPNLWIKGLTRMATMIRRIGN  198

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGPK+N+ DW RYM++GAE VH+ANP +LVI SGL +D DL FL
Sbjct  199  VVGMSLRNELRGPKENLRDWLRYMERGAEVVHSANPHVLVIASGLYYDTDLWFL  252



>gb|KCW59699.1| hypothetical protein EUGRSUZ_H02457, partial [Eucalyptus grandis]
Length=528

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 195/252 (77%), Gaps = 0/252 (0%)
 Frame = +2

Query  2    MENKYSFllclilcniiiSHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVV  181
            M  + S+L  + L  ++ S  A P   +  L T SRWIV++ G RVKLACVNW +HLE +
Sbjct  1    MRRRPSYLCFIALWALVASQHAEPAKASWRLHTESRWIVDKHGHRVKLACVNWASHLEPM  60

Query  182  VAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGL  361
            VAEGL K+PVD ISK+I  MGFNCVRLTWPLF+ TNDSL S++V QSF++LGL++ I G+
Sbjct  61   VAEGLDKKPVDWISKQIASMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRDLGLVDYIGGI  120

Query  362  QANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPK  541
            + NNPS++D+ ++ A++AVV SL    VM+ILDNHISKPGWCCS+ DGNGFFGD YFDP 
Sbjct  121  RQNNPSLLDVSVLAAFRAVVTSLGDNSVMVILDNHISKPGWCCSNRDGNGFFGDQYFDPN  180

Query  542  LWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIF  721
            LW+ GLT++ATM     NVVGMSLRNELRGPK+N+ DW RYM++GAE VH+ANP +LVI 
Sbjct  181  LWIKGLTRMATMIRRIGNVVGMSLRNELRGPKENLRDWLRYMERGAEVVHSANPHVLVIA  240

Query  722  SGLSFDKDLSFL  757
            SGL +D DL FL
Sbjct  241  SGLYYDTDLWFL  252



>ref|XP_002446675.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
 gb|EES11003.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
Length=586

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 179/222 (81%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            LST SRW+V+ESG RVKLACVNW +HLE ++AEGL K+PV  I+  +  MGFNCVR TWP
Sbjct  38   LSTASRWVVDESGSRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAAMGFNCVRFTWP  97

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
             FL TN S + LTV QSF  L L ES+AG++ NNP  VDL LI A++AVV SL ++ VM+
Sbjct  98   TFLVTNASYSGLTVAQSFLRLNLTESLAGIRVNNPGFVDLKLIDAFKAVVSSLGEHDVMV  157

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH+SKPGWCCS+ DGNGFFGD  FDP +WV GLTK+ATMF G  NVVGMSLRNELRG
Sbjct  158  ILDNHLSKPGWCCSNTDGNGFFGDALFDPDVWVDGLTKMATMFAGVPNVVGMSLRNELRG  217

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            P+QN NDWY+YMQ+GAEAVHAANP +LVI SGL FD DL+FL
Sbjct  218  PRQNANDWYKYMQRGAEAVHAANPRVLVILSGLQFDNDLAFL  259



>ref|XP_010528075.1| PREDICTED: uncharacterized protein LOC104805267 [Tarenaya hassleriana]
Length=575

 Score =   327 bits (838),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST+SRWIV  +GRRVKLAC+ W +HL+  VAEGLSK+P+D I++KI+ MGFNCVR TW
Sbjct  26   PLSTDSRWIVGLTGRRVKLACIVWPSHLDAAVAEGLSKRPMDAIAEKILSMGFNCVRFTW  85

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            PL+L T+DS AS+TVRQS + LGL E+I+G+QANNPSI+DLPLI A+Q +V  L K ++M
Sbjct  86   PLYLATDDSFASMTVRQSLRRLGLFEAISGVQANNPSIIDLPLIRAFQEMVSCLGKNRLM  145

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDN+ S+PGWCCS  DGNGFF D +F+P LW+  L K+A+MF   SNVVGMSLRN+LR
Sbjct  146  VILDNYTSQPGWCCSDNDGNGFFWDRHFNPDLWINSLKKMASMFANVSNVVGMSLRNDLR  205

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP+QN +DWY+YMQ+GAEAVH+ NP++LVI SGLS++ DLSFL
Sbjct  206  GPRQNTDDWYKYMQKGAEAVHSMNPNVLVIVSGLSYETDLSFL  248



>ref|XP_010026599.1| PREDICTED: uncharacterized protein LOC104416971 [Eucalyptus grandis]
Length=419

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 194/252 (77%), Gaps = 0/252 (0%)
 Frame = +2

Query  2    MENKYSFllclilcniiiSHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVV  181
            M  + S+L  + L  ++ S  A P      L T+SRWIV++ GRRVKLACVNW +HLE +
Sbjct  1    MRRRPSYLCFIALWALVASRHAEPAKAPWRLHTDSRWIVDKHGRRVKLACVNWASHLEPM  60

Query  182  VAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGL  361
            VAEGL K+PVD ISK+I  MGFNCVRLTWPLF+ TNDSL S++V QSF+NLGL++ I G+
Sbjct  61   VAEGLDKKPVDWISKQIASMGFNCVRLTWPLFMVTNDSLGSMSVAQSFRNLGLVDYIGGI  120

Query  362  QANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPK  541
            + NN S++D+ ++ A++AVV SL    VM+ILDNHISKPGWCCS+ D NGFFGD YFDP 
Sbjct  121  RQNNLSLLDVSVLAAFRAVVKSLGDNNVMVILDNHISKPGWCCSNRDSNGFFGDPYFDPN  180

Query  542  LWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIF  721
            LW+ GLT++AT+F+   NVVGMSLRNELRGPK+N+ DW RYM+ GAEAVH ANP +LVI 
Sbjct  181  LWIKGLTRMATLFHRVGNVVGMSLRNELRGPKENLRDWLRYMKSGAEAVHLANPHVLVIV  240

Query  722  SGLSFDKDLSFL  757
            SGL  D DL FL
Sbjct  241  SGLYCDTDLWFL  252



>ref|XP_010535458.1| PREDICTED: uncharacterized protein LOC104810759 [Tarenaya hassleriana]
Length=394

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 184/228 (81%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
             +A PLSTNSRWIVNE G+RVKLACVNW +HL+ VVAEGLS+QPV  I+ +IV M FNCV
Sbjct  26   TMAYPLSTNSRWIVNEGGQRVKLACVNWPSHLQPVVAEGLSQQPVTEIANRIVAMKFNCV  85

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L  ND+LA S+TVRQSF++LGL + I G+Q  NP+ +DLPLI A + VV  L 
Sbjct  86   RLTWPLELAINDTLANSVTVRQSFQSLGLNDDIDGIQRKNPNFIDLPLIEALKTVVNVLG  145

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCCS+ DGNGFFGD +FDP  W+ G  K+A +FNG SNV+GMSL
Sbjct  146  QKGVMVILDNHLTVPGWCCSAGDGNGFFGDRFFDPTAWINGWKKMAGIFNGVSNVIGMSL  205

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNELRG KQNVNDWY YMQQGAEA+H+ NP++LVI SGL FD DLSF+
Sbjct  206  RNELRGRKQNVNDWYTYMQQGAEAIHSVNPNVLVIMSGLGFDTDLSFV  253



>ref|XP_006648806.1| PREDICTED: uncharacterized protein LOC102721430 [Oryza brachyantha]
Length=340

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 181/228 (79%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVA  LST+SRWIV+E+GRRVKLACVNW +HLE VVAEGL +QPVD ISKK+  +GFNCV
Sbjct  35   VVAVTLSTSSRWIVDEAGRRVKLACVNWPSHLEPVVAEGLGRQPVDAISKKVASLGFNCV  94

Query  257  RLTWPLFLFTNDSLASLTVRQ-SFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLT+P+ L TN SL+SLTVRQ S    GL E++AG+  NNP  +DL LI +++AVV SL 
Sbjct  95   RLTYPIALATNASLSSLTVRQGSLLAHGLAETVAGVGENNPGFLDLTLIESFRAVVDSLG  154

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH+S+PGWCC+  DGNGFFGD YFD  +WV GL  +A +F G  NVVGMSL
Sbjct  155  ENDVMVILDNHVSQPGWCCADDDGNGFFGDRYFDSDVWVQGLANMAALFAGVPNVVGMSL  214

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNELRGP+QN  DWYRYMQ+GAEAVHAANP  LV+  GL +D DLSFL
Sbjct  215  RNELRGPRQNHGDWYRYMQRGAEAVHAANPAALVVMGGLGYDTDLSFL  262



>ref|XP_002284888.2| PREDICTED: uncharacterized protein LOC100258876 [Vitis vinifera]
Length=518

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 185/227 (81%), Gaps = 5/227 (2%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVA PL TNSRWIV+E G RVKLACVNW++H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  32   VVALPLHTNSRWIVDEDGARVKLACVNWLSHQEAAVAEGLSNHPVDLISKRIASLGFNCV  91

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLT PLFL  + SLASLTVRQSF+ LGLLES+AG QANNPS++DLPL +AYQAVV +LA 
Sbjct  92   RLTLPLFLAIDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLAD  151

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILD+H S+P     S+ GNG FGD +F+P LWV GLT++ATMF+G  NVVGMSLR
Sbjct  152  NNMMVILDSHFSEP-----SFHGNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGMSLR  206

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELR P QNV DWYRYMQ+GAEAVH+ANPD+LVI SGLS   DLSFL
Sbjct  207  NELRCPNQNVKDWYRYMQKGAEAVHSANPDVLVIISGLSDGTDLSFL  253



>ref|XP_004975985.1| PREDICTED: uncharacterized protein LOC101760765 [Setaria italica]
Length=566

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 178/222 (80%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            LST SRW+V+E G RVKLACVNW +HLE ++AEGLSK+PV  I+  +  MGFNCVRLTWP
Sbjct  33   LSTASRWVVDEGGSRVKLACVNWPSHLEPMLAEGLSKRPVGAIAAAVAAMGFNCVRLTWP  92

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
             FL T+ S   LTV QSF+ L L ES+AG++ANNP  VDL LI A +AVV SL K+ VM+
Sbjct  93   TFLATDASYGELTVAQSFQRLNLTESLAGIRANNPDFVDLKLIDALKAVVSSLGKHDVMV  152

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH+SKPGWCCS+ DGNGFFGD YFDP +WV GL K+A MF G  NVVGMSLRNELRG
Sbjct  153  ILDNHLSKPGWCCSNTDGNGFFGDTYFDPDVWVAGLKKMAAMFAGVDNVVGMSLRNELRG  212

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            P+QN NDWY+YMQ GAEAVH ANP +LVI SGLSFD DL+F+
Sbjct  213  PRQNANDWYKYMQLGAEAVHGANPRVLVILSGLSFDNDLAFI  254



>ref|XP_006290844.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
 gb|EOA23742.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
Length=554

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 190/233 (82%), Gaps = 5/233 (2%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            T  A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  18   TTFALPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPMDSIAEKIVSMGF  77

Query  248  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL+L T++S +  +TVRQS    GL E+++G Q +NP+++DLPLI A+Q VV 
Sbjct  78   NCVRLTWPLYLATDESFSDIMTVRQSLLKFGLFEAVSGFQVHNPTVLDLPLIKAFQEVVA  137

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTSNV  598
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +SNV
Sbjct  138  CLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFASNVSSNV  197

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGPKQN+ DWY YM++GAEAVH+ NPD+LVI SGL++  DLSFL
Sbjct  198  VGMSLRNELRGPKQNIKDWYMYMKKGAEAVHSINPDVLVIVSGLNYATDLSFL  250



>gb|KFK33555.1| hypothetical protein AALP_AA5G028800 [Arabis alpina]
Length=552

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 189/227 (83%), Gaps = 4/227 (2%)
 Frame = +2

Query  89   PLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            PLSTNSRWIV++S  GRRVKL C+NW +HLE  VAEGLSKQP+D I+ KI  MGFNCVRL
Sbjct  24   PLSTNSRWIVDDSNHGRRVKLTCINWPSHLETAVAEGLSKQPLDSIADKIFSMGFNCVRL  83

Query  263  TWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            TWPL+L T++S +  +TVRQS +   L E+++G Q NNPSI+DLPLI A+Q VV  L  +
Sbjct  84   TWPLYLATDESFSGVMTVRQSLRKFRLFEAVSGFQVNNPSILDLPLIKAFQEVVTCLGNH  143

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVVGMSLR  616
             +M+ILDNHIS+PGWCC++ DGNGFFGD + +P++W+ GL K+A+MF N +SNVVGMSLR
Sbjct  144  GLMVILDNHISQPGWCCNANDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVVGMSLR  203

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGPKQN+NDWY+YM++GAEAVH+ NPD+LVI SGL+++ DLSFL
Sbjct  204  NELRGPKQNINDWYKYMREGAEAVHSVNPDILVIVSGLNYETDLSFL  250



>ref|XP_010240029.1| PREDICTED: uncharacterized protein LOC100839976 [Brachypodium 
distachyon]
Length=562

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 179/222 (81%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            LST SRWIV+E+G RVKLACVNW +HLE ++AEGLSK+PV  I+  +  MGFNCVRLTWP
Sbjct  32   LSTASRWIVDEAGDRVKLACVNWPSHLEPMLAEGLSKRPVGSIAGDVAAMGFNCVRLTWP  91

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
             F+ TN S  SLTV QSF+ L L E +AG++ANNP++VDL LI A++AVV SL +  +M+
Sbjct  92   TFMVTNASYTSLTVAQSFQRLNLTEPLAGIRANNPALVDLRLIDAFKAVVSSLGENNLMV  151

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH+S P WCCS+ DGNGFFGD YF P +WV GLTK+AT F    NVVGMSLRNELRG
Sbjct  152  ILDNHVSMPKWCCSNTDGNGFFGDAYFQPDVWVDGLTKMATTFAAVPNVVGMSLRNELRG  211

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            P+QN NDWY+YMQ+GAEAVHAANP  LVI SGLS+D DL+FL
Sbjct  212  PRQNANDWYKYMQRGAEAVHAANPRALVILSGLSYDNDLAFL  253



>ref|NP_189244.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AEE77124.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=551

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 191/232 (82%), Gaps = 4/232 (2%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            T  A P ST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  17   TTFAFPPSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGF  76

Query  248  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL+L T++S ++ +TVRQS +   L E+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  77   NCVRLTWPLYLATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVY  136

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  601
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  137  CLEKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  196

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GMSLRNELRGPKQN+ DWY+YM++GAEAVH+ NP++LVI SGL++  DLSFL
Sbjct  197  GMSLRNELRGPKQNIKDWYKYMREGAEAVHSVNPNVLVIVSGLNYATDLSFL  248



>ref|XP_010556349.1| PREDICTED: uncharacterized protein LOC104825675 [Tarenaya hassleriana]
Length=555

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 189/226 (84%), Gaps = 1/226 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A PLST+SRWIV+E+ +RVKL+C NW +HL+ VVAEGLSK+PV+ I+ KIV MGFNCVRL
Sbjct  29   AYPLSTSSRWIVDETSQRVKLSCANWPSHLQPVVAEGLSKKPVEEIADKIVGMGFNCVRL  88

Query  263  TWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            TWPL L TN +LA ++TVRQSF++LGL +   G Q +NPSI+DLPLI A++ VV +L   
Sbjct  89   TWPLDLATNFTLAHNVTVRQSFQSLGLYDDFVGFQTHNPSIIDLPLIDAFKTVVETLGNE  148

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             VM++LDNH++KPGWCCS  DGNGFFGD +FDP +W+ GLT +A++FNG SNVVGMSLRN
Sbjct  149  GVMVVLDNHVTKPGWCCSDDDGNGFFGDRFFDPTVWISGLTNMASIFNGVSNVVGMSLRN  208

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRG +QN NDW++YM+QGAEAVH+ANP++LVI SGL +D DLS++
Sbjct  209  ELRGSRQNTNDWFKYMEQGAEAVHSANPNVLVILSGLHYDLDLSYI  254



>dbj|BAB02432.1| unnamed protein product [Arabidopsis thaliana]
Length=561

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 191/232 (82%), Gaps = 4/232 (2%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            T  A P ST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQP+D I++KIV MGF
Sbjct  25   TTFAFPPSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQPLDAIAEKIVSMGF  84

Query  248  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL+L T++S ++ +TVRQS +   L E+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  85   NCVRLTWPLYLATDESFSAFMTVRQSLRKFRLFEAVSGFQTHNPTILDLPLIKAFQEVVY  144

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  601
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  145  CLEKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  204

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GMSLRNELRGPKQN+ DWY+YM++GAEAVH+ NP++LVI SGL++  DLSFL
Sbjct  205  GMSLRNELRGPKQNIKDWYKYMREGAEAVHSVNPNVLVIVSGLNYATDLSFL  256



>ref|XP_002876947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 189/232 (81%), Gaps = 4/232 (2%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            T  A PLST+SRWIV++   GRRVKL CVNW +HLE  VAEGLSKQ +D I++KIV MGF
Sbjct  17   TTFAFPLSTDSRWIVDDGNKGRRVKLTCVNWPSHLETAVAEGLSKQSLDSIAEKIVSMGF  76

Query  248  NCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL+L T++S +  +TVRQS +   LLE+++G Q +NP+I+DLPLI A+Q VV 
Sbjct  77   NCVRLTWPLYLATDESFSDIMTVRQSLRKFRLLEAVSGFQTHNPTILDLPLIKAFQEVVS  136

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF-NGTSNVV  601
             L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF N +SNVV
Sbjct  137  CLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANVSSNVV  196

Query  602  GMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GM LRNELRGPKQN+ DWY YM++GAEAVH+ NPD+LVI SGL++  DLSFL
Sbjct  197  GMCLRNELRGPKQNIKDWYTYMRKGAEAVHSMNPDVLVIVSGLNYATDLSFL  248



>gb|EMT10461.1| Endoglucanase E1 [Aegilops tauschii]
Length=498

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 181/233 (78%), Gaps = 12/233 (5%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  238
            H AP   V   LST SRW+V+E+G RVKLACVNW +HLE ++AEGL K+PV  I+  +  
Sbjct  28   HHAPAAAVT--LSTASRWVVDEAGDRVKLACVNWPSHLEPMLAEGLGKRPVGAIAGDVAA  85

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++          AV
Sbjct  86   MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPAV----------AV  135

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  136  VSSLGENNVMVILDNHVSKPGWCCDNTDGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  195

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGP+QN NDWY+YMQ+GAEAVHAANP +LVI SGLSFD DL+FL
Sbjct  196  VGMSLRNELRGPRQNSNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFL  248



>ref|XP_010514258.1| PREDICTED: uncharacterized protein LOC104790245 [Camelina sativa]
Length=562

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 190/235 (81%), Gaps = 7/235 (3%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNE----SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDM  241
            T  A PLST+SRWIV++     GRRVK+ CVNW +HLE  VAEGLSKQP+D I++KIV M
Sbjct  20   TTFALPLSTDSRWIVDDDGSNKGRRVKVTCVNWPSHLETAVAEGLSKQPLDSIAEKIVSM  79

Query  242  GFNCVRLTWPLFLFTNDSLASLT-VRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            GFNCVRLTWPL+L T++S + +T VRQS   L L ++++G Q +NP+I+DLPLI A+Q V
Sbjct  80   GFNCVRLTWPLYLATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEV  139

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTS  592
            V  L K++VM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +S
Sbjct  140  VSCLGKHRVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSS  199

Query  593  NVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NVVGMSLRNELRGPKQN+ DWY YM++GAEAVH+ NPD+LVI SGL++  DLSFL
Sbjct  200  NVVGMSLRNELRGPKQNIKDWYTYMRKGAEAVHSVNPDVLVIVSGLNYATDLSFL  254



>ref|XP_002284895.1| PREDICTED: uncharacterized protein LOC100253729 [Vitis vinifera]
Length=512

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 183/227 (81%), Gaps = 5/227 (2%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVA PL TNSRWIV+E G RVKLACVNW +H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  26   VVALPLYTNSRWIVDEDGARVKLACVNWPSHQEAAVAEGLSNHPVDLISKRIASLGFNCV  85

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLT PLFL T+ SLASLTV QSF+ LGLLES+AG QANNPS++DLPL +AYQAVV +LA 
Sbjct  86   RLTLPLFLATDQSLASLTVIQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLAD  145

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILD+H S+P     S+  NG FGD +F+P LWV GLT++ATMF+G  NVVGMSLR
Sbjct  146  NNMMVILDSHFSEP-----SFHDNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGMSLR  200

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELR P QNV DWYRYMQ+GAEAVH+ANPD+LVI SGLS   DLSFL
Sbjct  201  NELRCPNQNVKDWYRYMQKGAEAVHSANPDVLVIISGLSDGTDLSFL  247



>ref|XP_002284881.1| PREDICTED: uncharacterized protein LOC100264047 [Vitis vinifera]
Length=509

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 182/227 (80%), Gaps = 5/227 (2%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVA PL T SRWIV+E G RVKLACVNW +H E  VAEGLS  PVD+ISK+I  +GFNCV
Sbjct  23   VVALPLHTTSRWIVDEDGARVKLACVNWPSHREAPVAEGLSNHPVDLISKRIASLGFNCV  82

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RL  PLFL T+ SLASLTVRQSF+ LGLLES+AG QANNPS++DLPL +AYQAVV ++A 
Sbjct  83   RLALPLFLATDQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNIAD  142

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +MIILD+H SKP     S+  N  FGD YF+P LWV GLT++AT+F+G  NVVGMSLR
Sbjct  143  NNMMIILDSHFSKP-----SFHSNDIFGDQYFNPDLWVKGLTRMATVFSGVPNVVGMSLR  197

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELR PKQNV DWYRYMQ+GAEAVH+ANPD+LVI SGLS   DLSFL
Sbjct  198  NELRCPKQNVKDWYRYMQKGAEAVHSANPDVLVIISGLSDGTDLSFL  244



>ref|NP_001047320.1| Os02g0596200 [Oryza sativa Japonica Group]
 dbj|BAD16839.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAD21617.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF09234.1| Os02g0596200 [Oryza sativa Japonica Group]
Length=449

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 180/234 (77%), Gaps = 2/234 (1%)
 Frame = +2

Query  62   LAPPTVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            L    V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+ 
Sbjct  17   LHAAAVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVA  76

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             +GFNCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++A
Sbjct  77   SLGFNCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRA  136

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV SL +  VM+ILDNH+S+PGWCC+  DGNGFFGD +FDP  WV GL  +A +F G  N
Sbjct  137  VVDSLGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPN  196

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGP+QN +DWYRYMQ GAEAVHAANP  LVI  GL +D DLSFL
Sbjct  197  VVGMSLRNELRGPRQNADDWYRYMQMGAEAVHAANPAALVIMGGLGYDTDLSFL  250



>gb|AIZ06017.1| hypothetical protein [Zea nicaraguensis]
Length=555

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A PLST SRWIV   GRRVKLAC NW +HLE   AEGL+++PV  I+ ++  MGFNCVRL
Sbjct  26   ALPLSTASRWIVGVDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRL  85

Query  263  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            TWP +L TN +LASL +R S + LG+LES+AG++ NNP+++DLPLI  ++ VV SLA+  
Sbjct  86   TWPTYLVTNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKG  145

Query  443  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  622
            +M+ILDN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T  VVGMSLRNE
Sbjct  146  IMVILDNQMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGMSLRNE  205

Query  623  LRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRGPKQNV+ WYRYMQ GAEAVHAANP++L+I SGL FD  LSFL
Sbjct  206  LRGPKQNVSLWYRYMQLGAEAVHAANPNVLIILSGLDFDNTLSFL  250



>gb|EEE61202.1| hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
Length=571

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = +2

Query  107  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  286
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  287  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  466
            N S +SLTV QSF+ L L ES+A ++ NNPS+VDL LI A++AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSSLGENGVMVILDNH  155

Query  467  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  646
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  156  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  215

Query  647  NDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             DWY+YMQ+GAEAVHAANP ++VI SG+SFD DL+FL
Sbjct  216  ADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFL  252



>ref|XP_010502521.1| PREDICTED: uncharacterized protein LOC104779823 [Camelina sativa]
Length=558

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 187/231 (81%), Gaps = 6/231 (3%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE---SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            A PLST+SRWIV++    GRRVKL CVNW +HLE  VAEGLSKQP+D I++ IV MGFNC
Sbjct  23   ALPLSTDSRWIVDDGINKGRRVKLTCVNWPSHLETAVAEGLSKQPLDSIAEMIVSMGFNC  82

Query  254  VRLTWPLFLFTNDSLASLT-VRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            VRLTWPL+L T++S + +T VRQS   L L ++++G Q +NP+I+DLPLI A+Q VV  L
Sbjct  83   VRLTWPLYLATDESFSDITTVRQSLLKLRLFQAVSGFQVHNPTILDLPLIKAFQEVVSCL  142

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF--NGTSNVVG  604
             K+KVM+ILDNHIS+PGWCCS  DGNGFFGD + +P++W+ GL K+A+MF  N +SNVVG
Sbjct  143  GKHKVMVILDNHISQPGWCCSDNDGNGFFGDKHLNPQVWIKGLKKMASMFANNVSSNVVG  202

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNELRGPKQN  DWY YM++GAEAVH+ NP++LVI SGL++  DLSFL
Sbjct  203  MSLRNELRGPKQNTKDWYTYMRKGAEAVHSVNPNVLVIVSGLNYATDLSFL  253



>gb|EEC77495.1| hypothetical protein OsI_16343 [Oryza sativa Indica Group]
Length=571

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = +2

Query  107  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  286
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  287  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  466
            N S +SLTV QSF+ L L ES+A ++ NNPS+VDL LI A++AVV +L +  VM+ILD+H
Sbjct  96   NASYSSLTVAQSFQRLNLTESLAAIRVNNPSLVDLKLIDAFKAVVSTLGENGVMVILDDH  155

Query  467  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  646
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  156  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  215

Query  647  NDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             DWY+YMQ+GAEAVHAANP ++VI SG+SFD DL+FL
Sbjct  216  ADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFL  252



>ref|XP_002446674.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
 gb|EES11002.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
Length=556

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRL  262
            A PLST SRWIV   GRRVKLAC  W +HLE   AEGL+++ V  I+ ++  MGFNCVRL
Sbjct  27   ALPLSTASRWIVGADGRRVKLACATWASHLEPAAAEGLARRGVSDIAARVAAMGFNCVRL  86

Query  263  TWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            TWP +L TN +LASL +R S + LG+LES+AG++ NNP+++DLPL+  ++ VV SLA   
Sbjct  87   TWPTYLATNVTLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLVDVFREVVSSLASKG  146

Query  443  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  622
            +M+ILDN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T NVVGMSLRNE
Sbjct  147  IMVILDNQMTTPGWCCSRIDGNGFFGDVYFDPDEWLKGLSAMATMFNNTKNVVGMSLRNE  206

Query  623  LRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRGPKQNV+ WYRYMQ GAEAVHAANP++LVI SGL FD  LSFL
Sbjct  207  LRGPKQNVSLWYRYMQMGAEAVHAANPNVLVILSGLDFDNTLSFL  251



>gb|EAZ23667.1| hypothetical protein OsJ_07369 [Oryza sativa Japonica Group]
Length=583

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 179/230 (78%), Gaps = 2/230 (1%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNES--GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
             V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+  +GF
Sbjct  21   AVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVASLGF  80

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++AVV S
Sbjct  81   NCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRAVVDS  140

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L +  VM+ILDNH+S+PGWCC+  DGNGFFGD +FDP  WV GL  +A +F G  NVVGM
Sbjct  141  LGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFDPDAWVRGLGAMAALFAGVPNVVGM  200

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNELRGP+QN +DWYRYMQ GAEAVHAANP  LVI  GL +D DLSFL
Sbjct  201  SLRNELRGPRQNADDWYRYMQMGAEAVHAANPAALVIMGGLGYDTDLSFL  250



>ref|NP_001132121.1| hypothetical protein precursor [Zea mays]
 gb|ACF80825.1| unknown [Zea mays]
 gb|AFW58604.1| hypothetical protein ZEAMMB73_652830 [Zea mays]
Length=555

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 175/220 (80%), Gaps = 0/220 (0%)
 Frame = +2

Query  98   TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  277
            T SRWIV   GRRVKLAC NW +HLE   AEGL+++PV  I+ ++  MGFNCVRLTWP +
Sbjct  31   TASRWIVGVDGRRVKLACANWASHLEPAAAEGLARRPVSDIAARVAAMGFNCVRLTWPTY  90

Query  278  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  457
            L TN +LASL +R S + LG+LES+AG++ NNP+++DLPLI  ++ VV SLA+  +M+IL
Sbjct  91   LVTNATLASLPLRWSLERLGMLESVAGVRVNNPALLDLPLIDVFREVVSSLARKGIMVIL  150

Query  458  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  637
            DN ++ PGWCCS  DGNGFFGD+YFDP  W+ GL+ +ATMFN T  VVGMSLRNELRGPK
Sbjct  151  DNQMTTPGWCCSRTDGNGFFGDVYFDPNEWLKGLSAMATMFNNTKYVVGMSLRNELRGPK  210

Query  638  QNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            QNV+ WYRYMQ GAEAVHAANP++LVI SGL FD  LSFL
Sbjct  211  QNVSLWYRYMQLGAEAVHAANPNVLVILSGLDFDNTLSFL  250



>gb|EAY86525.1| hypothetical protein OsI_07905 [Oryza sativa Indica Group]
Length=582

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 178/230 (77%), Gaps = 2/230 (1%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNE--SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
             V A  LST+SRWIV++   GRRVKLACVNW +HLE VV EGL  QPVD ISKK+  +GF
Sbjct  21   AVEAVTLSTSSRWIVDDEAGGRRVKLACVNWPSHLEPVVTEGLGMQPVDAISKKVASLGF  80

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NCVRLT+P+ L TN SL+SLTVR+S    GL  ++AG++ANNP ++DL LI +++AVV S
Sbjct  81   NCVRLTYPIALATNASLSSLTVRRSLLAHGLAGAVAGVEANNPGLLDLTLIESFRAVVDS  140

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L +  VM+ILDNH+S+PGWCC+  DGNGFFGD +F P  WV GL  +A +F G  NVVGM
Sbjct  141  LGESGVMVILDNHVSRPGWCCADDDGNGFFGDRHFVPDAWVRGLGAMAALFAGVPNVVGM  200

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNELRGP+QN +DWYRYMQ GAEAVHAANP  LVI  GL +D DLSFL
Sbjct  201  SLRNELRGPRQNADDWYRYMQMGAEAVHAANPAALVIMGGLGYDTDLSFL  250



>ref|XP_003579979.1| PREDICTED: uncharacterized protein LOC100845861 [Brachypodium 
distachyon]
Length=558

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 0/228 (0%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            ++ A PLST SRW+V   GRRVKLAC +W +HLE V AEGLS++ V  I+ ++  MGFNC
Sbjct  27   SLPALPLSTASRWVVGADGRRVKLACASWASHLEPVAAEGLSRRDVGGIAARVAAMGFNC  86

Query  254  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            VRLTWP +L TN +L+SL +R S + LGL ES+AG++ NNP ++DLPLI  ++ VV +LA
Sbjct  87   VRLTWPTYLATNTTLSSLPLRWSLERLGLRESVAGVRVNNPDLLDLPLIDVFREVVSALA  146

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
               +M+ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +ATMF  T NVVGMSL
Sbjct  147  SSNIMVILDNQMTTPGWCCSRSDGNGFFGDKYFDPEEWLKGLSAMATMFRYTKNVVGMSL  206

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNELRGP QNV+ WYRYMQQGAEAVHAANP++LVI SGL FD  LSFL
Sbjct  207  RNELRGPYQNVSLWYRYMQQGAEAVHAANPNVLVILSGLDFDNTLSFL  254



>gb|AFW62836.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=396

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 176/234 (75%), Gaps = 1/234 (0%)
 Frame = +2

Query  56   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++ NNPS +DL LI + +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKA  138

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  139  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  198

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGP+QN  DWY YMQ+GAEAVHAA+P  LVI  GLS+D DLSFL
Sbjct  199  VVGMSLRNELRGPRQNPQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFL  252



>ref|XP_006400290.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
 gb|ESQ41743.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
Length=528

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 176/224 (79%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRWIVNESG RVKLAC NW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNESGHRVKLACANWPSHLQPVVAEGLSSQPMDSISKKIREMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV++PLI A+QAVV SL +  V
Sbjct  88   PLELMINDTLAYNVTVKQSFERYGLDHELQGIHNHNPSIVNIPLINAFQAVVHSLGRNDV  147

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  FDP LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNGDPDAFFGDPKFDPDLWMLGLKKMATIFMNVNNVVGMSLRNEL  207

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY YMQ+GAEAVH +NP++LVI SGL FD DL+FL
Sbjct  208  RGHNHTAKDWYTYMQKGAEAVHTSNPNVLVILSGLEFDADLTFL  251



>dbj|BAK00694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 172/223 (77%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRW+V   GRRVKL C NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTW
Sbjct  33   PLSTASRWVVGADGRRVKLVCANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTW  92

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            P +L TN +L+SL +R S + LGL ES AG++ NNP ++DLPLI  ++ VV +LA   +M
Sbjct  93   PTYLATNSTLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFREVVSALASNSIM  152

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +ATMF    NVVGMSLRNELR
Sbjct  153  VILDNQMTTPGWCCSRTDGNGFFGDKYFDPEEWLKGLSAMATMFRHAKNVVGMSLRNELR  212

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP QNV+ WYRYMQQGAEAVHAANP++LVI SGL FD  LSFL
Sbjct  213  GPYQNVSLWYRYMQQGAEAVHAANPNVLVILSGLDFDNSLSFL  255



>ref|XP_008678767.1| PREDICTED: uncharacterized protein LOC100501654 isoform X1 [Zea 
mays]
Length=564

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 176/234 (75%), Gaps = 1/234 (0%)
 Frame = +2

Query  56   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++ NNPS +DL LI + +A
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEVNNPSFLDLTLIESLKA  138

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  139  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  198

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGP+QN  DWY YMQ+GAEAVHAA+P  LVI  GLS+D DLSFL
Sbjct  199  VVGMSLRNELRGPRQNPQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFL  252



>ref|XP_002871770.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48029.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   303 bits (776),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PL T SRWIVN+ G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLFTKSRWIVNKKGHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV++PLI A+QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNIPLINAFQAVVYSLGRHDV  147

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNNDPDAFFGDPKFNPDLWMLGLKKMATIFMNVNNVVGMSLRNEL  207

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY+YMQ+GAEAVH +NP++LVI SGL+FD DLSFL
Sbjct  208  RGYNHTAKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDADLSFL  251



>ref|XP_006289374.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
 gb|EOA22272.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
Length=527

 Score =   303 bits (776),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRWIVN  G+RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLSTKSRWIVNNKGQRVKLACTNWPSHLKPVVAEGLSSQPIDYISKKIKDMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+ A+NPSIV++PLI  +QAVV SL ++ +
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYAHNPSIVNIPLINVFQAVVYSLGRHDL  147

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FF D  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFNDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNEL  207

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY+YMQ+GAEAVH +NP++LVI SGLSFD DLSFL
Sbjct  208  RGYNHTAKDWYKYMQKGAEAVHTSNPNVLVILSGLSFDADLSFL  251



>ref|XP_002452393.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
 gb|EES05369.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
Length=570

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 175/233 (75%), Gaps = 2/233 (1%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVD  238
            H  P   V   LST+SRWIV+ +G RVKLACVNW +HL+ VV EGL +QPV  I+  IV 
Sbjct  23   HGEPAAAVT--LSTSSRWIVDPAGHRVKLACVNWPSHLDPVVTEGLGRQPVGAITGMIVS  80

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLT+P+ L TN SL++LTVRQS    GL E++ G++ NNPS +DL LI + +AV
Sbjct  81   MGFNCVRLTYPIALATNASLSALTVRQSLLAHGLSETVGGVEVNNPSFLDLTLIDSLKAV  140

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V +L +  VM+ILDNHIS PGWCCS+ DGNGFFGD  FDP +WV GL  +AT F    NV
Sbjct  141  VNALGEKNVMVILDNHISTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATTFADVPNV  200

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGP+QN  DWY YMQ+GAEAVHAANP  LVI  GLS+D DLSFL
Sbjct  201  VGMSLRNELRGPRQNSEDWYTYMQRGAEAVHAANPRALVIMGGLSYDYDLSFL  253



>ref|XP_008793758.1| PREDICTED: uncharacterized protein LOC103709981 [Phoenix dactylifera]
Length=549

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = +2

Query  107  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  286
            RWIV+ +GRRVKLACVNW  HLE   AEGL KQP+D IS+++V +GFNCVRLTWPL+L T
Sbjct  36   RWIVDGNGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISRRVVALGFNCVRLTWPLYLLT  95

Query  287  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  466
            N SL SL +R S   LGLLES A +  NNP+++DLPL+ A+QAVV +LA   +M+ILDN 
Sbjct  96   NASLGSLPLRASLAGLGLLESAAAVAVNNPALLDLPLLQAFQAVVSNLASNNIMVILDNQ  155

Query  467  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  646
            ISKPGWCCS +D NGFFGD YFDP  W+ GLT +ATMFN ++NVVGMSLRNELRGPKQN+
Sbjct  156  ISKPGWCCSKFDENGFFGDKYFDPDEWLRGLTMMATMFNSSANVVGMSLRNELRGPKQNI  215

Query  647  NDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            + WYRYMQ GAEAVHAANPDLL+I SGL +DKDLSFL
Sbjct  216  SLWYRYMQIGAEAVHAANPDLLIILSGLDYDKDLSFL  252



>ref|XP_010492706.1| PREDICTED: uncharacterized protein LOC104770057 [Camelina sativa]
Length=528

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 176/224 (79%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PL T SRWIVN+ G RVKLAC NW +HLE VVAEGLS QP+D I+KKI DMGFNCVRLTW
Sbjct  28   PLYTKSRWIVNKKGHRVKLACTNWPSHLEPVVAEGLSSQPMDCITKKIKDMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSI+++PLI  +QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDV  147

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNEL  207

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY+YMQ+GAEAVH +NP++LVI SGL+FD DLSFL
Sbjct  208  RGYNHTSKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDVDLSFL  251



>ref|XP_010248706.1| PREDICTED: uncharacterized protein LOC104591538 isoform X2 [Nelumbo 
nucifera]
Length=538

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 184/227 (81%), Gaps = 5/227 (2%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V+A PL TNSRWIV+  G RVKLACVNW  HLE +V +GLS++ +D+ISK+I+ +GFNCV
Sbjct  27   VMALPLYTNSRWIVDGDGHRVKLACVNWGAHLEAMVPDGLSRRSLDMISKEIISLGFNCV  86

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            +LTWP F+  ++SLAS+TVRQSFKNLGLLESI G+Q NNPS++DLPL++AYQAVV +LA+
Sbjct  87   QLTWPQFMVNDESLASVTVRQSFKNLGLLESIVGIQVNNPSLLDLPLVSAYQAVVDNLAE  146

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILDN ISKPGW  S+++     GD YFD  LW+ GLT+ AT+FN T NVVGMSL 
Sbjct  147  KNLMVILDNRISKPGWHHSNFN-----GDKYFDTDLWIRGLTRTATIFNHTINVVGMSLS  201

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NE  G KQNVN+WYRYMQ+GAEAVHAA+P++LVI   L++D+D +F 
Sbjct  202  NEFEGNKQNVNNWYRYMQKGAEAVHAASPNVLVILYELNYDEDFAFF  248



>ref|XP_010248705.1| PREDICTED: uncharacterized protein LOC104591538 isoform X1 [Nelumbo 
nucifera]
Length=540

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 184/227 (81%), Gaps = 5/227 (2%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            V+A PL TNSRWIV+  G RVKLACVNW  HLE +V +GLS++ +D+ISK+I+ +GFNCV
Sbjct  27   VMALPLYTNSRWIVDGDGHRVKLACVNWGAHLEAMVPDGLSRRSLDMISKEIISLGFNCV  86

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            +LTWP F+  ++SLAS+TVRQSFKNLGLLESI G+Q NNPS++DLPL++AYQAVV +LA+
Sbjct  87   QLTWPQFMVNDESLASVTVRQSFKNLGLLESIVGIQVNNPSLLDLPLVSAYQAVVDNLAE  146

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              +M+ILDN ISKPGW  S+++     GD YFD  LW+ GLT+ AT+FN T NVVGMSL 
Sbjct  147  KNLMVILDNRISKPGWHHSNFN-----GDKYFDTDLWIRGLTRTATIFNHTINVVGMSLS  201

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NE  G KQNVN+WYRYMQ+GAEAVHAA+P++LVI   L++D+D +F 
Sbjct  202  NEFEGNKQNVNNWYRYMQKGAEAVHAASPNVLVILYELNYDEDFAFF  248



>ref|XP_010420476.1| PREDICTED: uncharacterized protein LOC104706046 [Camelina sativa]
Length=527

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 176/224 (79%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PL T SRWIVN+ G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  28   PLYTKSRWIVNKKGHRVKLACTNWPSHLKPVVAEGLSSQPMDFISKKIKDMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSI+++PLI  +QAVV SL ++ V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIINIPLINVFQAVVHSLGRHDV  147

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NVVGMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFLNVNNVVGMSLRNEL  207

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY+YMQ+GAEAVH +NP++LVI SGL+FD DLSFL
Sbjct  208  RGYNHTAKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDVDLSFL  251



>ref|XP_004955049.1| PREDICTED: uncharacterized protein LOC101776534 [Setaria italica]
Length=556

 Score =   301 bits (770),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 172/227 (76%), Gaps = 0/227 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              A  LST+SRWIV+++G RVKLACVNW +HLE VV EGL +QPV  I+  +V +GFNCV
Sbjct  25   AAALTLSTSSRWIVDQAGHRVKLACVNWPSHLEPVVTEGLGRQPVGAIAGMVVSLGFNCV  84

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAK  436
            RLT+P+ L TN SL+SLTVRQS    GL E+  G++ NNP  +DL L+ + +AVV +L +
Sbjct  85   RLTYPIALATNASLSSLTVRQSLLAHGLAETAGGVEVNNPGFLDLTLMESLKAVVNTLGE  144

Query  437  YKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLR  616
              VM+ILDNH+SKPGWCC   DGNGFFGD  FDP +WV GL  +AT+F    +V+GMSLR
Sbjct  145  KDVMVILDNHVSKPGWCCGDDDGNGFFGDRDFDPDVWVDGLASMATIFADVPSVIGMSLR  204

Query  617  NELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NELRGP+QN  DWY YMQ+GAEAVHAANP  LVI  GLS+D DLSFL
Sbjct  205  NELRGPRQNTEDWYTYMQRGAEAVHAANPRALVIMGGLSYDYDLSFL  251



>ref|XP_010492589.1| PREDICTED: uncharacterized protein LOC104769956 isoform X2 [Camelina 
sativa]
Length=487

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F G +NVVGMSL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKGATNVVGMSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M +GAEAVHAANP LLVI SG+ FD +LSFL
Sbjct  201  RNEPRGTRDYPDLWFRHMPEGAEAVHAANPKLLVILSGIDFDTNLSFL  248



>ref|XP_010549752.1| PREDICTED: uncharacterized protein LOC104820833 [Tarenaya hassleriana]
Length=531

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 177/229 (77%), Gaps = 1/229 (0%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            +V +  LST SRWIV+E G RVKLAC NW +HL+ VVAEGL KQP+D IS++I  MGFNC
Sbjct  25   SVFSDGLSTRSRWIVDERGHRVKLACANWPSHLQPVVAEGLHKQPMDSISERIRFMGFNC  84

Query  254  VRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSL  430
            VR TWPL L TND+LA  +TV QSF+   L + + G++ +NPSI+ LPL  A++AVV S+
Sbjct  85   VRFTWPLELMTNDTLAFHVTVTQSFQRYRLFQELDGIRRHNPSILHLPLFNAFEAVVSSM  144

Query  431  AKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMS  610
             +Y VM+ILDNH + PGWCC ++D + FFGD  FDP LW++GL K+A  F    NV+GMS
Sbjct  145  GRYGVMVILDNHKTVPGWCCGNHDPDAFFGDPEFDPNLWILGLKKMAASFRNVKNVIGMS  204

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRNELRGPK+  + WY+YMQQGAEAVHA+NP++LVI SG++FD DLSFL
Sbjct  205  LRNELRGPKEYPHVWYKYMQQGAEAVHASNPNVLVILSGINFDTDLSFL  253



>ref|XP_009107523.1| PREDICTED: uncharacterized protein LOC103833179 [Brassica rapa]
Length=527

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 175/224 (78%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI  +QAVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLINVFQAVVYSLGRNDV  147

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GMSLRNEL
Sbjct  148  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNEL  207

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY YMQ+GAEAVH +NP++LVI SGL FD DL+FL
Sbjct  208  RGYNHTAKDWYTYMQRGAEAVHGSNPNVLVILSGLDFDADLTFL  251



>ref|XP_010453833.1| PREDICTED: uncharacterized protein LOC104735704 [Camelina sativa]
Length=486

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 176/228 (77%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  20   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  79

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  80   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVRGIQTHNPKILNLPLLNAFQEVVSNLG  139

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVGMSL
Sbjct  140  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGMSL  199

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M QGAEAVHAANP LLVI SG+ FD +LSFL
Sbjct  200  RNEPRGTRDYPDLWFRHMPQGAEAVHAANPKLLVILSGIDFDTNLSFL  247



>ref|XP_010492588.1| PREDICTED: uncharacterized protein LOC104769956 isoform X1 [Camelina 
sativa]
Length=523

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F G +NVVGMSL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKGATNVVGMSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M +GAEAVHAANP LLVI SG+ FD +LSFL
Sbjct  201  RNEPRGTRDYPDLWFRHMPEGAEAVHAANPKLLVILSGIDFDTNLSFL  248



>ref|XP_004975980.1| PREDICTED: uncharacterized protein LOC101758857 [Setaria italica]
Length=557

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 169/220 (77%), Gaps = 0/220 (0%)
 Frame = +2

Query  98   TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  277
            T SRW+V   GRRVKLAC NW +HLE   AEGLS++ V+ I+ ++  MGFNCVRLTWP +
Sbjct  33   TASRWLVGADGRRVKLACANWASHLEPAAAEGLSRRGVEGIAGRVAAMGFNCVRLTWPTY  92

Query  278  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  457
            L TN +LASL  R S + LG+ ES+AG++ NNP+++DLPLI  ++ VV +L    +M+IL
Sbjct  93   LATNATLASLPFRWSLERLGMRESVAGVRVNNPALLDLPLIDVFREVVSALGSKSIMVIL  152

Query  458  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  637
            DN ++ PGWCCS  DGNGFFGD YFDP  W+ GL  +AT+FN T NVVGMSLRNELRGP 
Sbjct  153  DNQMTTPGWCCSRTDGNGFFGDKYFDPDEWLKGLNAMATIFNDTKNVVGMSLRNELRGPN  212

Query  638  QNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            QN++ WYRYMQ GAEAVHAANP++LVI SGL FD  LSFL
Sbjct  213  QNISLWYRYMQLGAEAVHAANPNVLVILSGLDFDNTLSFL  252



>ref|XP_004975262.1| PREDICTED: uncharacterized protein LOC101779133 [Setaria italica]
Length=595

 Score =   299 bits (766),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 172/235 (73%), Gaps = 2/235 (1%)
 Frame = +2

Query  59   HLAPPTVVAQP--LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKI  232
            H A     A P  LST+SRW+V+E GRRVKLACVNW +HLE ++AEGL   P+  I+  +
Sbjct  39   HEAAGGAAALPKSLSTSSRWVVDERGRRVKLACVNWASHLEPMLAEGLGHLPLGAIAAGV  98

Query  233  VDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ  412
              MGFNCVRLTWP FL T+ + +SLTV  S + L L  ++AG+ ANNP  + L L  A+ 
Sbjct  99   AAMGFNCVRLTWPTFLVTDAASSSLTVADSLRRLNLTAALAGVGANNPGFLGLSLADAFG  158

Query  413  AVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS  592
            AVV  L    VM+ILDNH+S+PGWCC + DGNGFFGD  FDP +WV GL ++A MF G  
Sbjct  159  AVVRGLGDSGVMVILDNHVSRPGWCCRAGDGNGFFGDADFDPDVWVEGLRRMAAMFAGEE  218

Query  593  NVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            NVVGMSLRNELRGP+QN  DWYRYMQ+GAEAVHAANP +LVI SGL+ D DL+FL
Sbjct  219  NVVGMSLRNELRGPRQNTADWYRYMQRGAEAVHAANPRVLVILSGLNNDNDLAFL  273



>ref|NP_197252.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAC01894.1| putative protein [Arabidopsis thaliana]
 gb|AED92434.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 172/224 (77%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PL T SRWIVN  G RVKLAC NW +HL+ VVAEGLS QP+D ISKKI DMGFNCVRLTW
Sbjct  27   PLFTKSRWIVNNKGHRVKLACANWPSHLKPVVAEGLSSQPMDSISKKIKDMGFNCVRLTW  86

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NP IV+ PLI  +QAVV SL ++ V
Sbjct  87   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPYIVNTPLINVFQAVVYSLGRHDV  146

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F    NVVGMSLRNEL
Sbjct  147  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMNVKNVVGMSLRNEL  206

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY+YMQ+GAEAVH +NP++LVI SGL+FD DLSFL
Sbjct  207  RGYNHTSKDWYKYMQKGAEAVHTSNPNVLVILSGLNFDADLSFL  250



>ref|XP_010437048.1| PREDICTED: uncharacterized protein LOC104720845 isoform X2 [Camelina 
sativa]
 ref|XP_010437061.1| PREDICTED: uncharacterized protein LOC104720858 isoform X2 [Camelina 
sativa]
Length=487

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   ITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+SL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGVSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M +GAEAVHAANP LLVI SG+ FD +LSFL
Sbjct  201  RNEPRGARDYPDLWFRHMPEGAEAVHAANPKLLVILSGIDFDTNLSFL  248



>ref|XP_010437042.1| PREDICTED: uncharacterized protein LOC104720845 isoform X1 [Camelina 
sativa]
 ref|XP_010437060.1| PREDICTED: uncharacterized protein LOC104720858 isoform X1 [Camelina 
sativa]
Length=523

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   ITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+SL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGVSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M +GAEAVHAANP LLVI SG+ FD +LSFL
Sbjct  201  RNEPRGARDYPDLWFRHMPEGAEAVHAANPKLLVILSGIDFDTNLSFL  248



>gb|KHN43979.1| Endoglucanase E1 [Glycine soja]
Length=471

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +2

Query  179  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  358
            +VAEGL ++P+D I+K+I  MGFNCVRLTWP++L TNDSLA+LTVRQSF NLGL ++I+ 
Sbjct  1    MVAEGLGERPLDGIAKEIKSMGFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISA  60

Query  359  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  538
            +Q NNPS++DLPLI AYQ VV  L    +M+ILDNH+SKP WCCS+ DGNGFFGD YFDP
Sbjct  61   VQVNNPSLIDLPLIKAYQDVVKGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDP  120

Query  539  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVI  718
             LW+ GLTK+AT+F G +NVV MSLRNELRGP+QN NDW++YM +GAEAVH ANPD+LVI
Sbjct  121  DLWIKGLTKMATLFKGVTNVVAMSLRNELRGPRQNANDWFKYMPKGAEAVHGANPDVLVI  180

Query  719  FSGLSFDKDLSFL  757
             SGL++D DLSFL
Sbjct  181  MSGLNYDLDLSFL  193



>ref|XP_006652422.1| PREDICTED: uncharacterized protein LOC102702088, partial [Oryza 
brachyantha]
Length=529

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 169/224 (75%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST SRW+V  + GRRVKLAC NW +HLE   AEGLS++ V  I+ ++  MGFNCVRLT
Sbjct  2    PLSTASRWVVGGADGRRVKLACANWASHLEPAAAEGLSRRGVGDIAARVAAMGFNCVRLT  61

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            WP +L TN +LA+L +R S + LG+ ES AG++ NNP ++DLPLI  ++ VV +L +  +
Sbjct  62   WPTYLATNATLANLPLRWSLELLGMRESAAGVRVNNPQLLDLPLIDVFKEVVSALGRNNI  121

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDN ++ PGWCCS  DGNGFFGD YFDP  W+ GL+ +ATMF  T NVVGMSLRNEL
Sbjct  122  MVILDNQMTTPGWCCSQRDGNGFFGDTYFDPDEWLSGLSTMATMFRNTKNVVGMSLRNEL  181

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG KQNV  W+RYMQQGAE VHAANP +LVI SGL FD  L FL
Sbjct  182  RGDKQNVTLWFRYMQQGAEVVHAANPGVLVILSGLEFDNTLDFL  225



>ref|XP_010904544.1| PREDICTED: uncharacterized protein LOC105031943 [Elaeis guineensis]
Length=554

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 175/217 (81%), Gaps = 0/217 (0%)
 Frame = +2

Query  107  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  286
            RWIV+ +GRRVKLACVNW  HLE   AEGL KQP+D IS  +V +GFNCVRLTWPL+L T
Sbjct  41   RWIVDGNGRRVKLACVNWAAHLEAAAAEGLGKQPLDTISGGVVALGFNCVRLTWPLYLLT  100

Query  287  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  466
            N SL SL +R S   LGLLES A +  NNP+++DL L+ A+QAVV +LA   +M+ILDN 
Sbjct  101  NVSLGSLPLRASLAGLGLLESAAAVAVNNPALLDLSLLQAFQAVVSNLASNNIMVILDNQ  160

Query  467  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  646
            ISK GWCCS +D NGFFGD YFDP  W+ GLT +ATMFN T+NVVGMSLRNELRGPKQN+
Sbjct  161  ISKAGWCCSKFDDNGFFGDKYFDPDEWLQGLTMMATMFNSTTNVVGMSLRNELRGPKQNI  220

Query  647  NDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            + WYRYMQ+GAEAVHAANP+LL+I SGL +DKDLSFL
Sbjct  221  SLWYRYMQRGAEAVHAANPNLLIILSGLDYDKDLSFL  257



>gb|EAY94563.1| hypothetical protein OsI_16341 [Oryza sativa Indica Group]
Length=552

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 169/220 (77%), Gaps = 0/220 (0%)
 Frame = +2

Query  98   TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  277
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLT P +
Sbjct  31   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTCPTY  90

Query  278  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  457
            L TN +LASL +R S +  G+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  91   LATNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  150

Query  458  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  637
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGMSLRNELRGP 
Sbjct  151  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPY  210

Query  638  QNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             NV+ WYRYM++GAEAVH ANPD+LVI SGL FD  L+F+
Sbjct  211  ANVSLWYRYMKEGAEAVHTANPDVLVILSGLEFDNTLNFV  250



>gb|KHN06535.1| Endoglucanase [Glycine soja]
Length=474

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = +2

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLTWP+ L TNDSLASLTVR SF+NL LLESIAG+Q NNPSI+DLPLI A+QAV
Sbjct  1    MGFNCVRLTWPIVLVTNDSLASLTVRSSFQNLALLESIAGVQTNNPSIIDLPLIQAFQAV  60

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL    VM+ILDNHI++PGWCCS+ DGNGFFGD +FDP  W++GLTK+A++FNG +NV
Sbjct  61   VKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKFFDPNQWILGLTKMASLFNGVTNV  120

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGPKQNVNDWY+YM +GAEA+HAANPD+LVI SGL+FDKDLSF+
Sbjct  121  VGMSLRNELRGPKQNVNDWYKYMVKGAEAIHAANPDVLVILSGLNFDKDLSFI  173



>gb|EMT27118.1| hypothetical protein F775_19072 [Aegilops tauschii]
Length=571

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 175/239 (73%), Gaps = 11/239 (5%)
 Frame = +2

Query  74   TVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            ++ A PLST SRW+V+  GRRVKL C N  +HLE V AEGLS++ V  I+ ++  MGFNC
Sbjct  27   SLPALPLSTASRWLVDADGRRVKLVCANGASHLEPVAAEGLSRRGVGDIAARVAAMGFNC  86

Query  254  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAY--------  409
            VRLTWP +L TN +L+SL +R S + LGL ES AG++ NNP ++DLPLI  +        
Sbjct  87   VRLTWPTYLATNATLSSLPLRWSLERLGLRESAAGVRVNNPDLLDLPLIDVFRVSSWVWG  146

Query  410  ---QAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMF  580
               + VV +LA   +M+ILDN ++ PGWCCS  DGNGFFGD YFDP+ W+ GL+ +A +F
Sbjct  147  SPEEEVVSALASNSIMVILDNQMTTPGWCCSRTDGNGFFGDKYFDPEEWLRGLSAMAAVF  206

Query  581  NGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
              T NVVGMSLRNELRGP QNV+ WYRYMQQGAEAVHAANP++LVI SGL FD  LSFL
Sbjct  207  RDTKNVVGMSLRNELRGPYQNVSLWYRYMQQGAEAVHAANPNVLVILSGLDFDNSLSFL  265



>emb|CDX94333.1| BnaC01g18510D [Brassica napus]
Length=335

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 173/224 (77%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG +   + W+R+M +GAEAVHAANP++LVI SG+ FD +LSFL
Sbjct  205  RGTRDYPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFL  248



>ref|XP_010420372.1| PREDICTED: uncharacterized protein LOC104705962 [Camelina sativa]
Length=484

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 174/228 (76%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQ +D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQTLDSISKKIVSMGFNCV  80

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TN++LA  +TV+QSF++  L E + G+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNNTLALKVTVKQSFESFKLFEDVRGIQTHNPKIINLPLLNAFQEVVSNLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCC   D + FFG   FDPK+W  GL+K+AT+F   +NVVG+SL
Sbjct  141  QNGVMVILDNHLTTPGWCCGENDLDAFFGYPNFDPKVWANGLSKMATLFKSATNVVGVSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M QGAEAVHAANP LLVI SG+ FD +LSFL
Sbjct  201  RNEPRGTRDYPDLWFRHMPQGAEAVHAANPKLLVILSGIDFDTNLSFL  248



>ref|NP_001053105.1| Os04g0480900 [Oryza sativa Japonica Group]
 emb|CAD41088.2| OSJNBb0011N17.5 [Oryza sativa Japonica Group]
 dbj|BAF15019.1| Os04g0480900 [Oryza sativa Japonica Group]
 dbj|BAG98948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61201.1| hypothetical protein OsJ_15210 [Oryza sativa Japonica Group]
Length=554

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 170/223 (76%), Gaps = 1/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRW+V   GRRVKLAC NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGMSLRNELR
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELR  208

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            G K NV+ W+RYMQ GAE VHAANP +LVI SGL+FD  L FL
Sbjct  209  GSK-NVSLWFRYMQLGAEVVHAANPGVLVILSGLNFDNTLDFL  250



>ref|NP_197172.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 emb|CAC01834.1| putative protein [Arabidopsis thaliana]
 gb|AED92327.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=488

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 173/228 (76%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCV
Sbjct  21   TTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCV  80

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TND+LA  +TV+QSF++L L E + G+Q +NP ++ LPL  A+Q VV +L 
Sbjct  81   RLTWPLDLVTNDTLALKVTVKQSFESLKLFEDVLGIQTHNPKLLHLPLFNAFQEVVSNLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  VM+ILDNH++ PGWCC   D + FFG  +FDP +W  GL K+AT+F   ++V+GMSL
Sbjct  141  ENGVMVILDNHLTTPGWCCGDNDLDAFFGYPHFDPLVWAKGLRKMATLFRNFTHVIGMSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M QGAEAVHAANP LLVI SG+ FD +LSFL
Sbjct  201  RNEPRGARDYPDLWFRHMPQGAEAVHAANPKLLVILSGIDFDTNLSFL  248



>emb|CDY38435.1| BnaA10g17230D [Brassica napus]
Length=524

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 173/224 (77%), Gaps = 4/224 (2%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI    AVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLI---NAVVYSLGRNDV  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GMSLRNEL
Sbjct  145  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNEL  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY YMQ+GAEAVH +NP++LVI SGL FD DL+FL
Sbjct  205  RGYNHTAKDWYTYMQRGAEAVHGSNPNVLVILSGLDFDADLTFL  248



>gb|KCW59700.1| hypothetical protein EUGRSUZ_H02458, partial [Eucalyptus grandis]
Length=516

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 8/228 (4%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
            VVAQ L  +SRWIV+  GRRVKLACVNW  HL+ ++AEGLSK P D I++KI +MGFNCV
Sbjct  27   VVAQQLYADSRWIVDGDGRRVKLACVNWPAHLQPLLAEGLSKLPADTIARKIREMGFNCV  86

Query  257  RLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQ-AVVGSLA  433
            RLTW L L  N++LASLTV QSF+NLGL ES+AG+++NNPS+++LPL+ AY+   +   A
Sbjct  87   RLTWALELPMNETLASLTVTQSFQNLGLFESLAGIKSNNPSLINLPLMEAYKDKRIAQFA  146

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
             Y   I   N +   G      DGNGFFGD YFDP++W+ GL K+ATM  G SNV+GMSL
Sbjct  147  SYGYEIF--NMMRDDG-----EDGNGFFGDKYFDPQVWMQGLHKMATMATGFSNVIGMSL  199

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNELRGP+QNV+DWY+YMQQGAE+VHAANPD+LVI SGL +DK LSF+
Sbjct  200  RNELRGPRQNVDDWYKYMQQGAESVHAANPDVLVILSGLHYDKVLSFI  247



>emb|CDY16914.1| BnaC09g40410D [Brassica napus]
Length=524

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 173/224 (77%), Gaps = 4/224 (2%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRWIVN+SG RVKLACVNW +HL+ VVAEGLS QP+D ISKKI +MGFNCVRLTW
Sbjct  28   PLSTKSRWIVNKSGHRVKLACVNWPSHLKPVVAEGLSSQPMDSISKKIKEMGFNCVRLTW  87

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L  ND+LA ++TV+QSF+  GL   + G+  +NPSIV+ PLI    AVV SL +  V
Sbjct  88   PLELMINDTLAFNVTVKQSFERYGLDHELQGIYTHNPSIVNTPLI---NAVVYSLGRNDV  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH + PGWCCS+ D + FFGD  F+P LW++GL K+AT+F   +NV+GMSLRNEL
Sbjct  145  MVILDNHKTVPGWCCSNDDPDAFFGDPKFNPDLWMLGLKKMATIFMDVNNVIGMSLRNEL  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG      DWY YMQ+GAEAVH +NP++LVI SGL FD DL+FL
Sbjct  205  RGYNHTAKDWYTYMQRGAEAVHGSNPNVLVILSGLDFDADLTFL  248



>emb|CDX69429.1| BnaA10g17780D [Brassica napus]
Length=524

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGL+KQP+D ISKKIV MGF
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGF  78

Query  248  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL L TND+LA ++TV+QSF+ L LL+ + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVG  198

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNE RG +   N W++YM +G EAVHAANP++LVI SG+ +D +LSFL
Sbjct  199  MSLRNEPRGTRDYPNLWFKYMPKGGEAVHAANPEVLVILSGIDYDTNLSFL  249



>gb|EEC77494.1| hypothetical protein OsI_16340 [Oryza sativa Indica Group]
Length=554

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 170/223 (76%), Gaps = 1/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRW+V   GRRVKLAC NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWLVGADGRRVKLACANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGMSLRNELR
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELR  208

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            G K NV+ W+RYMQ GAE VHAANP +LVI SGL+FD  L FL
Sbjct  209  GSK-NVSLWFRYMQLGAEVVHAANPGVLVILSGLNFDNTLDFL  250



>emb|CAH67676.1| H0510A06.1 [Oryza sativa Indica Group]
 emb|CAH66881.1| OSIGBa0158F13.12 [Oryza sativa Indica Group]
Length=553

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 170/220 (77%), Gaps = 2/220 (1%)
 Frame = +2

Query  98   TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  277
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTWP +
Sbjct  34   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTY  93

Query  278  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  457
            L TN +LASL +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  94   LATNATLASLPLRWSLERLGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  153

Query  458  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  637
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGMSLRNELRGP 
Sbjct  154  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPY  213

Query  638  QNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            +NV+ W  YM++GAE+VH ANPD+LVI SGL FD  L+F+
Sbjct  214  ENVSLW--YMKEGAESVHTANPDVLVILSGLEFDNTLNFV  251



>ref|XP_009121461.1| PREDICTED: uncharacterized protein LOC103846308 [Brassica rapa]
Length=489

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 175/231 (76%), Gaps = 1/231 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P    + PLST SRWIV+E G+RVKLACVNW  HL+  VAEG+SKQP+D ISKKIV MGF
Sbjct  19   PKLTTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGVSKQPLDSISKKIVSMGF  78

Query  248  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL L TND+LA ++TV+QSF+ L L + + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLFDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPAVWAKGLSKMASLFRNVTNVVG  198

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNE RG +   N W++YM +G EAVHAANP++LVI SG+ +D +LSFL
Sbjct  199  MSLRNEPRGTRDYPNLWFKYMPKGGEAVHAANPEVLVILSGIDYDTNLSFL  249



>emb|CAH66880.1| OSIGBa0158F13.11 [Oryza sativa Indica Group]
Length=554

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 169/223 (76%), Gaps = 1/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRW+V   GRRVKL C NW +HLE V AEGLS++ +  I+ ++  MG NCVRLTW
Sbjct  29   PLSTASRWVVGADGRRVKLTCANWASHLEPVAAEGLSRRGLGDIAARVAAMGLNCVRLTW  88

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            P +L TN +LA+L +R S + LG+ ES+AG++ NNP ++DLPLI  +Q VV +LAK  +M
Sbjct  89   PTYLATNATLANLPLRASLERLGMPESVAGVRVNNPGLLDLPLIDVFQEVVSALAKNNIM  148

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDN ++ PGWCCS  DGNGFFGD YF P+ W+ GL+ +ATMF  T NVVGMSLRNELR
Sbjct  149  VILDNQMTTPGWCCSENDGNGFFGDKYFGPEEWLKGLSAMATMFRNTKNVVGMSLRNELR  208

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            G K NV+ W+RYMQ GAE VHAANP +LVI SGL+FD  L FL
Sbjct  209  GSK-NVSLWFRYMQLGAEVVHAANPGVLVILSGLNFDNTLDFL  250



>ref|XP_009126336.1| PREDICTED: uncharacterized protein LOC103851244 [Brassica rapa]
Length=246

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLALKITVKQSFESLKLFDDALGIQTHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSYNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKD  745
            RG +   + W+R+M +GAEAVHAANP++LVI SG+ FD +
Sbjct  205  RGTRDYPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTN  244



>ref|XP_006400209.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
 gb|ESQ41662.1| hypothetical protein EUTSA_v10015466mg [Eutrema salsugineum]
Length=488

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 174/231 (75%), Gaps = 1/231 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P    + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGF
Sbjct  19   PKLTTSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGF  78

Query  248  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL L TND+LA ++TV+QSF+ L L E + G+Q +NP I++L +  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLAHNVTVKQSFEGLKLFEDVLGIQTHNPKILNLSIFRAFQEVVS  138

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +L +  VM+ILDNH++ PGWCCS  D + FFG   FDP +W  GL+K+A +F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFGYPNFDPLVWAKGLSKMAFLFRNATNVVG  198

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNE RG +   + W+R+M +GAEAVHAANP LLVI SG+ +D +LSFL
Sbjct  199  MSLRNEPRGTRDYPDLWFRFMPKGAEAVHAANPKLLVILSGIDYDTNLSFL  249



>gb|KFK25904.1| hypothetical protein AALP_AA8G177600 [Arabis alpina]
Length=523

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 173/228 (76%), Gaps = 1/228 (0%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCV  256
              + PLST SRWI++E G+RVKLACVNW  HL   VAEGLSKQP+D ISKKIV M FNCV
Sbjct  21   TTSYPLSTKSRWILDEKGQRVKLACVNWPAHLLPAVAEGLSKQPLDSISKKIVSMRFNCV  80

Query  257  RLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            RLTWPL L TND+LA ++TV+QSF++L L E +AG+Q +NP I++LPL+ A+Q VV +L 
Sbjct  81   RLTWPLDLMTNDTLALNVTVKQSFESLKLFEDVAGIQTHNPKILNLPLLNAFQEVVSNLG  140

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSL  613
            +  +M+ILDNH++ PGWCCS  D + FFG   FDP  W  GL K+AT+F   +NVVGMSL
Sbjct  141  QNGLMVILDNHLTTPGWCCSDNDLDAFFGYPNFDPAEWATGLKKMATLFRNATNVVGMSL  200

Query  614  RNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RNE RG +   + W+R+M QGAEAVHA NP LLVI SG+ +D +LSFL
Sbjct  201  RNEPRGTRDYPDLWFRFMPQGAEAVHAGNPKLLVIVSGIDYDTNLSFL  248



>ref|XP_009121460.1| PREDICTED: uncharacterized protein LOC103846306 [Brassica rapa]
Length=524

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 177/231 (77%), Gaps = 1/231 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGL+KQP+D ISKKIV MGF
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLNKQPLDSISKKIVSMGF  78

Query  248  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL L TND+LA ++TV+QSF+ L LL+ + G+Q +NP I++LP+  A+Q VV 
Sbjct  79   NCVRLTWPLDLMTNDTLARNVTVKQSFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVS  138

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVG
Sbjct  139  NLGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPVIWTKGLSKMASLFRNVTNVVG  198

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNE RG +   N W++YM +G EAVHAA+P++LVI SG+ +D +LSFL
Sbjct  199  MSLRNEPRGTRDYPNLWFKYMPKGGEAVHAASPEVLVILSGIDYDTNLSFL  249



>emb|CAD41089.2| OSJNBb0011N17.6 [Oryza sativa Japonica Group]
 gb|EAZ31113.1| hypothetical protein OsJ_15211 [Oryza sativa Japonica Group]
Length=550

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 169/220 (77%), Gaps = 2/220 (1%)
 Frame = +2

Query  98   TNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  277
            T SRW+V   GRRVKLAC NW +HLE V AEGLS++ V  I+ ++  MGFNCVRLTWP +
Sbjct  31   TASRWVVGADGRRVKLACANWASHLEPVAAEGLSRRGVGDIAARVAAMGFNCVRLTWPTY  90

Query  278  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  457
            L TN +LASL +R S +  G+ ES+AG++ NNP ++DLPLI  +Q VV +LA+  +M+IL
Sbjct  91   LATNATLASLPLRWSLERFGMRESVAGVRVNNPGLLDLPLIDVFQEVVSALARNNIMVIL  150

Query  458  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  637
            DN ++ PGWCCS+ DGNGFFGD YFDP+ W+ GL  +ATMF  T NVVGMSLRNELRGP 
Sbjct  151  DNQMTTPGWCCSTTDGNGFFGDKYFDPEEWLNGLKTMATMFRKTKNVVGMSLRNELRGPY  210

Query  638  QNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            +NV+ W  YM++GAE+VH ANPD+LVI SGL FD  L+F+
Sbjct  211  ENVSLW--YMKEGAESVHTANPDVLVILSGLEFDNTLNFV  248



>ref|XP_002871731.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47990.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   286 bits (733),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 170/223 (76%), Gaps = 1/223 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            LST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTWP
Sbjct  26   LSTKSRWIVDEKGQRVKLACVNWPAHLQPTVAEGLSKQPLDSISKKIVSMGFNCVRLTWP  85

Query  272  LFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            L L TND+LA ++TV+QSF++L L E + G+Q +NP I+ LPL  A+Q VV +L +  VM
Sbjct  86   LDLMTNDTLALNVTVKQSFESLKLFEDVLGIQTHNPKILHLPLFNAFQEVVSNLGQNGVM  145

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDNH++ PGWCC   D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE R
Sbjct  146  VILDNHLTTPGWCCGENDLDAFFGYPKFDPTVWAKGLGKMATLFRNFTNVIGMSLRNEPR  205

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            G +   + W+R+M QGAE VHAANP LLVI SG+ FD +LSFL
Sbjct  206  GARDYPDLWFRHMPQGAEVVHAANPKLLVILSGIDFDTNLSFL  248



>ref|XP_009142284.1| PREDICTED: uncharacterized protein LOC103866155 [Brassica rapa]
Length=487

 Score =   286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 173/224 (77%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG +   + W+R+M +GAEAVHAANP++LVI SG+ FD +LSFL
Sbjct  205  RGTRDYPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFL  248



>ref|XP_009142293.1| PREDICTED: uncharacterized protein LOC103866164 [Brassica rapa]
Length=487

 Score =   286 bits (731),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 173/224 (77%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG +   + W+R+M +GAEAVHAANP++LVI SG+ FD +LSFL
Sbjct  205  RGTRDYPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFL  248



>ref|XP_009126137.1| PREDICTED: uncharacterized protein LOC103851062 [Brassica rapa]
Length=487

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 172/224 (77%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTN+RWIV+E G+R KLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTNTRWIVDEKGQRAKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I +LP+  A+Q VV +L +  +
Sbjct  85   PLDLTTNDTLALKITVKQSFESLNLFDDALGIQTHNPKIFNLPIFNAFQEVVSNLGQNGL  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG +   + W+R+M +GAEAVHAANP++LVI SG+ FD +LSFL
Sbjct  205  RGTRDYPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFL  248



>emb|CDY38091.1| BnaC02g06820D [Brassica napus]
Length=523

 Score =   286 bits (733),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 175/231 (76%), Gaps = 1/231 (0%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P    + PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISK IV MGF
Sbjct  18   PTPSTSFPLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKNIVSMGF  77

Query  248  NCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            NCVRLTWPL L TND+LA  +TV+QSF++L L + + G+Q +NP I++LP+  A+Q VV 
Sbjct  78   NCVRLTWPLDLMTNDTLALKITVKQSFESLNLFDDVLGIQTHNPKILNLPIFNAFQEVVS  137

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +L +  +M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+G
Sbjct  138  NLGQNGLMVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIG  197

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            MSLRNE RG +   + W+R+M +GAEAVHAANP++LVI SG+ FD +LSFL
Sbjct  198  MSLRNEPRGTRDYPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFL  248



>emb|CAH67677.1| H0510A06.2 [Oryza sativa Indica Group]
 emb|CAH66882.1| OSIGBa0158F13.13 [Oryza sativa Indica Group]
Length=555

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 163/217 (75%), Gaps = 16/217 (7%)
 Frame = +2

Query  107  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  286
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +V MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVVAMGFNCVRLTWATFMVT  95

Query  287  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  466
            N S +SLTV QSF+ L L ES+A                A +AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLA----------------AIRAVVSSLGENGVMVILDNH  139

Query  467  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  646
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  140  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  199

Query  647  NDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             DWY+YMQ+GAEAVHAANP ++VI SG+SFD DL+FL
Sbjct  200  ADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFL  236



>emb|CDX89335.1| BnaA01g15580D [Brassica napus]
Length=523

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 173/224 (77%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST +RWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKIV MGFNCVRLTW
Sbjct  25   PLSTKTRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKIVSMGFNCVRLTW  84

Query  269  PLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            PL L TND+LA  +TV+QSF++L L +   G+Q +NP I++LP+  A+Q VV +L +  +
Sbjct  85   PLDLMTNDTLARKITVKQSFESLNLFDDALGIQIHNPKILNLPIFNAFQEVVSNLGQNGL  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH++ PGWCCS  D + FFG   FDP +W  GL K+AT+F   +NV+GMSLRNE 
Sbjct  145  MVILDNHLTYPGWCCSDNDLDAFFGYPNFDPVIWAKGLGKMATLFRNVTNVIGMSLRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG +   + W+R+M +GAEAVHAANP++LVI SG+ FD +LSFL
Sbjct  205  RGTRDYPDLWFRFMPKGAEAVHAANPEVLVILSGIDFDTNLSFL  248



>gb|ACU18247.1| unknown [Glycine max]
Length=195

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  170  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  349
            LE VVAEGLSK+PVDVIS  I  MGFNCVRLTWP+ L TNDSLASLTVR SF+NL LLES
Sbjct  21   LEAVVAEGLSKKPVDVISNGIKSMGFNCVRLTWPIVLVTNDSLASLTVRSSFQNLALLES  80

Query  350  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  529
            IAG+Q NNPSI+DLPLI A+QAVV SL    VM+ILDNHI++PGWCCS+ DGNGFFGD +
Sbjct  81   IAGVQTNNPSIIDLPLIQAFQAVVKSLGDNDVMVILDNHITQPGWCCSNSDGNGFFGDKF  140

Query  530  FDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYM  667
            FDP  W++GLTK+A++FNG +NVVGMSLRNELRGPKQNVNDWY+YM
Sbjct  141  FDPNQWILGLTKMASLFNGVTNVVGMSLRNELRGPKQNVNDWYKYM  186



>gb|KHN19917.1| hypothetical protein glysoja_032397 [Glycine soja]
Length=464

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = +2

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLTWPLFL TNDS+ASLT+R SF+NLGL++S+ G+QA NPSI+DLPLI AYQAV
Sbjct  1    MGFNCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQAV  60

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL +  VM+ILDNH+S+PGWCCS+ DGNGFFGD YFDP LW++GLTK+AT+F G +NV
Sbjct  61   VKSLGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNV  120

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            V MSLRNELRGP+QNVN WYRYM +GAEAVHAANPD+LVI SGL+FD +LSF+
Sbjct  121  VAMSLRNELRGPRQNVNVWYRYMPKGAEAVHAANPDVLVILSGLNFDTNLSFI  173



>gb|EYU23408.1| hypothetical protein MIMGU_mgv1a020519mg [Erythranthe guttata]
Length=538

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 165/224 (74%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTNSRWIV++ +G+RVKL C NWV+HL+ +VAEGL K+P+  I+KKI + GFNCVR T
Sbjct  28   PLSTNSRWIVDQATGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKISETGFNCVRFT  87

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            WP F+FT     +LTV +S     L  + +G+  NNP  +++ +   ++AVV  L K KV
Sbjct  88   WPTFMFTRPDYYNLTVSESLDKFKLTAAKSGIAKNNPGFLNMKVAEVHKAVVNELGKNKV  147

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNHIS+PGWCC+  DGNGFFGD  FDP  W+ GLT VAT + G S V+GMS+RNEL
Sbjct  148  MVVLDNHISQPGWCCADNDGNGFFGDALFDPTEWLKGLTAVATAYKGNSAVIGMSMRNEL  207

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG +QNVNDWY+YMQ GAEA+H  NPD LVI SGL  D  L+FL
Sbjct  208  RGGRQNVNDWYKYMQAGAEAIHKENPDFLVIVSGLYTDTSLNFL  251



>emb|CAD41090.2| OSJNBb0011N17.7 [Oryza sativa Japonica Group]
Length=555

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 162/217 (75%), Gaps = 16/217 (7%)
 Frame = +2

Query  107  RWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFT  286
            RWIV+E G RVKLACVNW +HLE ++AEGL KQPV  I+K +  MGFNCVRLTW  F+ T
Sbjct  36   RWIVDEGGNRVKLACVNWPSHLEPMLAEGLGKQPVGAIAKDVDAMGFNCVRLTWATFMVT  95

Query  287  NDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNH  466
            N S +SLTV QSF+ L L ES+A                A +AVV SL +  VM+ILDNH
Sbjct  96   NASYSSLTVAQSFQRLNLTESLA----------------AIRAVVSSLGENGVMVILDNH  139

Query  467  ISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNV  646
            +SKPGWCC + DGNGFFGD YFDP +WV GLTK+ATMF    +VV MSLRNELRGP+QN 
Sbjct  140  VSKPGWCCGNNDGNGFFGDAYFDPDVWVDGLTKMATMFAAVPSVVAMSLRNELRGPRQNS  199

Query  647  NDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             DWY+YMQ+GAEAVHAANP ++VI SG+SFD DL+FL
Sbjct  200  ADWYKYMQRGAEAVHAANPRVVVILSGMSFDNDLAFL  236



>gb|EYU23411.1| hypothetical protein MIMGU_mgv1a004205mg [Erythranthe guttata]
Length=539

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 163/224 (73%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTNSRWI++ E+G+RVKL C NWV+HL+ +VAEGL K+P+  I+KK+ + GFNCVR T
Sbjct  26   PLSTNSRWIIDQETGKRVKLTCANWVSHLQPMVAEGLEKKPLSYIAKKVPETGFNCVRFT  85

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            WP F+FT     +LTV +S     L  + +G+  NNP  + + +   + AVV  L K KV
Sbjct  86   WPTFMFTRPDYYNLTVSESLDKYNLTAAKSGIAENNPGFLSMKVAEVHMAVVNELGKNKV  145

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+S+PGWCC   DGNGFFGD  FDP  W+ GLT VA  + G S VVGMS+RNEL
Sbjct  146  MVVLDNHVSQPGWCCGDNDGNGFFGDANFDPAEWLQGLTAVARAYKGNSAVVGMSMRNEL  205

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP+QN +DWY+YMQQGA+A+H  NPD LVI SGL +D +L FL
Sbjct  206  RGPRQNTDDWYKYMQQGAKAIHKENPDFLVIVSGLYYDTNLGFL  249



>gb|AFW62835.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=380

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 165/234 (71%), Gaps = 17/234 (7%)
 Frame = +2

Query  56   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++A                
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEA----------------  122

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  123  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  182

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGP+QN  DWY YMQ+GAEAVHAA+P  LVI  GLS+D DLSFL
Sbjct  183  VVGMSLRNELRGPRQNPQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFL  236



>gb|EPS62091.1| hypothetical protein M569_12701, partial [Genlisea aurea]
Length=514

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 156/223 (70%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST+SRWIV+ +GRRVKL CVNW++H E +VAEGL K+P+  I+K I   GFNCVR TW
Sbjct  17   PLSTSSRWIVDRAGRRVKLTCVNWISHNEPMVAEGLEKKPLAYIAKAIASAGFNCVRFTW  76

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
            P F+FT      LTV QS    GL  + AG+  NNP ++ + ++  + AVV  L +  +M
Sbjct  77   PTFMFTRPDYGKLTVGQSLDRYGLTAAKAGISKNNPQLMGMSVVEVHGAVVDELGRSGLM  136

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            ++LDNH+S P WCC S DGNGFFGD  FDP  W+ GLT VA  +     VVGMSLRNELR
Sbjct  137  VVLDNHVSHPQWCCGSDDGNGFFGDYNFDPDEWIRGLTAVARAYKSRPGVVGMSLRNELR  196

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GPKQN  DWYRYM  GA AVH+ NPD LVI SGL+FD +L FL
Sbjct  197  GPKQNEADWYRYMAAGAAAVHSENPDFLVIISGLNFDTNLGFL  239



>ref|XP_011080895.1| PREDICTED: uncharacterized protein LOC105164045 [Sesamum indicum]
Length=535

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 166/226 (73%), Gaps = 1/226 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            ++ LSTNSRWIV++ SG+RVKLACVNWV+HL+ ++ EGL K+PV  I+++IV  GFNCVR
Sbjct  23   SRTLSTNSRWIVDQASGKRVKLACVNWVSHLQPMIVEGLEKKPVSCIARQIVATGFNCVR  82

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
             TW  F+FT    + LTV +S    GL ++ AG+  NNP  +++ ++  ++AVV  L K 
Sbjct  83   FTWATFMFTRTDYSKLTVSESLDKYGLKDAKAGIMKNNPQFLNMNVVEVHKAVVNELGKN  142

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
            KVM++LDNH+S+P WCCS  DGNGFFGD  FDP  W+ GL  VA  + G S V+GMSLRN
Sbjct  143  KVMVVLDNHVSQPKWCCSGADGNGFFGDAEFDPTEWLQGLAAVAGTYKGNSVVIGMSLRN  202

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRG +QN  DWY+YMQ+GA+ VH  NPD LVI SGLS+D +L FL
Sbjct  203  ELRGDRQNEADWYKYMQEGAKTVHQENPDCLVIVSGLSYDTNLGFL  248



>ref|XP_008678768.1| PREDICTED: uncharacterized protein LOC100501654 isoform X2 [Zea 
mays]
 gb|AFW62834.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=548

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 165/234 (71%), Gaps = 17/234 (7%)
 Frame = +2

Query  56   SHLAPPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            SH  P   V   LST+SRWIV+ +G RVKLACVNW +HLE VV EGL +QPV  IS  IV
Sbjct  20   SHRQPAAAVVT-LSTSSRWIVDPAGHRVKLACVNWPSHLESVVTEGLGRQPVGAISGMIV  78

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             MGFNCVRLT+P+ L TN SL+ LTVRQS    GL E++ G++A                
Sbjct  79   SMGFNCVRLTYPIALVTNASLSVLTVRQSLLANGLAETVGGVEA----------------  122

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV +L +  VM+ILDNH+S PGWCCS+ DGNGFFGD  FDP +WV GL  +AT+F    N
Sbjct  123  VVNALGEKNVMVILDNHVSTPGWCCSNDDGNGFFGDRDFDPNVWVDGLGSMATIFADVPN  182

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGP+QN  DWY YMQ+GAEAVHAA+P  LVI  GLS+D DLSFL
Sbjct  183  VVGMSLRNELRGPRQNPQDWYTYMQRGAEAVHAASPRALVIMGGLSYDYDLSFL  236



>ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera]
Length=530

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 165/224 (74%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWIV+ E+G RVKL C+NWV H E +V EGL  QP+  I+ K+  MGFNC+RLT
Sbjct  23   PLSTRGRWIVDSETGHRVKLTCLNWVAHTETMVTEGLHTQPIKDIAAKVTSMGFNCIRLT  82

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +  F++T    ++ TV QS  +  L ++  G+  NNP +++L L  AY+AVV  L    +
Sbjct  83   YATFMWTRSDYSNKTVAQSLDSFNLTQAREGIARNNPQLLNLSLQEAYEAVVDELGANGL  142

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+  DGNGFFGD++FDPK W+ GLT+VA  F G   VV MS+RNE+
Sbjct  143  MLVLDNHVSKPMWCCAREDGNGFFGDMFFDPKEWIEGLTQVAKRFKGKPQVVAMSMRNEI  202

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP+QN+ DWY+ M++GA+A+H+ NPD+LV+ SGL+FDKDLSFL
Sbjct  203  RGPRQNLPDWYKNMREGAKAIHSTNPDVLVLVSGLNFDKDLSFL  246



>ref|XP_010658499.1| PREDICTED: uncharacterized protein LOC100267356 isoform X2 [Vitis 
vinifera]
Length=502

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 166/224 (74%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  64   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  123

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  124  YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  183

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +S+RNE+
Sbjct  184  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEM  243

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG + NV DWYRYM++GA+A+H ANP +LVI SGL+FDKDLSFL
Sbjct  244  RGARSNVPDWYRYMRKGAKAIHKANPKVLVIVSGLNFDKDLSFL  287



>gb|ABR17494.1| unknown [Picea sitchensis]
Length=543

 Score =   275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 165/223 (74%), Gaps = 1/223 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESG-RRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            L+  SRWIV+E+G  RVKLACVNWV+HL+ +V EGLS+QP+  I+  IV  GFNCVRLTW
Sbjct  26   LAVKSRWIVDETGGTRVKLACVNWVSHLQPMVTEGLSRQPLKYITSTIVSQGFNCVRLTW  85

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
              F+ TN +  +LTV+ S  +L L ++ A +  +NP  +DL L+ +Y+ VV  L +  +M
Sbjct  86   ATFMVTNPANRNLTVQDSLNSLNLSDAAAAMAVSNPEFLDLTLMDSYKRVVAGLGEAGLM  145

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDNHIS+P WCC   DGNGFFGD  FDP +W+ GL+ +AT F GT+ VVGMSLRNELR
Sbjct  146  VILDNHISRPQWCCGYNDGNGFFGDADFDPGVWIQGLSAMATAFKGTAAVVGMSLRNELR  205

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            G + N  DWY+YMQQGA+AVH ANPD+LVI SGL++  DL FL
Sbjct  206  GSRANAADWYKYMQQGAQAVHDANPDVLVIMSGLNYAADLKFL  248



>ref|XP_002272454.2| PREDICTED: uncharacterized protein LOC100267356 isoform X1 [Vitis 
vinifera]
Length=575

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 166/224 (74%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  64   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  123

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  124  YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  183

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +S+RNE+
Sbjct  184  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEM  243

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG + NV DWYRYM++GA+A+H ANP +LVI SGL+FDKDLSFL
Sbjct  244  RGARSNVPDWYRYMRKGAKAIHKANPKVLVIVSGLNFDKDLSFL  287



>gb|EMS46776.1| hypothetical protein TRIUR3_23304 [Triticum urartu]
Length=290

 Score =   264 bits (675),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 145/173 (84%), Gaps = 2/173 (1%)
 Frame = +2

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVRLTWP FL TN S +SLTV QSF+ L L ES+AG++ANNP++VDL LI A++A 
Sbjct  1    MGFNCVRLTWPTFLVTNASYSSLTVEQSFQRLNLTESLAGIRANNPTVVDLKLIDAFKA-  59

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
              SL +  VM+ILDNH+SKPGWCC + DGNGFFGD YF+P +WV GLTK+ATMF G  +V
Sbjct  60   -SSLGENNVMVILDNHVSKPGWCCDNADGNGFFGDGYFEPDVWVDGLTKMATMFAGVPHV  118

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGP+QN NDWY+YMQ+GAEAVHAANP +LVI SGLSFD DL+FL
Sbjct  119  VGMSLRNELRGPRQNSNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFL  171



>ref|XP_002272491.1| PREDICTED: uncharacterized protein LOC100262188 [Vitis vinifera]
Length=541

 Score =   271 bits (694),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 164/224 (73%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWIV++ +GRRVKL CVNW++H E ++ EGL  QP+  I+ KI +MGFNCVRLT
Sbjct  30   PLSTKGRWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLT  89

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +P FL+T     + TV +S  +L   E+ A +   NP  + LPL  +Y+ VVG L +  +
Sbjct  90   YPTFLWTRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGL  149

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH+SKP WCC   DGNGFFGD +FDP+ W+ GL++VA  F   S+V+GMS+RNEL
Sbjct  150  MLILDNHVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGMSMRNEL  209

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG + N  DWY+YM++GA+A+H+ NP+LLV+ SGL+FD DLSFL
Sbjct  210  RGQRSNQKDWYKYMREGAKAIHSINPNLLVVVSGLNFDNDLSFL  253



>ref|XP_009381699.1| PREDICTED: uncharacterized protein LOC103969775 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 0/193 (0%)
 Frame = +2

Query  179  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  358
            ++AEGLSKQP+  I+  I  MGFNCVRLT+P FL T++SLASLTVRQSF+  GL  +I  
Sbjct  1    MLAEGLSKQPLASITWNIHLMGFNCVRLTYPTFLLTDESLASLTVRQSFERAGLDATIPL  60

Query  359  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  538
            +  +NP+ VDL L+ AY+AVV  L    +M+ILDNHISKPGWCCS+ DGNGFFGD YFDP
Sbjct  61   IALHNPTFVDLNLLQAYKAVVAKLGATNIMVILDNHISKPGWCCSNSDGNGFFGDTYFDP  120

Query  539  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVI  718
             +W  GL K+ATMF GT NVVGMSLRNELRG +QNV+DW+ YMQ+GAEAVH AN D+LV+
Sbjct  121  NVWYQGLIKMATMFKGTPNVVGMSLRNELRGRRQNVDDWFTYMQKGAEAVHGANQDVLVV  180

Query  719  FSGLSFDKDLSFL  757
             SGLSFD DLSFL
Sbjct  181  LSGLSFDNDLSFL  193



>gb|ACF85134.1| unknown [Zea mays]
Length=492

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +2

Query  239  MGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAV  418
            MGFNCVR TWP FL T+ S + LTV QSF+ L L ES+AG++ NNP +VDL LI A++AV
Sbjct  1    MGFNCVRFTWPTFLVTDASYSDLTVAQSFQRLNLTESLAGIRVNNPGVVDLKLIDAFKAV  60

Query  419  VGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNV  598
            V SL ++ +M+ILDNH+SKPGWCCS+ DG+GFFGD YFDP +WV GLTK+ATMF G  NV
Sbjct  61   VSSLGEHNLMVILDNHLSKPGWCCSNTDGSGFFGDTYFDPDVWVDGLTKMATMFAGVPNV  120

Query  599  VGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VGMSLRNELRGP+QNVNDWY+YMQ+GAEAVHAANP +LVI SGLSFD DL+FL
Sbjct  121  VGMSLRNELRGPRQNVNDWYKYMQRGAEAVHAANPRVLVILSGLSFDNDLAFL  173



>ref|XP_002272534.1| PREDICTED: uncharacterized protein LOC100257079 [Vitis vinifera]
Length=545

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 162/223 (73%), Gaps = 1/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RW+V++ SG+RVKLACVNW++HL+ +V EGL K+P+  I+  I  MGFNCVRLT
Sbjct  26   PLSTRGRWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLT  85

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  ++FT  S  + +V +S   LGL E+  G+  NNP +++L L+ AY+AVV  L ++ V
Sbjct  86   WATYMFTRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGV  145

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+  DGNGFFGD YF PK W+ GLTKVA  F   S VV MS+RNEL
Sbjct  146  MVVLDNHVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAMSMRNEL  205

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSF  754
            RGP Q  + WY+ +++G   +H+ NP+LLVI SGL FD DLSF
Sbjct  206  RGPNQTEHIWYKQIRKGGRTIHSINPNLLVIVSGLEFDTDLSF  248



>emb|CBI34404.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 162/223 (73%), Gaps = 1/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RW+V++ SG+RVKLACVNW++HL+ +V EGL K+P+  I+  I  MGFNCVRLT
Sbjct  42   PLSTRGRWVVDDASGQRVKLACVNWISHLQAMVVEGLHKRPLREIAGGITAMGFNCVRLT  101

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  ++FT  S  + +V +S   LGL E+  G+  NNP +++L L+ AY+AVV  L ++ V
Sbjct  102  WATYMFTRPSYGNRSVAESLGELGLSEAKEGVARNNPELLNLSLVEAYEAVVDELGRHGV  161

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+  DGNGFFGD YF PK W+ GLTKVA  F   S VV MS+RNEL
Sbjct  162  MVVLDNHVSKPKWCCAEDDGNGFFGDKYFHPKEWLQGLTKVAHRFKDKSQVVAMSMRNEL  221

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSF  754
            RGP Q  + WY+ +++G   +H+ NP+LLVI SGL FD DLSF
Sbjct  222  RGPNQTEHIWYKQIRKGGRTIHSINPNLLVIVSGLEFDTDLSF  264



>ref|XP_010053198.1| PREDICTED: uncharacterized protein LOC104441706 [Eucalyptus grandis]
 gb|KCW77462.1| hypothetical protein EUGRSUZ_D01800 [Eucalyptus grandis]
Length=538

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 162/224 (72%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN RWIV+  +GRR+KLACVNW +HLE ++AEGL K+P+ VI  +I  + FNCVRLT
Sbjct  29   PLSTNGRWIVDSATGRRMKLACVNWASHLEPMLAEGLDKKPLGVIVAEIRRLRFNCVRLT  88

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  ++FT        V ++  +LGL E+  G+  NNP ++++  + AY AVV  L K  V
Sbjct  89   WATYMFTQPGHGDQPVEETLDSLGLAEAKGGVARNNPLVLNMTHVEAYAAVVDELGKQGV  148

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+  DGNGFFGD YFDP+ W+ GL  VA  FNG S VVGMS+RNEL
Sbjct  149  MVVLDNHVSKPKWCCAYDDGNGFFGDEYFDPEEWLRGLVAVAEHFNGKSQVVGMSVRNEL  208

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP+QN  DWY+Y++  A  VH ANP++LVI SGL++  DLSFL
Sbjct  209  RGPRQNDYDWYQYIRTAATKVHQANPNVLVILSGLNWASDLSFL  252



>ref|XP_002893942.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70201.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=420

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 170/245 (69%), Gaps = 30/245 (12%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKL-ACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST+SRWIV+E+G+R KL +C    T          +KQPVD ++KKIV+M FNCVRLT
Sbjct  4    PLSTSSRWIVDENGQRAKLMSCGGERTKQ--------AKQPVDAVAKKIVEMSFNCVRLT  55

Query  266  WPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            WP  L TN++LA ++TVRQSF++ GL + I G + NNPSI+DL LI A+  V      ++
Sbjct  56   WPSDLMTNETLAYNVTVRQSFQSFGLNDDIVGFKTNNPSIIDLSLIEAFICVTEVNVTFR  115

Query  443  --------------------VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLT  562
                                VM+ILDNH++KPGWCC+  DGN F GD +FDP +W   L+
Sbjct  116  THNTRDLCLAFFLFCSKSNDVMVILDNHLTKPGWCCADNDGNDFSGDKFFDPTVWAAALS  175

Query  563  KVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDK  742
            K+   F+G SNVVGMSLRNEL GPKQNVNDW++YMQQGAEAVH+AN ++LVI SGL+FD 
Sbjct  176  KMTATFDGVSNVVGMSLRNELTGPKQNVNDWFKYMQQGAEAVHSANKNVLVILSGLTFDT  235

Query  743  DLSFL  757
            DLSF+
Sbjct  236  DLSFV  240



>ref|XP_002272386.2| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera]
Length=536

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 164/224 (73%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWIV+ E+G RVKL C+NW  H++ +V EGL  QP+  I  K+  MGFNC+RLT
Sbjct  29   PLSTRGRWIVDSETGSRVKLTCLNWAAHIDTMVTEGLHTQPIKDIVAKVTLMGFNCIRLT  88

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +  F++T     + TV QS  ++ L ++  G+  NNP +++L L  AY+AVV ++    +
Sbjct  89   YATFMWTRPDYGNKTVAQSLDSMNLTQAREGIARNNPQLLNLSLQDAYEAVVDAIGANGL  148

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+S DGNGFFGD++FDPK W+ GLT+VA+ F G   VV MS+RNEL
Sbjct  149  MLVLDNHVSKPMWCCASEDGNGFFGDMFFDPKEWIEGLTQVASRFKGKPQVVAMSMRNEL  208

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP+QN+ DWY  M +GA+A+H+ NPD+LV+ SGL+FD DLSFL
Sbjct  209  RGPRQNLPDWYTNMTEGAKAIHSTNPDVLVLVSGLNFDLDLSFL  252



>ref|XP_006439449.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
 gb|ESR52689.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
Length=538

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 158/224 (71%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN RWI+N S G+RVKLACVNW  HL+ ++AEGL K+P+  I   +V M FNCVRLT
Sbjct  22   PLSTNKRWIINASTGQRVKLACVNWPAHLQPMLAEGLDKKPLGEIVAAVVKMHFNCVRLT  81

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  F+FT  +   ++V Q+  +L L E+  G+  NNP I+++  I AY+AVVG L    +
Sbjct  82   WSTFMFTRPNYGHISVSQTLDSLDLKEAKQGISKNNPFILNMTHIQAYEAVVGELGAQGI  141

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNHISKP WCCS+ DGNGFFGD YFDP  W+ GL+ VA  F     VV +SLRNEL
Sbjct  142  MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNEL  201

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP+QN  DWY+Y+ +GA  VH  NP +LV  SGL+FD DL FL
Sbjct  202  RGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFL  245



>emb|CBI34405.3| unnamed protein product [Vitis vinifera]
Length=970

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 166/224 (74%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIV-NESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWIV N +G RVK+ACVNWV+HLE +V EG+  QPV+ I++ +  MGFNC+RLT
Sbjct  26   PLSTRGRWIVDNAAGGRVKMACVNWVSHLEPLVTEGIHAQPVERIAETVKAMGFNCIRLT  85

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +  F++T     + TV QS  +  L ++  G+  NNP +++L +I AY+AVV  L  + +
Sbjct  86   YATFMWTRADYNNRTVAQSLDSFNLTQAKEGIARNNPKLLNLQIIDAYEAVVNELGAHGL  145

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++LDNH+SKP WCC+  DGNGFFGD+YFDPK W+ GLT V+T F     VV +S+RNE+
Sbjct  146  MLVLDNHVSKPLWCCAREDGNGFFGDMYFDPKEWIKGLTDVSTRFKNNPQVVALSMRNEM  205

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG + NV DWYRYM++GA+A+H ANP +LVI SGL+FDKDLSFL
Sbjct  206  RGARSNVPDWYRYMRKGAKAIHKANPKVLVIVSGLNFDKDLSFL  249


 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 164/224 (73%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWIV++ +GRRVKL CVNW++H E ++ EGL  QP+  I+ KI +MGFNCVRLT
Sbjct  459  PLSTKGRWIVDDVTGRRVKLKCVNWISHTESMITEGLHSQPIGDIADKISEMGFNCVRLT  518

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +P FL+T     + TV +S  +L   E+ A +   NP  + LPL  +Y+ VVG L +  +
Sbjct  519  YPTFLWTRVDYYNKTVAESLDSLNATEAKAMIAVQNPRFLSLPLRESYERVVGELGRRGL  578

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH+SKP WCC   DGNGFFGD +FDP+ W+ GL++VA  F   S+V+GMS+RNEL
Sbjct  579  MLILDNHVSKPMWCCEREDGNGFFGDKFFDPEEWIEGLSQVANRFKDESHVIGMSMRNEL  638

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG + N  DWY+YM++GA+A+H+ NP+LLV+ SGL+FD DLSFL
Sbjct  639  RGQRSNQKDWYKYMREGAKAIHSINPNLLVVVSGLNFDNDLSFL  682



>emb|CDX83591.1| BnaC07g23310D [Brassica napus]
Length=460

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 145/174 (83%), Gaps = 1/174 (1%)
 Frame = +2

Query  239  MGFNCVRLTWPLFLFTNDSLAS-LTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
            MGFNCVRLTWPL L TN +LA+ +TVR SF++LGL   I+G + NNPS++DLPLI AYQ+
Sbjct  1    MGFNCVRLTWPLDLATNVTLATNVTVRDSFQSLGLNTDISGFETNNPSMIDLPLIEAYQS  60

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV +L KY VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSN
Sbjct  61   VVTTLGKYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGPKQNV+DW++YMQQGAEAVH ANP  LVI SG S+D DLSF+
Sbjct  121  VVGMSLRNELRGPKQNVDDWFKYMQQGAEAVHEANPYALVILSGFSYDTDLSFV  174



>ref|XP_008467257.1| PREDICTED: uncharacterized protein LOC103504654 [Cucumis melo]
Length=539

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 164/224 (73%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN RWI++ + GRRVKL CVNW  H++ ++ EGL ++P+D I+  +  + FNCVRLT
Sbjct  28   PLSTNGRWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRFNCVRLT  87

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPSI++L L+ AY AVV SL  + +
Sbjct  88   YSIHMFTRH--ANLTVKQSFENFDMKDAMAGIAQNNPSILNLTLVEAYGAVVDSLVAHGI  145

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++ DNHIS+P WCC + DGNGFFGD YFDP+ W+ G++  A      + VV MSLRNEL
Sbjct  146  MVVSDNHISQPRWCCDNNDGNGFFGDRYFDPQEWLQGISLAAQSLKSKAQVVAMSLRNEL  205

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP QNV  W++YM QGA+ +H  NP+ LV+ SGLS+D DLSFL
Sbjct  206  RGPNQNVEKWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFL  249



>ref|XP_011080894.1| PREDICTED: uncharacterized protein LOC105164044 [Sesamum indicum]
Length=409

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 164/231 (71%), Gaps = 3/231 (1%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMG  244
            P    + PLST SRWI++E +G RVKL C+NW  HLE ++AEGL+KQP   I++ + +MG
Sbjct  14   PILCCSLPLSTRSRWIIDEATGARVKLICINWAAHLEPMLAEGLNKQPAGRIARLVAEMG  73

Query  245  FNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVG  424
            FNCVRLTW  ++FT    A+LTV QS   LGL++++ G+  NNP  +++ ++ A +AVV 
Sbjct  74   FNCVRLTWATYMFTR--FANLTVAQSLTRLGLVDAMEGIAVNNPGFLNVTVVDAQRAVVE  131

Query  425  SLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVG  604
            +L +  VM++LDNH+S+P WCC  +DGNGFFGD YFD K W+ GL+ VA ++  TS VVG
Sbjct  132  ALVRQGVMVVLDNHVSQPMWCCGEHDGNGFFGDKYFDAKEWLQGLSIVAKLYKDTSMVVG  191

Query  605  MSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            +S+RNELRGP QN + W+ YM+ GA  +  ANP LLVI  GL +D   ++L
Sbjct  192  ISMRNELRGPLQNASVWHGYMESGAMRIQKANPRLLVIIPGLHYDLSFTYL  242



>gb|KGN50395.1| hypothetical protein Csa_5G171770 [Cucumis sativus]
Length=538

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 165/224 (74%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN RWIV+ + G+RVKL CVNW  H++ ++AEGL ++P+D I   +  + FNCVRLT
Sbjct  27   PLSTNGRWIVDATTGQRVKLMCVNWPGHMQGMLAEGLHRRPLDDIISLVAKLRFNCVRLT  86

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPS+V+L L+ AY AVV SLA + V
Sbjct  87   YSIHMFTRH--ANLTVQQSFENFDMKDAMAGIAQNNPSLVNLTLVEAYGAVVDSLAAHGV  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++ DNHIS+P WCC++ DGNGFFGD YFDP+ W+ G++  A      + VV MS+RNE 
Sbjct  145  MVVSDNHISQPRWCCNNDDGNGFFGDRYFDPEEWLQGISLAAQSLKSKAEVVAMSMRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP QNV  W++YM QGA+ +H  NP+ LV+ SGLS+D DLSFL
Sbjct  205  RGPNQNVEKWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFL  248



>gb|KGN50394.1| hypothetical protein Csa_5G171760 [Cucumis sativus]
Length=538

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 165/224 (74%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN RWIV+ + G RVKL CVNW  H++ ++AEGL  +P+D I+  +V   FNCVRLT
Sbjct  27   PLSTNGRWIVDATTGNRVKLMCVNWAGHMQGMLAEGLHLRPLDDIAALVVKSRFNCVRLT  86

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            + + +FT    A+LTV+QSF+N  + +++AG+  NNPSI+++ ++ AY AV+ SLA ++V
Sbjct  87   YSIHMFTRH--ANLTVQQSFENFDMKDALAGIAQNNPSILNMTVVQAYGAVIDSLAAHRV  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++ DNHIS+P WCC++ DGNGFFGD YFDP+ W+ G++  A      S VV MSLRNE 
Sbjct  145  MVVSDNHISQPRWCCNNDDGNGFFGDRYFDPQEWLQGISLAAQNLKSKSQVVAMSLRNEP  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP QNV  W++YM QGA+ +H  NP+ LV+ SGLS+D DLSFL
Sbjct  205  RGPNQNVEMWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFL  248



>emb|CDY13614.1| BnaA06g33090D [Brassica napus]
Length=460

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = +2

Query  239  MGFNCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
            MGFNCVRLTWPL L TN +LA S+TVR SF++LGL   I+G +  NPS++DLPLI AYQ+
Sbjct  1    MGFNCVRLTWPLDLATNVTLATSVTVRDSFQSLGLNTDISGFETKNPSMIDLPLIEAYQS  60

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV +L  Y VM+ILDNH++KPGWCC + DGNGFFGDI+FDP  W+ GLT +AT F  TSN
Sbjct  61   VVTTLGNYNVMVILDNHLTKPGWCCGNDDGNGFFGDIFFDPATWISGLTYMATSFKDTSN  120

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            VVGMSLRNELRGPKQNV+DW++YM QGAEAVH ANP  LVI SG S+D DLSF+
Sbjct  121  VVGMSLRNELRGPKQNVDDWFKYMLQGAEAVHEANPYALVILSGFSYDTDLSFV  174



>gb|EYU23409.1| hypothetical protein MIMGU_mgv1a004243mg [Erythranthe guttata]
Length=538

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 152/223 (68%), Gaps = 1/223 (0%)
 Frame = +2

Query  92   LSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            LST+SRWIVN+ +G RVKL C NW  HL+ +V EGL K+PV  I+ +I  +GFNCVRLTW
Sbjct  30   LSTSSRWIVNQGTGNRVKLTCANWAGHLQAMVPEGLEKKPVSYIASQIAKLGFNCVRLTW  89

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
              F+FT    ++L V  +     L  + +G+  NNP  +++ +I   +AVVG L K  +M
Sbjct  90   ATFMFTRPEYSNLKVSAALDKYNLAAAKSGIGKNNPQFLEMSVIDVQKAVVGELGKNNLM  149

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            ++LDNH+S PGWCC   DGNGFFGD  FD   W+ GLT VA  + G   VV MSLRNELR
Sbjct  150  VVLDNHVSLPGWCCGDDDGNGFFGDANFDTNEWLQGLTAVARSYKGNPAVVAMSLRNELR  209

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            G +QN NDWY+ M  GA+ VH  NPD+L+I SGLS+D DLSFL
Sbjct  210  GNRQNTNDWYKNMAAGAQTVHTQNPDVLIIVSGLSYDSDLSFL  252



>ref|XP_008459280.1| PREDICTED: uncharacterized protein LOC103498458 [Cucumis melo]
Length=719

 Score =   261 bits (666),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 164/230 (71%), Gaps = 3/230 (1%)
 Frame = +2

Query  71   PTVVAQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P   + PLSTN RWI++ + GRRVKL CVNW  H++ ++ EGL ++P+D I+  +  + F
Sbjct  193  PEAYSLPLSTNGRWIIDATTGRRVKLMCVNWAGHMQGMLVEGLHRRPLDDIAALVAKLRF  252

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NCVRLT+ + +FT    A++TV+QSF+N  + +++ G+  NNPSI++L L+ AY AVV S
Sbjct  253  NCVRLTYSIHMFTRH--ANVTVKQSFENFDMKDALVGIAQNNPSILNLTLVEAYGAVVDS  310

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            LA + +M++ DNHIS+P WCC + DGNGFFGD YFDP+ W  G++  A      + VV M
Sbjct  311  LAAHGIMVVSDNHISQPRWCCDNDDGNGFFGDRYFDPQEWFQGISLAAQSLKSKAQVVAM  370

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNE RGP QNV  W++YM QGA+ +H  NP+ LV+ SGLS+D DLSFL
Sbjct  371  SLRNEPRGPNQNVEKWFQYMSQGAKLIHQINPNALVVVSGLSYDTDLSFL  420



>ref|XP_008810943.1| PREDICTED: uncharacterized protein LOC103722247 [Phoenix dactylifera]
Length=554

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 163/229 (71%), Gaps = 2/229 (1%)
 Frame = +2

Query  77   VVAQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNC  253
            V A PLST+ RW+V+  SG+RVKL CVNW  H+  V+AEGL +QP+D I+  I  +GFNC
Sbjct  27   VHALPLSTSGRWVVDSASGQRVKLHCVNWAAHMPAVLAEGLDRQPLDGIAAGIAGLGFNC  86

Query  254  VRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLA  433
            VRLTW   LFT +S  +LTV +S  +LGL ++  G++ NN  +V + +  A+ AVV ++ 
Sbjct  87   VRLTWATHLFTKESYENLTVSESLSSLGLGDAFDGVRRNNGWMVGITVREAFDAVVKAIG  146

Query  434  KYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTS-NVVGMS  610
            +  +M++LDNH+S+P WCC   DGNGFFGD YFDP+ W+ GL  VAT +   +  VVGMS
Sbjct  147  EAGLMVVLDNHVSRPQWCCGDDDGNGFFGDTYFDPEEWLRGLEFVATRYRSDNPQVVGMS  206

Query  611  LRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            +RNELRGP Q+   WYR + +GA+ +H  NPD+L+I SGLS+D DLSFL
Sbjct  207  MRNELRGPNQSEPAWYRNIARGAQKIHGTNPDVLIIASGLSYDTDLSFL  255



>ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus]
Length=535

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 160/224 (71%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN RWIV  + G+RVKL CVNW  H++ +VAEGL  +P+D I+  +V + FNCVRLT
Sbjct  26   PLSTNGRWIVEATTGQRVKLICVNWPGHMQAMVAEGLHLKPLDDIAAMVVKLRFNCVRLT  85

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            + + +FT    A+LTV+QSF+N  L E+I G+  NNP+I+++ ++ AY+AVV SL  + V
Sbjct  86   YSIHMFTR--YANLTVKQSFENFDLKEAIVGIAQNNPTILNMKVVEAYEAVVDSLGAHGV  143

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M++ DNHIS+P WCCS+ DGNGFFGD YF+ + W+ GL+           VV MSLRNE 
Sbjct  144  MVVSDNHISQPRWCCSNDDGNGFFGDRYFNSQEWLQGLSLATQSLKTKPQVVAMSLRNEP  203

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP QNV  W++YM QGA+ VH  NP+ LV+ SGLS+D  LSFL
Sbjct  204  RGPNQNVEMWFQYMSQGAKLVHQINPNALVVVSGLSYDTYLSFL  247



>ref|XP_009773950.1| PREDICTED: uncharacterized protein LOC104224082 [Nicotiana sylvestris]
Length=526

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST+SRWI++ E+G+RVKL C NW  HL+ ++ EGL +QPV  I++ I  MGFNCVRLT
Sbjct  22   PLSTSSRWIIDDETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSHIARHISLMGFNCVRLT  81

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  ++FT  S  +LTV QSF N GL ++++GL  NNP ++ L ++ A +AV+  L ++ V
Sbjct  82   WATYMFTRHS--NLTVAQSFINNGLNDAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGV  139

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M +LDN + +P WCC S DGNGF+GD YF+PK W+ GL  VA  +     V+G+SLRNEL
Sbjct  140  MSVLDNQVGEPMWCCGSDDGNGFWGDKYFEPKEWLKGLDIVARTYKDIPLVIGISLRNEL  199

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP QN + WY Y+Q+GA+ +H ANP+LL+I SGL +D D +FL
Sbjct  200  RGPLQNQSVWYEYVQKGAKTIHRANPNLLLIISGLDYDLDFTFL  243



>ref|XP_009605826.1| PREDICTED: uncharacterized protein LOC104100317 [Nicotiana tomentosiformis]
Length=526

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 161/224 (72%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST+SRWIV+E +G+RVKL C NW  HL+ ++ EGL +QPV  I++ I  MGFNCVRLT
Sbjct  22   PLSTSSRWIVDEETGQRVKLVCGNWAAHLQTMLPEGLDQQPVSQIARHISLMGFNCVRLT  81

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  ++FT  S  +LTV QSF N GL  +++GL  NNP ++ L ++ A +AV+  L ++ V
Sbjct  82   WATYMFTRHS--NLTVAQSFINNGLNNAMSGLGQNNPQLLGLTVVEAQKAVIEELGRHGV  139

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M +LDN + +P WCC S DGNGF+GD YF+PK W+ GL  VA  +     V+G+SLRNEL
Sbjct  140  MSVLDNQVGEPMWCCGSNDGNGFWGDKYFEPKEWLKGLDIVANRYKDIPMVIGISLRNEL  199

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP QN + WY Y+++GA+ +H ANP+LL+I SGL +D D +FL
Sbjct  200  RGPLQNQSVWYEYVEKGAKTIHRANPNLLLIISGLDYDLDFTFL  243



>gb|EYU23410.1| hypothetical protein MIMGU_mgv1a004297mg [Erythranthe guttata]
Length=534

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 151/226 (67%), Gaps = 1/226 (0%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            A  LSTNSRWI+++ +G+RVKL C NW  H+E ++ EGL K+PV  I+ +I  +GFNCVR
Sbjct  22   AITLSTNSRWIIDQGTGKRVKLTCANWAAHMEPMLPEGLEKKPVSYIASQIAKLGFNCVR  81

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LTW  ++FT     +L V +S     L  + AG+  NN   +++ +I   +AVVG L K 
Sbjct  82   LTWATYMFTRPEYVNLKVSESLDRYSLAAAKAGIGKNNAQFLEMSVIDVQKAVVGELGKN  141

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             +M++LDN +S P WCCS  DGNGF+GD YF    W+ GLT VA  + G   VV MSLRN
Sbjct  142  NLMVVLDNTVSMPTWCCSDDDGNGFWGDKYFAVDEWLQGLTAVARAYKGNPAVVAMSLRN  201

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRG  QN+ DWYRYM+ GA+ VH  NPD L++ SG S+D DLSFL
Sbjct  202  ELRGKGQNLLDWYRYMKAGAQTVHTENPDFLIVVSGTSYDSDLSFL  247



>ref|XP_010325669.1| PREDICTED: uncharacterized protein LOC101257885 [Solanum lycopersicum]
Length=503

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 163/224 (73%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST+SRWI+++ +G+RVKLACVNW  HL+ ++ EGL +QP+  I K I  MGFNCVRLT
Sbjct  28   PLSTSSRWIIDDKNGQRVKLACVNWAAHLQTMIPEGLDQQPISKIVKHISLMGFNCVRLT  87

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  ++FT  S  +LTV QSF N GL +++  +   NP ++ L +  A +AVV  + ++ +
Sbjct  88   WATYMFTRYS--NLTVAQSFANNGLHDALTRIAQKNPQLLGLSVFEAQRAVVEEMGRHGI  145

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M ILDNH+S+P WCC ++DGNGF+GD  F PK W+ GL  VA  +  +  V+G+SLRNEL
Sbjct  146  MSILDNHLSRPMWCCGNHDGNGFWGDEDFQPKEWLKGLDIVAKKYKDSPMVMGISLRNEL  205

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP QN + WY+ +++GA+A+H ANP++L+I SGL++D D +FL
Sbjct  206  RGPLQNQSVWYKNVKKGAKAIHKANPNILIIISGLNYDIDFTFL  249



>ref|XP_001767510.1| predicted protein [Physcomitrella patens]
 gb|EDQ67645.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 148/223 (66%), Gaps = 0/223 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLST SRW+V+  G RVK +CVNW  HLE  + EGLS+     I+  I   GFNCVRLT+
Sbjct  1    PLSTFSRWVVDRFGVRVKFSCVNWAGHLEAGIPEGLSRNTARGIATLIRVNGFNCVRLTY  60

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
              +L+TNDS   LTV Q+F NL L  +   + A NP +  L L   ++ +V  L  + +M
Sbjct  61   STWLWTNDSYGELTVAQNFNNLNLTSTGLAIAALNPDLYLLTLRQVHRRMVNILTAHDLM  120

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +ILDNH+SKP WCCS  DGNGF+GD YFD + W++GLT VAT F+    VV MSLRN LR
Sbjct  121  VILDNHVSKPKWCCSDTDGNGFWGDEYFDVETWMLGLTTVATTFSSNPFVVAMSLRNALR  180

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP+QN  DW   M Q AEAVH  NPD+L+I  GLSF  DLSFL
Sbjct  181  GPRQNAIDWRVLMAQAAEAVHDVNPDVLIIAGGLSFATDLSFL  223



>gb|KDP25366.1| hypothetical protein JCGZ_20522 [Jatropha curcas]
Length=554

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 158/230 (69%), Gaps = 3/230 (1%)
 Frame = +2

Query  71   PTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P     PLST  +WIV+ ++G RVKLACVNW +HLE ++AEGL+ +P+  I  +IV   +
Sbjct  17   PCCFCLPLSTKGKWIVDSKTGERVKLACVNWPSHLEPMLAEGLADKPLKQIVFQIVRGNY  76

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
            NCVR TW  F+FT    A+LTVR+SF  L L E++A ++  N  I++  L  A++ V+  
Sbjct  77   NCVRFTWATFMFTR--YANLTVRESFNTLNLTETVAEIRRQNGFILEKTLPQAFETVIDE  134

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L +  VM+ILD  +SKP WCC   DGN FFGD YFD + W+ GLT  A +  G  NV+G+
Sbjct  135  LGRQGVMVILDCQVSKPTWCCGEKDGNAFFGDEYFDVEEWLQGLTTAAELAKGKPNVIGI  194

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            S RNELRGP  NV++WY+Y+ QGAEA+H ANPD +++ SGLS+  DL+FL
Sbjct  195  STRNELRGPLSNVDNWYKYITQGAEAIHKANPDAIILASGLSYANDLTFL  244



>emb|CDP12092.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   250 bits (638),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 161/224 (72%), Gaps = 1/224 (0%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST+SRWI+++ +G RVKL CVNWV HLE +V EGL K+P+  I   +  MGFNCVRLT
Sbjct  407  PLSTSSRWILDDKTGSRVKLTCVNWVGHLEPLVVEGLQKKPLPYIVDNVALMGFNCVRLT  466

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  F+FT ++  +LTVR+S   L L  S+AG+  NNP ++D  ++   +AVV  L +  +
Sbjct  467  WATFMFTRENYGNLTVRESLNQLSLDGSVAGIAMNNPQLLDATVVEVQKAVVYELGRKNI  526

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+ILDNH+SKP WCC   DGNGFFGD +FDPK W+ GL  VA ++    NVV MS+RNEL
Sbjct  527  MVILDNHVSKPQWCCGGDDGNGFFGDEFFDPKEWLQGLAAVANLYKDAPNVVAMSMRNEL  586

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP+QN NDWY Y+ QGA A+H  NP LL+I SGL ++ D+SF+
Sbjct  587  RGPRQNTNDWYEYIPQGAAAIHGENPSLLIIVSGLGYETDISFV  630


 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 137/193 (71%), Gaps = 2/193 (1%)
 Frame = +2

Query  179  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  358
            ++ EGLSK P+D IS+ I  +GFNC+RLTW ++++T    A +TV Q  ++L L +++AG
Sbjct  1    MLPEGLSKSPLDDISRHISLLGFNCIRLTWAVYMYTRH--AHVTVAQHLQDLNLTDALAG  58

Query  359  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  538
            +Q +NP +  L L+ A +AV+ S+A + VM++LD  +SKP WCC+  DGNGF+GD YFDP
Sbjct  59   IQRHNPHLASLTLVDAQKAVIESVASHGVMVLLDCQVSKPMWCCNDNDGNGFWGDAYFDP  118

Query  539  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVI  718
              W+  L+ VA  +     V+ MSLRNELRGP+QN   WY ++++GA+ +H ANP++LV+
Sbjct  119  HEWLRALSTVAKRYKDMHMVMAMSLRNELRGPRQNETLWYHWVEEGAKTIHRANPNVLVL  178

Query  719  FSGLSFDKDLSFL  757
             SGL++D D  FL
Sbjct  179  VSGLNYDLDFRFL  191



>gb|KFK38059.1| hypothetical protein AALP_AA3G064700 [Arabis alpina]
Length=449

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 139/174 (80%), Gaps = 1/174 (1%)
 Frame = +2

Query  239  MGFNCVRLTWPLFLFTNDSLA-SLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
            MGFNCVR TWPL L TND+LA ++TVRQSF+  GL + + G+  +NPSIVD+PL+ A+QA
Sbjct  1    MGFNCVRFTWPLELMTNDTLAFNVTVRQSFERYGLNQDLNGIHTHNPSIVDIPLVNAFQA  60

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV SL ++ VM+ILDNH + PGWCCS  D + FFGD  FDP  W++GL K+AT+F    N
Sbjct  61   VVYSLGRHSVMVILDNHKTVPGWCCSKNDPDAFFGDAKFDPDQWILGLRKMATIFRNVKN  120

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            V+GMSLRNELRG K++  DWY+YMQ+GAEAVHA+NP++LVI SGL+FD DLSFL
Sbjct  121  VIGMSLRNELRGNKEDPKDWYKYMQKGAEAVHASNPNVLVILSGLNFDADLSFL  174



>ref|XP_002509879.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51266.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=542

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 155/220 (70%), Gaps = 3/220 (1%)
 Frame = +2

Query  101  NSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLF  277
            N RWI++ +SG RVKLACVNW +HL+ ++AEGL K+P+  ++ K+    FNCVR T    
Sbjct  30   NKRWIIDAKSGERVKLACVNWASHLQPMLAEGLDKKPLSYLASKLARYHFNCVRFTCATH  89

Query  278  LFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIIL  457
            +FT      LTV QSF +L L ++ AG+  +N  +++L ++ AY+AVV  L  + +M++L
Sbjct  90   MFTR--YGKLTVAQSFDSLNLTKAKAGIARHNSFLLNLTVVQAYEAVVNELGAHGLMVLL  147

Query  458  DNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPK  637
            DNH+S+P WCC   D NGFFGDI+F PK W+ GL  VA +F G S VV MS+RNELRGP 
Sbjct  148  DNHVSQPKWCCPQDDENGFFGDIHFHPKEWLRGLAIVAKIFQGKSQVVAMSMRNELRGPY  207

Query  638  QNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            QN +DWY+Y+Q+GA  VH  NP++LV+ SGL +  DLSFL
Sbjct  208  QNEHDWYKYIQEGARMVHKLNPEVLVLVSGLVWGTDLSFL  247



>ref|XP_002509878.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51265.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=521

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 155/226 (69%), Gaps = 5/226 (2%)
 Frame = +2

Query  83   AQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            + PLST  RWI++ ++G+RVKLACVNW +H+E ++AEGL +QP+  I   +    FNCVR
Sbjct  27   SMPLSTKGRWIIDTKTGQRVKLACVNWPSHMETMLAEGLHEQPLKRIVALLAKQKFNCVR  86

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LT+  +++T  S  + TV +SF  L   E+  G+  NNP ++   L  AY+ VV  LA  
Sbjct  87   LTYATYMWTRYS--NRTVSESFNFLP--EAKEGIAKNNPDLLSKTLPQAYETVVDELAAQ  142

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             VM +LDNH+SKP WCCS  DGN FFGD YFD K W+ GLT VAT F G   V+ +S RN
Sbjct  143  GVMTLLDNHVSKPTWCCSETDGNTFFGDTYFDVKEWIQGLTTVATRFRGKPKVMAISTRN  202

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRGP QN +DWY+Y+ +GA A+H ANPD+L+  SGLS+  DL++L
Sbjct  203  ELRGPLQNQDDWYKYILEGASAIHNANPDVLIFASGLSYANDLTYL  248



>gb|KDP25365.1| hypothetical protein JCGZ_20521 [Jatropha curcas]
Length=935

 Score =   245 bits (626),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 156/224 (70%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN +WIV+ ++G+RVKLACVNW  HLE +VAEG  +Q +  I ++IV   +NCVRLT
Sbjct  27   PLSTNGKWIVDSKTGQRVKLACVNWPAHLEPMVAEGFREQSLKRIVEQIVKQKYNCVRLT  86

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            W  F+FT    A++TV+QSF+ L L E+  G++ +N  +  + L+ A++AV+  L    V
Sbjct  87   WATFMFTR--YANITVKQSFQTLKLTETTGGIKKHNLFLYSMTLVQAFEAVIDELGNQGV  144

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M +LD  +SKP WCC   DGN FFGD  FD + W+ GLTKVA +     +VVG+S RNEL
Sbjct  145  MAVLDCQVSKPSWCCGERDGNAFFGDTSFDVQEWIQGLTKVAELVKSKPHVVGISTRNEL  204

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP  NV+DWY+Y+ +GA A+H ANPD+L+  SGL +  DL+FL
Sbjct  205  RGPLSNVDDWYKYINEGASAIHKANPDVLIFVSGLGYATDLTFL  248


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +2

Query  536  PKLWVIGLTKVATMFNGTS--NVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDL  709
            P LW   L    T   G +   V+G+S RNE+RGP+ N  DWY+YM+QG E +  ANP +
Sbjct  681  PALWPQVLLLNLTWNGGCALGKVIGISTRNEIRGPRSNEEDWYKYMEQGIETIQKANPPV  740

Query  710  LVIFSGLSF  736
            L+  SGL +
Sbjct  741  LIFASGLGY  749



>ref|XP_007159232.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
 gb|ESW31226.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
Length=529

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 157/226 (69%), Gaps = 3/226 (1%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            + PLS   RWI+++ +G RVKL C +WV H + ++AEGL K P++VI+  +   GFNCVR
Sbjct  21   SMPLSVQKRWIIDDATGERVKLHCTHWVVHAQPMLAEGLDKSPLNVIAANVAKAGFNCVR  80

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            L++  ++FT    A+ TVR +F +  + E +  +Q +NPS++++  + AY+AVV +L  +
Sbjct  81   LSYATYMFTRH--ANNTVRDTFHSYDVPEMVTAIQKHNPSVLNMTHLQAYEAVVDALGAH  138

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             VM+++DNH+S P WCC++ D NGFFGD +F+   W+ GL  VA  F G  NV  M LRN
Sbjct  139  GVMVLIDNHLSLPDWCCANDDQNGFFGDRHFNTSEWIQGLAIVAHHFKGKPNVFAMDLRN  198

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRG +QN N WY+Y+ +GA+ +H  NPDLL+I SGLSFD DLS+L
Sbjct  199  ELRGSRQNWNVWYKYVSEGAKTIHEINPDLLIIISGLSFDNDLSYL  244



>ref|XP_003621386.1| Endoglucanase E1 [Medicago truncatula]
Length=416

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 151/223 (68%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTN+RWI++E+G+RVKL CVNW +HL  +VAEGL  +P+  +  ++ ++GF+CVR TW
Sbjct  25   PLSTNNRWIIDETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTW  84

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
               +FT    ++  V ++   L L  S  G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMM  142

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +++DNH+S P WCC + DGNGFFGD Y DPK W+ GL+ VA    G S VV + LRNELR
Sbjct  143  VLVDNHVSDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAVGLRNELR  202

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP QN+++W +YM QGA  VH  NP++LV  SG ++D DLSFL
Sbjct  203  GPGQNIDNWQKYMSQGATTVHKENPNVLVFVSGFNYDTDLSFL  245



>emb|CDY16991.1| BnaC09g41180D [Brassica napus]
Length=495

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 151/230 (66%), Gaps = 29/230 (13%)
 Frame = +2

Query  68   PPTVVAQPLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGF  247
            P  + + PLST SRWIV+E G+RVKLACVNW  HL+  VAEGLSKQP+D ISKKI     
Sbjct  19   PKLITSYPLSTKSRWIVDEKGQRVKLACVNWPAHLQPAVAEGLSKQPLDSISKKI-----  73

Query  248  NCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGS  427
                                    SF+ L LL+ + G+Q +NP I++LP+  A+Q VV +
Sbjct  74   ------------------------SFERLNLLDDVLGIQTHNPKILNLPIFNAFQEVVSN  109

Query  428  LAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGM  607
            L +  VM+ILDNH++ PGWCCS  D + FF    FDP +W  GL+K+A++F   +NVVGM
Sbjct  110  LGQNGVMVILDNHLTTPGWCCSDNDLDAFFEYPNFDPIIWTKGLSKMASLFRNVTNVVGM  169

Query  608  SLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            SLRNE RG +   N W++YM +G EAVHAANPD+LVI SG+ +D +LSFL
Sbjct  170  SLRNEPRGTRDYPNLWFKYMPKGGEAVHAANPDVLVILSGIDYDTNLSFL  219



>ref|XP_003621369.1| Endoglucanase E1 [Medicago truncatula]
 gb|AES77587.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 147/223 (66%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTN RW+V+ESG+RVKL C+NW +H+  +VAEGL   P+     ++  +GFNCVR TW
Sbjct  25   PLSTNKRWVVDESGKRVKLHCINWSSHMNAMVAEGLDTIPLKDCIAQLKGLGFNCVRYTW  84

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
               +FT    ++  V +    L L     G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSTNKVGEKLDKLNLTGPRLGIGNFNPSMENITVVEAFDFVIDEFGKQGMM  142

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ VA    G   VV + LRNELR
Sbjct  143  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVANRVKGKPQVVAIGLRNELR  202

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GPKQN N+W++YM QGA  VH ANPD+LV  SGL++D DLSFL
Sbjct  203  GPKQNENNWHKYMSQGATTVHKANPDVLVFVSGLNYDTDLSFL  245



>ref|XP_010261410.1| PREDICTED: uncharacterized protein LOC104600255 [Nelumbo nucifera]
Length=418

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = +2

Query  170  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  349
            ++ ++AEGL K+P+  I   +  +GFNCVRLTW  ++FT    A  TV +S  ++GL E+
Sbjct  1    MQPMLAEGLDKKPLRDIVGLVSSLGFNCVRLTWATYMFTRTRAAQRTVAESLDSMGLTEA  60

Query  350  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  529
             AG+  NNPS+++L ++ AY  V+  L    +M++LDNH+S P WCC S DGNGFFGD Y
Sbjct  61   KAGVARNNPSLLNLTVVQAYGTVINELGAAGLMVVLDNHVSLPKWCCGSNDGNGFFGDAY  120

Query  530  FDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDL  709
            F+P  WV GL +VA  F G   VVGMS+RNELRGP+QN  DW+RY+Q GA  +H  NPDL
Sbjct  121  FNPDEWVEGLGRVAKRFKGRPQVVGMSMRNELRGPRQNEQDWFRYIQLGARKIHKMNPDL  180

Query  710  LVIFSGLSFDKDLSFL  757
            LVI SGLS+D DLSFL
Sbjct  181  LVIVSGLSYDTDLSFL  196



>emb|CBI34407.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 142/193 (74%), Gaps = 0/193 (0%)
 Frame = +2

Query  179  VVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAG  358
            +V EGL  QP+  I+ K+  MGFNC+RLT+  F++T    ++ TV QS  +  L ++  G
Sbjct  1    MVTEGLHTQPIKDIAAKVTSMGFNCIRLTYATFMWTRSDYSNKTVAQSLDSFNLTQAREG  60

Query  359  LQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDP  538
            +  NNP +++L L  AY+AVV  L    +M++LDNH+SKP WCC+  DGNGFFGD++FDP
Sbjct  61   IARNNPQLLNLSLQEAYEAVVDELGANGLMLVLDNHVSKPMWCCAREDGNGFFGDMFFDP  120

Query  539  KLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVI  718
            K W+ GLT+VA  F G   VV MS+RNE+RGP+QN+ DWY+ M++GA+A+H+ NPD+LV+
Sbjct  121  KEWIEGLTQVAKRFKGKPQVVAMSMRNEIRGPRQNLPDWYKNMREGAKAIHSTNPDVLVL  180

Query  719  FSGLSFDKDLSFL  757
             SGL+FDKDLSFL
Sbjct  181  VSGLNFDKDLSFL  193



>gb|AES77604.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 151/223 (68%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTN+RWI++E+G+RVKL CVNW +HL  +VAEGL  +P+  +  ++ ++GF+CVR TW
Sbjct  25   PLSTNNRWIIDETGKRVKLHCVNWSSHLNAMVAEGLEIKPLKDLIAQLKELGFDCVRYTW  84

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
               +FT    ++  V ++   L L  S  G+   NPS+ ++ ++ A+  V+    K  +M
Sbjct  85   ATHMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLENITVVEAFDFVIDEFGKQGMM  142

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            +++DNH+S P WCC + DGNGFFGD Y DPK W+ GL+ VA    G S VV + LRNELR
Sbjct  143  VLVDNHVSDPKWCCHNKDGNGFFGDQYSDPKEWLQGLSNVANRVKGKSQVVAVGLRNELR  202

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP QN+++W +YM QGA  VH  NP++LV  SG ++D DLSFL
Sbjct  203  GPGQNIDNWQKYMSQGATTVHKENPNVLVFVSGFNYDTDLSFL  245



>ref|XP_007135020.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
 gb|ESW07014.1| hypothetical protein PHAVU_010G095100g [Phaseolus vulgaris]
Length=512

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 153/226 (68%), Gaps = 3/226 (1%)
 Frame = +2

Query  83   AQPLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            A PLST +RWI++E +G+R KL C NW  HL+ ++ EGL K+P+  +  ++V   FNCVR
Sbjct  22   AYPLSTQNRWIIDEATGQRAKLVCANWAGHLKPMIPEGLDKRPLKELVGELVKHNFNCVR  81

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LT+ ++++T  S  +++   SF +L   E + G+  NNPS++ +  + A+ AVV  L   
Sbjct  82   LTYAIYMWTRYSHENVSA--SFASLDAPEVVQGISKNNPSVLSMTHVQAFHAVVHELGVQ  139

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             V ++LDNH+S+P WCC   D NGFF D +F+P+ WV GLT  A  F G   VV MSLRN
Sbjct  140  NVKVLLDNHVSEPMWCCDDDDENGFFHDRHFNPQEWVRGLTLAAKHFTGNHAVVAMSLRN  199

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            EL GP+QN+ DWYRYM QGA A+H  NP++LV+ SGL++D +L FL
Sbjct  200  ELHGPRQNLQDWYRYMSQGAVAIHKTNPNVLVLISGLNYDTELQFL  245



>ref|XP_001769398.1| predicted protein [Physcomitrella patens]
 gb|EDQ65767.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 147/222 (66%), Gaps = 0/222 (0%)
 Frame = +2

Query  92   LSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWP  271
            LSTNSRW+V+  G RVKL+CVNWV HLE  + EGL+K     I+  +   GFNCVRLT  
Sbjct  1    LSTNSRWVVDRFGVRVKLSCVNWVGHLEPGIPEGLNKNTARGIAILVRATGFNCVRLTSS  60

Query  272  LFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMI  451
             +L+TNDS   LTV QSF NL +  S   L+A NP +  L L   +  V+  L    +M+
Sbjct  61   TWLWTNDSYGGLTVAQSFSNLNITSSSIALRAINPELYPLTLREVHHQVINILTAQGLMV  120

Query  452  ILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRG  631
            ILDNH+SKP WCC+S DGNGF+GD +FD + W++GLT VA+ F+    VV MSLRNELRG
Sbjct  121  ILDNHVSKPQWCCASNDGNGFWGDEFFDAETWLMGLTTVASEFSNNPFVVAMSLRNELRG  180

Query  632  PKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
             +QN   W   M   A+AVH  NP++L+I  GL+F  DLSFL
Sbjct  181  SRQNSYLWRVLMSTAAQAVHDVNPNILIIAGGLNFGTDLSFL  222



>gb|KEH18775.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=538

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 154/226 (68%), Gaps = 3/226 (1%)
 Frame = +2

Query  83   AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            A PLST+SRWI++++ G RVKL C NW  HL+ ++ EGL ++P+  +  ++V   FNCVR
Sbjct  26   AYPLSTHSRWIIDDTTGERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVKNNFNCVR  85

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LT+ ++++T     +  V  +F +L + E + G+  NNPS++ +  I A+ AVV  L   
Sbjct  86   LTYAIYMWTR--YQNGIVNDTFNDLDVPEIVEGIANNNPSVLKMTHIEAFDAVVKELGDQ  143

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             V ++LDNH+S+P WCC   D NGFF D +FDP+ W+ GLT  A  F G   VV MSLRN
Sbjct  144  NVRVLLDNHVSEPKWCCHDDDENGFFHDRHFDPQEWIHGLTLAAKHFEGHHPVVAMSLRN  203

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            EL GP+QN+ DWY+YM QGA A+H +NP++LV+ SGL++D +L FL
Sbjct  204  ELHGPRQNLKDWYKYMSQGAFAIHKSNPNVLVLISGLNYDTELQFL  249



>ref|XP_004510834.1| PREDICTED: uncharacterized protein LOC101496378 [Cicer arietinum]
Length=540

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 153/226 (68%), Gaps = 3/226 (1%)
 Frame = +2

Query  83   AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            A PLST SRWI+++S   RVKL C NW  HL+ ++ EGL ++P+  +  ++V   FNCVR
Sbjct  27   AYPLSTKSRWIIDDSTSERVKLVCGNWAGHLQPMIPEGLDRRPLKELVGELVQKKFNCVR  86

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LT+ ++++T        V ++F +L   E++ G+   NP ++ +  I A+ AVV  LA  
Sbjct  87   LTYAIYMWTRH--GHDIVNETFSDLDAPEAVDGIAKYNPFVLKMTHIEAFDAVVNELAAQ  144

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             V ++LDNH+S+P WCC+  DGNGFF D +FDP+ W+ GLT  A  FNG  +VV MSLRN
Sbjct  145  NVKVLLDNHVSEPKWCCNDDDGNGFFYDRHFDPQEWIHGLTLAAKHFNGHHHVVAMSLRN  204

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            EL GP+QN+ DWY+YM Q A ++H ANP++LV+ SGL +D +L FL
Sbjct  205  ELHGPRQNLKDWYKYMSQAALSIHKANPNVLVVISGLIYDTELQFL  250



>ref|XP_010916958.1| PREDICTED: uncharacterized protein LOC105041671 [Elaeis guineensis]
Length=485

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 143/196 (73%), Gaps = 0/196 (0%)
 Frame = +2

Query  170  LEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLES  349
            +  V+AEGL KQPVD I+ +I  +GFNCVRLTW  +LFTN+S  +LTV  S  +LGL ++
Sbjct  1    MPAVLAEGLDKQPVDGIAARIAGLGFNCVRLTWATYLFTNESYENLTVSDSLSSLGLGDA  60

Query  350  IAGLQANNPSIVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIY  529
            +AG++ NN  +V + +  AY AVV ++ +  +M++LDNH+S+P WCC + DGNGFFGD+Y
Sbjct  61   LAGVRRNNGRMVGMTVREAYDAVVKAIGEAGLMVVLDNHVSRPQWCCGNADGNGFFGDLY  120

Query  530  FDPKLWVIGLTKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDL  709
            FDP+ W+ GL  VA  +     VVGMS+RNELRGP Q+   WYR + +GA+ +H  NPD+
Sbjct  121  FDPEEWLRGLELVARRYRDIHQVVGMSMRNELRGPNQSEPAWYRNIGRGAQTIHDTNPDV  180

Query  710  LVIFSGLSFDKDLSFL  757
            L+I SGL++D DLSFL
Sbjct  181  LIIASGLNYDTDLSFL  196



>ref|XP_003621392.1| Endoglucanase E1 [Medicago truncatula]
Length=534

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 148/223 (66%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  I  ++  +GF+CVR TW
Sbjct  25   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTW  84

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
               +FT    ++  V ++   L L  S  G++  NPS  ++ ++ A+  V+    +  +M
Sbjct  85   ATKMFT--RYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMM  142

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ V+    G S VV + LRNELR
Sbjct  143  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAIGLRNELR  202

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP QN++ W +YM QGA  VH  NP++LV  SG ++D DLSFL
Sbjct  203  GPSQNISSWQKYMSQGATTVHKENPNVLVFVSGFNYDIDLSFL  245



>gb|AES77610.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=535

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 148/223 (66%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  I  ++  +GF+CVR TW
Sbjct  26   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLETIPLKDIITQLKGLGFDCVRYTW  85

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
               +FT    ++  V ++   L L  S  G++  NPS  ++ ++ A+  V+    +  +M
Sbjct  86   ATKMFT--RYSNYKVGENLDKLNLTSSRLGIRFYNPSFENITVVEAFDNVIDEFGRQGMM  143

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            ++ DNH+S P WCC + DGNGFFGD YF+P+ W+ GL+ V+    G S VV + LRNELR
Sbjct  144  VLADNHVSDPKWCCDNNDGNGFFGDQYFNPEEWLQGLSNVSNRVKGKSQVVAIGLRNELR  203

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP QN++ W +YM QGA  VH  NP++LV  SG ++D DLSFL
Sbjct  204  GPSQNISSWQKYMSQGATTVHKENPNVLVFVSGFNYDIDLSFL  246



>gb|KGN45940.1| hypothetical protein Csa_6G028440 [Cucumis sativus]
Length=539

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 153/224 (68%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST+ RWI++ +SG+RVKL CVNW +H + ++ EGL+ +P+  ++ + + + FNCVRLT
Sbjct  26   PLSTHGRWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLT  85

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +   +FT    A+ TV ++F  L L ++ AGL   NP +++  +  AY+AVV  L    +
Sbjct  86   YATHMFTR--YANRTVEENFDLLDLEQAKAGLAQYNPFVLNKTIAEAYEAVVDVLGASGL  143

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+I DNH+S+P WCCS  DGNGFFG+ YFDP+ W+ GL+ VA  FN  S VVGMSLRNEL
Sbjct  144  MVIADNHMSQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGMSLRNEL  203

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG  +N NDW  Y+ QG   +H  NP +LVI SGL++D DL  L
Sbjct  204  RGMMENANDWNNYVTQGVTTIHKINPAVLVIVSGLNYDNDLRCL  247



>ref|XP_003621368.1| Endoglucanase [Medicago truncatula]
 gb|AES77586.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=457

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 147/223 (66%), Gaps = 2/223 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLTW  268
            PLSTN+RWIV+E+G+RVKL CVNW +H+  +VAEGL   P+  +  ++  +GF+CVR TW
Sbjct  26   PLSTNNRWIVDETGKRVKLHCVNWSSHMNAMVAEGLDAIPLKDVIAQLKGLGFDCVRYTW  85

Query  269  PLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKVM  448
              ++FT    ++  V ++   L L  S  G+   NPS+  + ++ A+  VV    K  +M
Sbjct  86   ATYMFT--RYSNYKVGENLDKLNLTSSRLGIGNFNPSLESITVVEAFDFVVDEFGKQGMM  143

Query  449  IILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNELR  628
            ++ DNH+S P WCC + DGNG FGD YF+ + W+ GL+ VA    G   +V + LRNELR
Sbjct  144  VLADNHVSDPKWCCDNNDGNGCFGDQYFNLEEWLQGLSNVANRVKGKPQIVAVGLRNELR  203

Query  629  GPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            GP QN ++WY+YM QG   VH ANP++LV  SGL++D DLSFL
Sbjct  204  GPGQNNDNWYKYMSQGVTTVHKANPNVLVFVSGLNYDTDLSFL  246



>ref|XP_002509877.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51264.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=547

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 148/224 (66%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLSTN RWIV+ ++G+RVKL C NW +H+E ++AEGL K+P+D I  ++    FNCVR T
Sbjct  22   PLSTNGRWIVDAKTGQRVKLTCANWPSHVESMLAEGLDKKPLDYIIHQLSRNHFNCVRFT  81

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +   ++T    A+ TV ++F +L L ++ AG+   NPS + +  + A+ AVV       V
Sbjct  82   YATHMYTR--YANRTVSETFDSLNLTDAKAGIAKYNPSFLSMTHVQAFDAVVDQFGAQGV  139

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            +++LDN +S+P WCC   DGNGFFGD  FD + W+  L  VA  F G S V+G+S RNEL
Sbjct  140  LVVLDNQVSRPTWCCGYDDGNGFFGDKDFDAEEWLQALATVADRFKGKSQVIGISTRNEL  199

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RGP  N +DWY+YM +G   +H ANPD+L+  SG+ +  DL++L
Sbjct  200  RGPSSNEDDWYKYMHEGGSTIHRANPDVLIFVSGIGYASDLTYL  243



>gb|KHN45741.1| Endoglucanase [Glycine soja]
Length=531

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 150/224 (67%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLS + RWI+++ +G+RVKL C +WV H   ++AEGL K P++ I+  I   GFNCVRL+
Sbjct  24   PLSVHKRWIIDDATGKRVKLHCAHWVAHATPMLAEGLDKSPMNDIAANIAKAGFNCVRLS  83

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +  ++FT    A+ TVR  F    +   ++ ++  NP ++++  + AY+AVV +L  + V
Sbjct  84   YATYMFTR--YANNTVRDIFHTHDIPGIVSAIEKYNPRVLNMTHLQAYEAVVDALGDHGV  141

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+++DNH+S   WCC++ D NGFFGD +F+   W+ GL  +A  F G  NV  M LRNEL
Sbjct  142  MVLIDNHVSLAKWCCANDDQNGFFGDRHFNTSEWLQGLAFIAHHFKGKPNVFAMDLRNEL  201

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG +QN +DWY+YM QGA  +H  NPD +VI SGL+FD DLSFL
Sbjct  202  RGSRQNHHDWYKYMTQGANTIHDINPDFIVIISGLAFDNDLSFL  245



>gb|KEH28356.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=523

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 148/226 (65%), Gaps = 3/226 (1%)
 Frame = +2

Query  83   AQPLSTNSRWIVNES-GRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVR  259
            A PLST SRWI+++S G RVKL C NW  HL+ ++ EGL + P+  +  ++V   FNCVR
Sbjct  24   AYPLSTQSRWIIDDSTGERVKLVCGNWAGHLQPMIPEGLDRIPLKELVGELVKNRFNCVR  83

Query  260  LTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKY  439
            LT+ ++++T    A   V  +F  L   E +AG+   NPSI+ +  I A+ AVV  L   
Sbjct  84   LTYAVYMWTRH--AHGIVNNTFNYLDAPEVVAGIAKYNPSILKMTHIEAFDAVVNELGAR  141

Query  440  KVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRN  619
             V ++LDNH+S+P WCC+  D NGFF D +FDP+ W+ GLT  A  F G   +V MSLRN
Sbjct  142  NVKVLLDNHVSEPKWCCNDDDDNGFFHDQHFDPQEWIHGLTLAAKHFYGHQPIVAMSLRN  201

Query  620  ELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            ELRGP+QN+ DWY+YM   A  +H  NP++LV+ SGL++D +L FL
Sbjct  202  ELRGPRQNLRDWYKYMSHAALVIHKTNPNVLVVISGLNYDTELQFL  247



>ref|XP_004170746.1| PREDICTED: endoglucanase E1-like [Cucumis sativus]
Length=539

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 152/224 (68%), Gaps = 3/224 (1%)
 Frame = +2

Query  89   PLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST+ RWI++ +SG+RVKL CVNW +H + ++ EGL+ +P+  ++ + + + FNCVRLT
Sbjct  26   PLSTHGRWIIDSQSGKRVKLVCVNWPSHTQSMLIEGLNHRPLKELADEAIKLRFNCVRLT  85

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQAVVGSLAKYKV  445
            +   +FT    A+ TV ++F  L L ++ AGL   N  +++  +  AY+AVV  L    +
Sbjct  86   YATHMFTR--YANRTVEENFDLLDLEQAKAGLAQYNAFVLNKTIAEAYEAVVDVLGASGL  143

Query  446  MIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNEL  625
            M+I DNH+S+P WCCS  DGNGFFG+ YFDP+ W+ GL+ VA  FN  S VVGMSLRNEL
Sbjct  144  MVIADNHMSQPRWCCSLDDGNGFFGNRYFDPQEWLQGLSLVAQRFNNKSTVVGMSLRNEL  203

Query  626  RGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            RG  +N NDW  Y+ QG   +H  NP +LVI SGL++D DL  L
Sbjct  204  RGMMENANDWNNYVTQGVTTIHKINPAVLVIVSGLNYDNDLRCL  247



>gb|KHG22500.1| Endoglucanase E1 [Gossypium arboreum]
Length=524

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 151/234 (65%), Gaps = 58/234 (25%)
 Frame = +2

Query  59   HLAPPTVVAQPLSTNSRWIVN-ESGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIV  235
            H+ P T +  PLSTNSRWIV+ ++ RRVKLACVNW +HLE V AEGLSK+ +D I+++IV
Sbjct  16   HVNPTTSL--PLSTNSRWIVDDQTHRRVKLACVNWPSHLEPVFAEGLSKRSMDSIAEQIV  73

Query  236  DMGFNCVRLTWPLFLFTNDSLASLTVRQSFKNLGLLESIAGLQANNPSIVDLPLITAYQA  415
             MGFNCVRLTWPL+L TNDSL+SLTVR+SF+NLGL+E IAG+QANNPS++D+ LI A+QA
Sbjct  74   SMGFNCVRLTWPLYLATNDSLSSLTVRRSFQNLGLMEPIAGIQANNPSVIDVSLIQAFQA  133

Query  416  VVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSN  595
            VV SL K  VM+ILDNH+SKPG                     W  G             
Sbjct  134  VVSSLGKNNVMVILDNHLSKPG---------------------WCCGY------------  160

Query  596  VVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
                                  Y   GAEAVHAANP+LL+I SGLSFDKDLSF+
Sbjct  161  ----------------------YDGDGAEAVHAANPNLLIILSGLSFDKDLSFI  192



>ref|XP_003608279.1| Endoglucanase [Medicago truncatula]
 gb|ABD32354.1| Glycoside hydrolase, family 5; Ricin B-related lectin [Medicago 
truncatula]
 gb|AES90476.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=536

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 152/225 (68%), Gaps = 4/225 (2%)
 Frame = +2

Query  89   PLSTNSRWIVNE-SGRRVKLACVNWVTHLEVVVAEGLSKQPVDVISKKIVDMGFNCVRLT  265
            PLST  RWI+++ +G R+KL C +WV H   ++ EGL K P+  I+ +I   GFNCVRL+
Sbjct  26   PLSTQKRWIIDDATGERMKLTCAHWVGHATPMLVEGLDKLPIQDIANQIAKSGFNCVRLS  85

Query  266  WPLFLFTNDSLASLTVRQSFKNLGLLESI-AGLQANNPSIVDLPLITAYQAVVGSLAKYK  442
            +  ++FT    A+ T+R +  +L + + + + ++ +NP ++++  + AY+A + +L +  
Sbjct  86   YATYMFTRH--ANDTIRDTLYSLDIPKDVVSAIEKHNPLMLNMTHVQAYEAAIDALGEKG  143

Query  443  VMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGLTKVATMFNGTSNVVGMSLRNE  622
            VM+++DNH+S   WCC + D NGFFGD +F P  W+ GL  +A  F G  NV+ M LRNE
Sbjct  144  VMVLIDNHVSMAEWCCDNNDQNGFFGDRHFHPDEWLQGLAFIAKHFRGKPNVIAMDLRNE  203

Query  623  LRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFDKDLSFL  757
            LRG +QN+ DWY+Y+ QGA  +H  NPDLL++ SGL+FD DLSFL
Sbjct  204  LRGGRQNLPDWYKYVSQGASTIHKHNPDLLIVISGLNFDNDLSFL  248



>emb|CBI16819.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  380  IVDLPLITAYQAVVGSLAKYKVMIILDNHISKPGWCCSSYDGNGFFGDIYFDPKLWVIGL  559
            +VDLPLI+AYQAVV  LA   VM+ILDNH+SKPGWCCSS+DGNGFFGD YF+P LWV GL
Sbjct  1    MVDLPLISAYQAVVSGLADNNVMVILDNHLSKPGWCCSSFDGNGFFGDQYFNPDLWVQGL  60

Query  560  TKVATMFNGTSNVVGMSLRNELRGPKQNVNDWYRYMQQGAEAVHAANPDLLVIFSGLSFD  739
            T++ATMF G +NVVGMSLRNELRGPKQNV DWYRYMQ+GAEAVH+ANPD+LVI SGLS+D
Sbjct  61   TRMATMFRGVTNVVGMSLRNELRGPKQNVKDWYRYMQKGAEAVHSANPDVLVIVSGLSYD  120

Query  740  KDLSFL  757
             DLSF+
Sbjct  121  TDLSFV  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470