BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043K04

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like               205   2e-57   Solanum tuberosum [potatoes]
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    195   8e-54   Nicotiana tomentosiformis
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    195   9e-54   Nicotiana tomentosiformis
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3         192   5e-53   
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         192   8e-53   Solanum lycopersicum
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         192   8e-53   Solanum lycopersicum
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               186   2e-50   Nicotiana sylvestris
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               162   4e-42   Sesamum indicum [beniseed]
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    160   2e-41   Sesamum indicum [beniseed]
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    160   3e-41   Sesamum indicum [beniseed]
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    159   3e-41   Sesamum indicum [beniseed]
emb|CBI25242.3|  unnamed protein product                                158   8e-41   Vitis vinifera
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               158   8e-41   Vitis vinifera
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily                 157   4e-40   
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    156   6e-40   Vitis vinifera
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg                154   2e-39   Erythranthe guttata [common monkey flower]
emb|CBI25244.3|  unnamed protein product                                154   2e-39   Vitis vinifera
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like               154   2e-39   Vitis vinifera
gb|KJB23545.1|  hypothetical protein B456_004G104100                    153   3e-39   Gossypium raimondii
gb|KJB23543.1|  hypothetical protein B456_004G104100                    153   5e-39   Gossypium raimondii
gb|KJB23544.1|  hypothetical protein B456_004G104100                    153   6e-39   Gossypium raimondii
gb|KJB23541.1|  hypothetical protein B456_004G104100                    153   6e-39   Gossypium raimondii
gb|KHG27245.1|  Protein WAX2                                            152   1e-38   Gossypium arboreum [tree cotton]
gb|KHG27244.1|  Protein WAX2                                            152   1e-38   Gossypium arboreum [tree cotton]
gb|KDO62362.1|  hypothetical protein CISIN_1g006768mg                   148   1e-37   Citrus sinensis [apfelsine]
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               149   2e-37   Cicer arietinum [garbanzo]
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                   148   3e-37   Citrus sinensis [apfelsine]
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             146   1e-36   Prunus persica
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    146   1e-36   
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    146   2e-36   Elaeis guineensis
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    145   3e-36   
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    145   3e-36   Phoenix dactylifera
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg             145   4e-36   Citrus clementina [clementine]
ref|XP_008223563.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         144   6e-36   
ref|XP_007154833.1|  hypothetical protein PHAVU_003G1516000g            143   6e-36   Phaseolus vulgaris [French bean]
ref|XP_007154834.1|  hypothetical protein PHAVU_003G1516000g            143   6e-36   Phaseolus vulgaris [French bean]
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like               144   9e-36   Solanum tuberosum [potatoes]
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         144   1e-35   Prunus mume [ume]
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         144   1e-35   Elaeis guineensis
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         143   1e-35   Elaeis guineensis
ref|XP_010545442.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         142   3e-35   
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         142   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_009622102.1|  PREDICTED: protein ECERIFERUM 3-like               137   7e-35   Nicotiana tomentosiformis
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg                141   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    140   2e-34   
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like               140   2e-34   Camelina sativa [gold-of-pleasure]
gb|KJB83321.1|  hypothetical protein B456_013G242200                    140   2e-34   Gossypium raimondii
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               140   2e-34   Glycine max [soybeans]
gb|KJB83319.1|  hypothetical protein B456_013G242200                    139   2e-34   Gossypium raimondii
gb|KJB83322.1|  hypothetical protein B456_013G242200                    140   2e-34   Gossypium raimondii
gb|KJB83320.1|  hypothetical protein B456_013G242200                    139   2e-34   Gossypium raimondii
gb|KJB83318.1|  hypothetical protein B456_013G242200                    140   4e-34   Gossypium raimondii
gb|KJB83323.1|  hypothetical protein B456_013G242200                    139   4e-34   Gossypium raimondii
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                    139   4e-34   Camelina sativa [gold-of-pleasure]
emb|CDY11848.1|  BnaC03g12740D                                          139   5e-34   Brassica napus [oilseed rape]
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg             139   6e-34   Capsella rubella
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like               139   7e-34   Nicotiana sylvestris
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3                    139   7e-34   Fragaria vesca subsp. vesca
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              139   7e-34   Medicago truncatula
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g             139   9e-34   
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                    139   9e-34   Populus euphratica
gb|KHG30512.1|  Protein WAX2 -like protein                              138   1e-33   Gossypium arboreum [tree cotton]
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like               138   1e-33   Glycine max [soybeans]
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like               138   1e-33   Phoenix dactylifera
gb|KHN17538.1|  Protein WAX2                                            138   1e-33   Glycine soja [wild soybean]
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like               138   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_011012180.1|  PREDICTED: protein ECERIFERUM 3-like               137   2e-33   Populus euphratica
ref|NP_200588.2|  protein ECERIFERUM 3                                  137   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like               137   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876             136   6e-33   
gb|KHG04939.1|  Protein WAX2                                            136   6e-33   Gossypium arboreum [tree cotton]
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    136   8e-33   Eucalyptus grandis [rose gum]
gb|KJB27032.1|  hypothetical protein B456_004G273200                    135   1e-32   Gossypium raimondii
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like               135   1e-32   Brassica rapa
emb|CDX88639.1|  BnaA03g10100D                                          135   2e-32   
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g             134   3e-32   
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like               134   6e-32   Cucumis sativus [cucumbers]
emb|CDX88642.1|  BnaA03g10070D                                          132   3e-31   
ref|XP_010103144.1|  Protein WAX2                                       131   5e-31   
emb|CDY50795.1|  BnaCnng19590D                                          130   1e-30   Brassica napus [oilseed rape]
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    130   2e-30   Brassica rapa
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    129   2e-30   Brassica rapa
emb|CDY51280.1|  BnaA10g11680D                                          129   2e-30   Brassica napus [oilseed rape]
emb|CDY11847.1|  BnaC03g12730D                                          129   2e-30   Brassica napus [oilseed rape]
emb|CDP02895.1|  unnamed protein product                                129   2e-30   Coffea canephora [robusta coffee]
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg             129   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_009132284.1|  PREDICTED: protein ECERIFERUM 3-like               127   1e-29   
emb|CDY02769.1|  BnaC02g11200D                                          127   1e-29   
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4    125   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX88640.1|  BnaA03g10090D                                          125   6e-29   
ref|XP_009387452.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    125   6e-29   
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    125   8e-29   
ref|XP_009387450.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    125   9e-29   
emb|CDY32747.1|  BnaA02g08090D                                          125   9e-29   Brassica napus [oilseed rape]
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg                124   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_009126813.1|  PREDICTED: protein ECERIFERUM 3                    124   1e-28   Brassica rapa
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                    124   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like               124   2e-28   Elaeis guineensis
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like               124   2e-28   Sesamum indicum [beniseed]
gb|AEQ39063.1|  putative sterol desaturase                              119   3e-28   Wolffia arrhiza
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like               121   1e-27   Sesamum indicum [beniseed]
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like               121   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like               120   2e-27   Setaria italica
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like               120   3e-27   Nicotiana sylvestris
ref|XP_002528208.1|  sterol desaturase, putative                        119   4e-27   
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like               120   5e-27   Nicotiana tomentosiformis
dbj|BAK02959.1|  predicted protein                                      119   6e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like               119   9e-27   Solanum tuberosum [potatoes]
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                    118   2e-26   Solanum lycopersicum
gb|EAZ44800.1|  hypothetical protein OsJ_29433                          117   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063227.1|  Os09g0426800                                       117   3e-26   
gb|KDP38762.1|  hypothetical protein JCGZ_04115                         117   4e-26   Jatropha curcas
gb|EPS72440.1|  hypothetical protein M569_02318                         112   4e-25   Genlisea aurea
gb|KJB27033.1|  hypothetical protein B456_004G273200                    113   9e-25   Gossypium raimondii
ref|XP_008443806.1|  PREDICTED: protein ECERIFERUM 3                    113   1e-24   Cucumis melo [Oriental melon]
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                    113   1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004173838.1|  PREDICTED: protein ECERIFERUM 3-like               110   2e-24   
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like               112   2e-24   Setaria italica
emb|CDO98263.1|  unnamed protein product                                112   4e-24   Coffea canephora [robusta coffee]
gb|EYU34298.1|  hypothetical protein MIMGU_mgv1a0095731mg               108   8e-24   Erythranthe guttata [common monkey flower]
gb|ADE75704.1|  unknown                                                 110   2e-23   Picea sitchensis
gb|KJB83324.1|  hypothetical protein B456_013G242200                    108   7e-23   Gossypium raimondii
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    107   2e-22   Setaria italica
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like               105   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT16346.1|  glossy1 protein                                         104   1e-21   Saccharum hybrid cultivar R570
ref|XP_003563334.1|  PREDICTED: protein ECERIFERUM 3-like               104   2e-21   Brachypodium distachyon [annual false brome]
gb|ACN25333.1|  unknown                                                 103   2e-21   Zea mays [maize]
gb|KHG04940.1|  Protein WAX2                                            103   3e-21   Gossypium arboreum [tree cotton]
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...    103   3e-21   
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like               103   3e-21   Setaria italica
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330          102   4e-21   Sorghum bicolor [broomcorn]
gb|AFW87578.1|  hypothetical protein ZEAMMB73_499314                    100   5e-21   
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...    102   8e-21   
ref|NP_001266321.1|  gl1 protein                                        102   9e-21   
dbj|BAJ85064.1|  predicted protein                                    99.4    7e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like             99.0    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006657201.1|  PREDICTED: protein ECERIFERUM 3-like             96.3    7e-19   
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920        96.3    7e-19   Sorghum bicolor [broomcorn]
ref|XP_006646964.1|  PREDICTED: protein ECERIFERUM 3-like             96.3    9e-19   
gb|AAB87597.1|  gl1                                                   92.8    1e-18   Zea mays [maize]
tpg|DAA61565.1|  TPA: glossy1                                         91.7    2e-18   
gb|ACG36324.1|  hypothetical protein                                  89.0    3e-18   Zea mays [maize]
dbj|BAJ85039.1|  predicted protein                                    94.4    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87617.1|  predicted protein                                    94.4    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC72610.1|  hypothetical protein OsI_06088                        94.4    3e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001046080.1|  Os02g0178800                                     94.4    3e-18   
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like             93.6    6e-18   Brachypodium distachyon [annual false brome]
ref|NP_001058237.1|  Os06g0653000                                     93.2    8e-18   
ref|NP_001105247.1|  glossy1                                          92.8    1e-17   Zea mays [maize]
gb|AAR90847.1|  glossy1 protein                                       92.8    1e-17   Zea mays [maize]
tpg|DAA61563.1|  TPA: glossy1                                         92.8    1e-17   
gb|EPS65188.1|  hypothetical protein M569_09590                       87.0    5e-17   Genlisea aurea
gb|EMS58990.1|  Protein WAX2                                          89.7    9e-17   Triticum urartu
gb|ACN25689.1|  unknown                                               89.0    2e-16   Zea mays [maize]
gb|EMT05456.1|  Protein WAX2                                          86.7    9e-16   
gb|EMT23422.1|  Protein WAX2                                          86.3    2e-15   
gb|EMS47164.1|  Protein WAX2                                          85.9    3e-15   Triticum urartu
gb|KDP34470.1|  hypothetical protein JCGZ_12753                       82.8    3e-15   Jatropha curcas
ref|XP_002509294.1|  predicted protein                                83.6    1e-14   Micromonas commoda
gb|AAA33934.1|  lipid transfer protein                                83.2    1e-14   Senecio odorus
ref|XP_002973631.1|  hypothetical protein SELMODRAFT_99824            79.3    2e-14   
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448           81.3    7e-14   Selaginella moellendorffii
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343           81.3    7e-14   Selaginella moellendorffii
ref|XP_001781794.1|  predicted protein                                80.9    8e-14   
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422           79.3    3e-13   
ref|XP_009760059.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3  79.3    3e-13   Nicotiana sylvestris
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  79.3    3e-13   Nicotiana sylvestris
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  79.3    3e-13   Nicotiana sylvestris
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942           79.0    3e-13   
ref|XP_003061467.1|  predicted protein                                79.0    4e-13   Micromonas pusilla CCMP1545
ref|XP_003625024.1|  Protein WAX2                                     78.6    5e-13   
gb|EEE56435.1|  hypothetical protein OsJ_05611                        78.2    5e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01917.1|  hypothetical protein OsI_23945                        77.0    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like             76.6    2e-12   
gb|EMS51792.1|  Protein WAX2                                          74.7    6e-12   Triticum urartu
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  75.1    7e-12   
dbj|BAJ85405.1|  predicted protein                                    74.7    7e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  75.1    7e-12   Solanum lycopersicum
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320        74.7    1e-11   Sorghum bicolor [broomcorn]
gb|AFW72383.1|  hypothetical protein ZEAMMB73_077345                  70.9    1e-11   
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982           74.3    1e-11   Selaginella moellendorffii
gb|KHG15491.1|  Protein WAX2 -like protein                            74.3    1e-11   Gossypium arboreum [tree cotton]
ref|NP_001169009.1|  hypothetical protein                             70.9    1e-11   
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590        74.3    1e-11   Sorghum bicolor [broomcorn]
gb|EMS58602.1|  Protein WAX2                                          71.6    1e-11   Triticum urartu
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like             73.9    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_010255639.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  73.9    2e-11   
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  73.9    2e-11   
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167           73.6    2e-11   Selaginella moellendorffii
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like             73.2    2e-11   
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like             73.2    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680           73.2    3e-11   Selaginella moellendorffii
gb|ACA14353.1|  TCER1                                                 73.2    3e-11   Triticum aestivum [Canadian hard winter wheat]
gb|ABD28319.2|  Sterol desaturase                                     73.2    3e-11   Medicago truncatula
emb|CBI16764.3|  unnamed protein product                              70.9    3e-11   Vitis vinifera
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like             73.2    3e-11   Oryza brachyantha
gb|EMT33049.1|  Protein WAX2                                          73.2    3e-11   
ref|XP_003625020.1|  Protein WAX2                                     73.2    3e-11   
ref|XP_003081883.1|  faceless pollen-1 (ISS)                          73.2    3e-11   
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    3e-11   Nelumbo nucifera [Indian lotus]
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal              72.8    3e-11   Ostreococcus tauri
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1     72.8    4e-11   
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                  72.8    4e-11   Vitis vinifera
gb|KJB67450.1|  hypothetical protein B456_010G191300                  72.8    4e-11   Gossypium raimondii
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    4e-11   Nicotiana tomentosiformis
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2     72.8    4e-11   
gb|KJB76287.1|  hypothetical protein B456_012G081500                  72.4    5e-11   Gossypium raimondii
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like             72.0    6e-11   
ref|XP_001420263.1|  predicted protein                                72.0    6e-11   Ostreococcus lucimarinus CCE9901
gb|KJB76257.1|  hypothetical protein B456_012G081600                  72.0    6e-11   Gossypium raimondii
gb|KJB76256.1|  hypothetical protein B456_012G081600                  72.0    7e-11   Gossypium raimondii
ref|XP_010661477.1|  PREDICTED: protein ECERIFERUM 1-like             71.2    7e-11   
gb|KJB76252.1|  hypothetical protein B456_012G081600                  72.0    7e-11   Gossypium raimondii
gb|KJB76288.1|  hypothetical protein B456_012G081500                  71.6    7e-11   Gossypium raimondii
gb|KJB76254.1|  hypothetical protein B456_012G081600                  71.6    8e-11   Gossypium raimondii
emb|CBI16761.3|  unnamed protein product                              71.6    8e-11   Vitis vinifera
gb|KJB67446.1|  hypothetical protein B456_010G191100                  71.6    9e-11   Gossypium raimondii
ref|XP_003625022.1|  Protein WAX2                                     71.6    9e-11   Medicago truncatula
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                  71.6    9e-11   Arabis alpina [alpine rockcress]
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like             71.6    1e-10   Vitis vinifera
gb|KJB67445.1|  hypothetical protein B456_010G191100                  71.2    1e-10   Gossypium raimondii
ref|XP_001783415.1|  predicted protein                                71.2    1e-10   
ref|XP_001782380.1|  predicted protein                                71.2    1e-10   
gb|ACR38546.1|  unknown                                               71.2    1e-10   Zea mays [maize]
gb|AES88391.2|  fatty acid hydroxylase superfamily protein            71.2    1e-10   Medicago truncatula
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like             71.2    1e-10   
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg           71.2    1e-10   
gb|EMT06855.1|  Protein WAX2                                          70.9    1e-10   
gb|KHG03871.1|  Protein WAX2 -like protein                            70.9    1e-10   Gossypium arboreum [tree cotton]
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    1e-10   Setaria italica
emb|CAN60676.1|  hypothetical protein VITISV_029045                   70.9    2e-10   Vitis vinifera
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                  70.9    2e-10   Vitis vinifera
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like             70.5    2e-10   Nicotiana tomentosiformis
ref|NP_171721.3|  protein CER1-like 1                                 70.5    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973742.1|  protein CER1-like 1                                 70.5    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAC24373.1|  CER1-like protein                                     70.5    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                  70.1    3e-10   
emb|CAA65199.1|  CER1-like                                            70.1    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAA65200.1|  CER1-like                                            70.1    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAN81825.1|  hypothetical protein VITISV_014168                   70.5    3e-10   Vitis vinifera
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like             70.1    3e-10   Vitis vinifera
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                   70.1    3e-10   Camelina sativa [gold-of-pleasure]
emb|CBI16759.3|  unnamed protein product                              68.2    3e-10   Vitis vinifera
emb|CBI16760.3|  unnamed protein product                              70.5    3e-10   Vitis vinifera
emb|CDP09363.1|  unnamed protein product                              69.7    4e-10   Coffea canephora [robusta coffee]
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg           69.7    4e-10   Capsella rubella
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like             69.7    4e-10   Nicotiana sylvestris
gb|AES88379.2|  fatty acid hydroxylase superfamily protein            69.3    4e-10   Medicago truncatula
ref|XP_004166202.1|  PREDICTED: protein ECERIFERUM 1-like             66.2    5e-10   
ref|XP_003606182.1|  Protein WAX2                                     69.3    5e-10   
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like             69.3    5e-10   Vitis vinifera
ref|XP_002526511.1|  sterol desaturase, putative                      69.3    5e-10   
ref|XP_006845484.1|  hypothetical protein AMTR_s00019p00142280        69.3    5e-10   
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like             69.3    5e-10   Eucalyptus grandis [rose gum]
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like             69.3    5e-10   Solanum tuberosum [potatoes]
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like             69.3    5e-10   Nicotiana tomentosiformis
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                  69.3    5e-10   Solanum lycopersicum
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like             69.3    6e-10   Solanum tuberosum [potatoes]
ref|XP_003521032.2|  PREDICTED: protein ECERIFERUM 1-like             69.3    6e-10   
gb|ABD28314.2|  possible aldehyde decarbonylase-related, putative     64.3    6e-10   Medicago truncatula
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like             68.9    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO62363.1|  hypothetical protein CISIN_1g006768mg                 68.9    7e-10   Citrus sinensis [apfelsine]
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like             68.9    7e-10   Solanum lycopersicum
gb|KHN40120.1|  Protein WAX2                                          68.9    7e-10   Glycine soja [wild soybean]
ref|XP_007509665.1|  predicted protein                                68.9    7e-10   Bathycoccus prasinos
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                   68.9    8e-10   Camelina sativa [gold-of-pleasure]
emb|CDP09364.1|  unnamed protein product                              68.6    8e-10   Coffea canephora [robusta coffee]
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048           68.6    9e-10   
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like             68.6    9e-10   Setaria italica
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like             68.6    1e-09   
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like             68.6    1e-09   Nelumbo nucifera [Indian lotus]
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein            68.2    1e-09   Medicago truncatula
gb|KCW76793.1|  hypothetical protein EUGRSUZ_D011441                  65.1    1e-09   Eucalyptus grandis [rose gum]
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  68.2    1e-09   Nicotiana tomentosiformis
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3        67.8    1e-09   Brassica rapa
gb|EEC73617.1|  hypothetical protein OsI_08114                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2        67.8    1e-09   Brassica rapa
emb|CDY55894.1|  BnaA04g29150D                                        67.8    1e-09   Brassica napus [oilseed rape]
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1        67.8    2e-09   Brassica rapa
ref|NP_001047459.1|  Os02g0621300                                     67.8    2e-09   
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  67.8    2e-09   
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  67.8    2e-09   
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like             67.8    2e-09   
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like             67.4    2e-09   
emb|CDX93353.1|  BnaC04g45430D                                        67.4    2e-09   
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650        67.4    2e-09   
gb|ABG66131.1|  CER1 protein, putative, expressed                     64.3    3e-09   
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like             67.4    3e-09   
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like             67.0    3e-09   
gb|KGN56664.1|  hypothetical protein Csa_3G127750                     67.0    3e-09   
emb|CDX79754.1|  BnaC03g20900D                                        67.0    3e-09   
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like             67.0    3e-09   
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                   67.0    3e-09   
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                  66.6    4e-09   
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1        66.6    4e-09   
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg           66.6    4e-09   
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  66.6    4e-09   
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  66.6    4e-09   
ref|NP_001146661.1|  uncharacterized protein LOC100280261             66.6    4e-09   
gb|KHN40121.1|  Protein WAX2                                          66.2    5e-09   
gb|KHG12604.1|  Protein WAX2 -like protein                            66.2    5e-09   
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898  66.6    6e-09   
gb|EEC73225.1|  hypothetical protein OsI_07312                        62.8    6e-09   
gb|ACG35856.1|  CER1                                                  66.2    6e-09   
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like             66.2    6e-09   
gb|EAY87991.1|  hypothetical protein OsI_09413                        65.9    6e-09   
gb|KHN33999.1|  Protein WAX2                                          64.3    6e-09   
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like             65.9    7e-09   
ref|NP_001048490.1|  Os02g0814200                                     65.9    7e-09   
emb|CDY38059.1|  BnaCnng09200D                                        66.2    7e-09   
gb|KJB09060.1|  hypothetical protein B456_001G122000                  65.9    7e-09   
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                   65.9    7e-09   
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg           65.9    7e-09   
gb|AFW68611.1|  hypothetical protein ZEAMMB73_227989                  65.5    8e-09   
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg              65.9    8e-09   
gb|EPS65064.1|  hypothetical protein M569_09713                       65.9    8e-09   
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                  65.5    9e-09   
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                   65.5    1e-08   
emb|CDX93352.1|  BnaC04g45440D                                        65.5    1e-08   
ref|XP_009777506.1|  PREDICTED: protein ECERIFERUM 1-like             65.5    1e-08   
gb|EMS68717.1|  Protein WAX2                                          65.5    1e-08   
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                   65.5    1e-08   
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                   65.5    1e-08   
gb|KJB67449.1|  hypothetical protein B456_010G191200                  65.1    1e-08   
emb|CDY55893.1|  BnaA04g29140D                                        65.1    1e-08   
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  65.1    1e-08   
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                  65.1    1e-08   
gb|AHD24918.1|  CER1                                                  65.1    1e-08   
gb|AAD29719.1|AF143746_1  CER1                                        65.1    1e-08   
gb|EMT07276.1|  Protein WAX2                                          65.1    1e-08   
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1     65.1    1e-08   
dbj|BAJ85488.1|  predicted protein                                    65.1    1e-08   
gb|ABG47420.1|  putative CER1                                         65.1    1e-08   
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like             65.1    1e-08   
gb|EEC67150.1|  hypothetical protein OsI_33995                        64.7    2e-08   
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  64.7    2e-08   
dbj|BAB08850.1|  lipid transfer protein; glossy1 homolog              64.7    2e-08   
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                   64.7    2e-08   
gb|ABG66132.1|  CER1 protein, putative, expressed                     64.7    2e-08   
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like             64.7    2e-08   
ref|NP_001064826.1|  Os10g0471100                                     64.7    2e-08   
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  64.3    2e-08   
ref|XP_007041196.1|  CER1 protein                                     64.3    2e-08   
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g           64.3    2e-08   
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg              64.3    3e-08   
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  64.3    3e-08   
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  64.3    3e-08   
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg              63.9    3e-08   
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478           63.9    3e-08   
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like             63.9    3e-08   
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like             63.9    3e-08   
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg           63.9    3e-08   
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...  63.9    3e-08   
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                  63.9    4e-08   
ref|XP_007041194.1|  CER1 protein                                     63.5    4e-08   
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2        63.5    4e-08   
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like             63.5    4e-08   
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1        63.5    4e-08   
gb|ACG47659.1|  CER1                                                  63.5    4e-08   
ref|XP_004493412.1|  PREDICTED: protein ECERIFERUM 1-like             63.5    4e-08   
ref|XP_011469549.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  63.5    4e-08   
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  63.5    5e-08   
gb|EPS60467.1|  hypothetical protein M569_14337                       63.5    5e-08   
ref|XP_004231132.1|  PREDICTED: protein ECERIFERUM 1-like             59.3    5e-08   
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like             63.2    6e-08   
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1        63.2    6e-08   
ref|XP_003580122.1|  PREDICTED: protein ECERIFERUM 1-like             63.2    6e-08   
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2        63.2    6e-08   
ref|XP_010496699.1|  PREDICTED: protein ECERIFERUM 1-like             62.0    6e-08   
gb|KHN30013.1|  Protein WAX2                                          62.8    7e-08   
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg           62.8    8e-08   
ref|XP_010479259.1|  PREDICTED: protein ECERIFERUM 1-like             61.6    8e-08   
gb|AAC23640.1|  CER1-like protein                                     62.8    8e-08   
ref|NP_181306.3|  protein CER1-like 2                                 62.8    8e-08   
ref|NP_001118464.1|  protein CER1-like 2                              62.4    8e-08   
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g           62.8    8e-08   
gb|AIE57503.1|  CER1                                                  62.8    9e-08   
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                   62.8    9e-08   
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g           62.8    9e-08   
gb|ACJ85705.1|  unknown                                               62.4    9e-08   
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like             62.4    9e-08   
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                   62.4    9e-08   
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g           62.4    1e-07   
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like             62.4    1e-07   
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                   62.4    1e-07   
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2       62.4    1e-07   
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1       62.4    1e-07   
ref|XP_007041192.1|  CER1 protein                                     62.4    1e-07   
ref|XP_003570374.1|  PREDICTED: protein ECERIFERUM 1-like             62.4    1e-07   
ref|XP_011466125.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  62.0    1e-07   
ref|XP_011466122.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  62.0    1e-07   
ref|XP_002526512.1|  sterol desaturase, putative                      62.0    1e-07   
gb|KGN56666.1|  hypothetical protein Csa_3G127770                     62.0    1e-07   
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  62.0    1e-07   
ref|XP_010054526.1|  PREDICTED: protein ECERIFERUM 1-like             62.0    1e-07   
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like             62.0    1e-07   
gb|EMS48098.1|  Protein WAX2                                          62.0    1e-07   
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  62.0    1e-07   
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like             62.0    1e-07   
emb|CDX74937.1|  BnaA05g06830D                                        61.6    2e-07   
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                   61.6    2e-07   
ref|XP_003626834.1|  gl1-like protein                                 61.6    2e-07   
gb|EEE57393.1|  hypothetical protein OsJ_07566                        61.6    2e-07   
ref|XP_009621541.1|  PREDICTED: protein ECERIFERUM 1-like             58.2    2e-07   
emb|CDX91381.1|  BnaC04g07690D                                        61.2    2e-07   
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like             61.2    2e-07   
ref|XP_007015842.1|  CER1 protein isoform 1                           61.2    2e-07   
ref|XP_011085187.1|  PREDICTED: protein ECERIFERUM 1-like             61.2    3e-07   
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g           61.2    3e-07   
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like             61.2    3e-07   
dbj|BAA11024.1|  possible aldehyde decarbonylase                      60.8    3e-07   
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg              60.8    3e-07   
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  60.8    3e-07   
ref|XP_004170720.1|  PREDICTED: protein ECERIFERUM 1-like             60.8    3e-07   
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like             60.8    3e-07   
gb|AAB87721.1|  maize gl1 homolog                                     60.8    3e-07   
ref|NP_001184890.1|  protein ECERIFERUM 1                             60.8    3e-07   
gb|AAC24374.1|  CER1 protein                                          60.8    3e-07   
ref|NP_171723.2|  protein ECERIFERUM 1                                60.8    3e-07   
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like             60.8    4e-07   
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320        60.5    4e-07   
ref|XP_010920377.1|  PREDICTED: protein ECERIFERUM 1-like             60.5    4e-07   
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940        60.5    4e-07   
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg           60.5    4e-07   
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  60.5    5e-07   
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  60.5    5e-07   
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  60.1    6e-07   
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg           60.1    6e-07   
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  60.1    6e-07   
dbj|BAK01778.1|  predicted protein                                    59.7    6e-07   
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                 60.1    6e-07   
gb|KDO85386.1|  hypothetical protein CISIN_1g006590mg                 60.1    6e-07   
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                 60.1    7e-07   
ref|XP_010054532.1|  PREDICTED: protein ECERIFERUM 1-like             59.7    7e-07   
ref|XP_006445498.1|  hypothetical protein CICLE_v10019265mg           59.7    7e-07   
gb|KDO85384.1|  hypothetical protein CISIN_1g006590mg                 59.7    7e-07   
gb|EMT04955.1|  Protein WAX2                                          59.7    9e-07   
ref|XP_010097746.1|  Protein WAX2                                     59.3    1e-06   
gb|EMT15823.1|  Protein WAX2                                          57.0    1e-06   
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like             59.3    1e-06   
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg           59.3    1e-06   
ref|XP_002892018.1|  hypothetical protein ARALYDRAFT_887207           58.9    1e-06   
ref|XP_001756318.1|  predicted protein                                58.9    1e-06   
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg           58.9    1e-06   
ref|XP_010041339.1|  PREDICTED: protein ECERIFERUM 1-like             58.5    1e-06   
ref|XP_009758897.1|  PREDICTED: uncharacterized protein LOC104211529  58.9    2e-06   
gb|KCW44429.1|  hypothetical protein EUGRSUZ_L02074                   58.5    2e-06   
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like             58.9    2e-06   
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  58.5    2e-06   
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  58.5    2e-06   
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like             58.5    2e-06   
ref|XP_002443046.1|  hypothetical protein SORBIDRAFT_08g006860        56.2    2e-06   
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  58.2    3e-06   
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  57.8    3e-06   
gb|AAB87722.1|  glossy1 homolog                                       57.8    4e-06   
gb|EMS58051.1|  Protein WAX2                                          57.8    4e-06   
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1         57.8    4e-06   
ref|XP_002320584.1|  ECERIFERUM 1 family protein                      57.8    4e-06   
dbj|BAK00236.1|  predicted protein                                    57.8    4e-06   
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like             57.8    4e-06   
ref|XP_009793431.1|  PREDICTED: protein ECERIFERUM 1-like             54.3    4e-06   
ref|XP_009339872.1|  PREDICTED: protein ECERIFERUM 1-like             57.0    5e-06   
gb|EMS58604.1|  Protein WAX2                                          57.4    6e-06   
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like             57.0    6e-06   
ref|XP_006661851.1|  PREDICTED: protein ECERIFERUM 1-like             57.0    7e-06   
ref|XP_004145021.1|  PREDICTED: protein ECERIFERUM 1-like             57.0    7e-06   
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  57.0    7e-06   
gb|EMT04858.1|  Protein WAX2                                          56.6    8e-06   
ref|XP_007041193.1|  Fatty acid hydroxylase superfamily               53.1    8e-06   
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like             56.6    8e-06   
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like             56.6    1e-05   
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like             56.2    1e-05   
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like             56.2    1e-05   
ref|XP_004510149.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3  56.2    1e-05   
ref|XP_008361247.1|  PREDICTED: protein ECERIFERUM 1-like             56.2    1e-05   
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily               56.6    1e-05   
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like             56.2    1e-05   
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg           55.8    2e-05   
emb|CAE03390.2|  OSJNBa0004N05.14                                     55.5    2e-05   
ref|XP_007015845.1|  CER1 protein                                     55.5    2e-05   
ref|XP_008356893.1|  PREDICTED: protein ECERIFERUM 1-like             55.1    2e-05   
ref|XP_008460068.1|  PREDICTED: protein ECERIFERUM 1-like             55.5    2e-05   
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like             55.1    2e-05   
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg           55.5    2e-05   
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like             55.5    3e-05   
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like             55.1    3e-05   
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  54.7    3e-05   
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like             54.7    3e-05   
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like             54.7    4e-05   
gb|EPS71900.1|  hypothetical protein M569_02856                       54.3    5e-05   
ref|XP_009339873.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...  53.5    6e-05   
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like             53.9    7e-05   
emb|CBI16766.3|  unnamed protein product                              52.4    1e-04   
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like             52.0    3e-04   
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg           52.0    3e-04   
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like             52.0    3e-04   
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg           51.6    4e-04   
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  51.6    4e-04   
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  51.6    4e-04   
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like             51.2    6e-04   



>ref|XP_006341693.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=646

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 1/137 (1%)
 Frame = +3

Query  396  MGKENGAVHKEEEGN-TLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE  572
            M K+N  V   E GN TL+RK DAALFAWPW+NLGN+KYLL GP +AKFI+S+ WKES E
Sbjct  1    MEKQNEGVEVVENGNYTLLRKTDAALFAWPWKNLGNYKYLLYGPFLAKFIHSMYWKESME  60

Query  573  DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQA  752
            +IWCLHIL+L  LRGLVHQLWS+YSNML+ NR +RVSQQGID+EQID EW WDNFLILQA
Sbjct  61   NIWCLHILILCALRGLVHQLWSTYSNMLYLNRTRRVSQQGIDYEQIDHEWDWDNFLILQA  120

Query  753  ILASFAYMSFPFLG*SP  803
            I+ SF Y++FP L   P
Sbjct  121  IVGSFVYLNFPSLANIP  137



>ref|XP_009609208.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Nicotiana tomentosiformis]
Length=638

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = +3

Query  423  KEEEG-NTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHIL  596
            K+ EG + L+RKKDAALFAWPWENLGN+KYLL GP +AK IYS+ WKE+ E DIWCLHIL
Sbjct  3    KQNEGSDCLLRKKDAALFAWPWENLGNYKYLLYGPFLAKVIYSMYWKENMEEDIWCLHIL  62

Query  597  VLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYM  776
            +L  LRGLVHQLWS+YSNML+  R +RVSQ+GI FEQID EWHWDNFLILQAI+ SFAY+
Sbjct  63   ILCALRGLVHQLWSTYSNMLYLVRTRRVSQEGIGFEQIDNEWHWDNFLILQAIVGSFAYL  122

Query  777  SFPFLG*SP  803
            +FP L   P
Sbjct  123  NFPSLANLP  131



>ref|XP_009609207.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Nicotiana tomentosiformis]
Length=640

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = +3

Query  423  KEEEG-NTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHIL  596
            K+ EG + L+RKKDAALFAWPWENLGN+KYLL GP +AK IYS+ WKE+ E DIWCLHIL
Sbjct  3    KQNEGSDCLLRKKDAALFAWPWENLGNYKYLLYGPFLAKVIYSMYWKENMEEDIWCLHIL  62

Query  597  VLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYM  776
            +L  LRGLVHQLWS+YSNML+  R +RVSQ+GI FEQID EWHWDNFLILQAI+ SFAY+
Sbjct  63   ILCALRGLVHQLWSTYSNMLYLVRTRRVSQEGIGFEQIDNEWHWDNFLILQAIVGSFAYL  122

Query  777  SFPFLG*SP  803
            +FP L   P
Sbjct  123  NFPSLANLP  131



>ref|XP_010318689.1| PREDICTED: protein ECERIFERUM 3 isoform X3 [Solanum lycopersicum]
Length=607

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  396  MGKENGAVHKEEEGNTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWED  575
            M K+N  V  E   +TL+RK DAALFAWPW NLGN+KYLL GP +AKFI+S+ WKES ED
Sbjct  1    MEKQNEEV--ENGNDTLLRKTDAALFAWPWNNLGNYKYLLYGPFLAKFIHSMYWKESMED  58

Query  576  IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  755
            IWCLHILVL  LRGLVHQLWS++SNML+ N  +RVS +GID++QID EW WDNFLILQA+
Sbjct  59   IWCLHILVLCSLRGLVHQLWSTFSNMLYLNSTRRVSYEGIDYDQIDNEWDWDNFLILQAV  118

Query  756  LASFAYMSFPFLG*SP  803
            + SF Y++FP L   P
Sbjct  119  VGSFVYLNFPSLANLP  134



>ref|XP_010318688.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Solanum lycopersicum]
Length=641

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  396  MGKENGAVHKEEEGNTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWED  575
            M K+N  V  E   +TL+RK DAALFAWPW NLGN+KYLL GP +AKFI+S+ WKES ED
Sbjct  1    MEKQNEEV--ENGNDTLLRKTDAALFAWPWNNLGNYKYLLYGPFLAKFIHSMYWKESMED  58

Query  576  IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  755
            IWCLHILVL  LRGLVHQLWS++SNML+ N  +RVS +GID++QID EW WDNFLILQA+
Sbjct  59   IWCLHILVLCSLRGLVHQLWSTFSNMLYLNSTRRVSYEGIDYDQIDNEWDWDNFLILQAV  118

Query  756  LASFAYMSFPFLG*SP  803
            + SF Y++FP L   P
Sbjct  119  VGSFVYLNFPSLANLP  134



>ref|XP_004235875.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Solanum lycopersicum]
Length=643

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  396  MGKENGAVHKEEEGNTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWED  575
            M K+N  V  E   +TL+RK DAALFAWPW NLGN+KYLL GP +AKFI+S+ WKES ED
Sbjct  1    MEKQNEEV--ENGNDTLLRKTDAALFAWPWNNLGNYKYLLYGPFLAKFIHSMYWKESMED  58

Query  576  IWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAI  755
            IWCLHILVL  LRGLVHQLWS++SNML+ N  +RVS +GID++QID EW WDNFLILQA+
Sbjct  59   IWCLHILVLCSLRGLVHQLWSTFSNMLYLNSTRRVSYEGIDYDQIDNEWDWDNFLILQAV  118

Query  756  LASFAYMSFPFLG*SP  803
            + SF Y++FP L   P
Sbjct  119  VGSFVYLNFPSLANLP  134



>ref|XP_009788358.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=638

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +3

Query  420  HKEEEGNTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWED-IWCLHIL  596
            ++ E  ++L+ KKDAALF+WPWENLGN+KYLL GP +AK IYS+ WKE+ ED IWCLHIL
Sbjct  3    NQNEGSDSLLSKKDAALFSWPWENLGNYKYLLYGPFLAKVIYSMYWKENIEDDIWCLHIL  62

Query  597  VLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYM  776
            +L  LRGLVHQLW +YSNML   R +RVSQ+GI FEQID EWHWDNFLILQAI+ SF Y+
Sbjct  63   ILCALRGLVHQLWCTYSNMLCLVRTRRVSQEGIGFEQIDNEWHWDNFLILQAIVGSFVYL  122

Query  777  SFPFLG*SP  803
            +FP L   P
Sbjct  123  NFPSLANLP  131



>ref|XP_011082697.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=635

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +3

Query  423  KEEEGNTLM--RKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSL-VWKESWEDIWCLHI  593
            ++E+ N +   R+ +A LFAWPWENL +FKYLL GPL+A+ +Y++ +  E   D WCLHI
Sbjct  3    EQEKDNKICKHRRGEAGLFAWPWENLHSFKYLLYGPLVARVLYAVYIDGEVKNDDWCLHI  62

Query  594  LVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAY  773
            L+L+GLR LVHQLWSS+S MLF NR +R++QQG++F+QID EWHWDNFLILQ   ASF Y
Sbjct  63   LMLSGLRALVHQLWSSFSCMLFVNRTRRINQQGVEFDQIDAEWHWDNFLILQTFAASFLY  122

Query  774  MSFPFLG*SP  803
            +SFP L   P
Sbjct  123  LSFPALANLP  132



>ref|XP_011073243.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Sesamum indicum]
Length=547

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 92/121 (76%), Gaps = 4/121 (3%)
 Frame = +3

Query  450  RKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW---EDIWCLHILVLTGLRGL  620
            R  +A LF+WPWENL NFKYLL GP+  K +YS ++KE     +D WCLHIL+L GLR L
Sbjct  19   RGDEALLFSWPWENLNNFKYLLYGPIAGKVLYS-IYKEKTIKNDDTWCLHILILFGLRAL  77

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*S  800
            VHQLWS+YSNMLF NRA R+++QG++F QID EWHWDNFLIL+AILA    +SFP L   
Sbjct  78   VHQLWSTYSNMLFLNRAHRINEQGVEFSQIDAEWHWDNFLILEAILAYLLCLSFPLLANL  137

Query  801  P  803
            P
Sbjct  138  P  138



>ref|XP_011073241.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Sesamum indicum]
Length=643

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 92/121 (76%), Gaps = 4/121 (3%)
 Frame = +3

Query  450  RKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW---EDIWCLHILVLTGLRGL  620
            R  +A LF+WPWENL NFKYLL GP+  K +YS ++KE     +D WCLHIL+L GLR L
Sbjct  19   RGDEALLFSWPWENLNNFKYLLYGPIAGKVLYS-IYKEKTIKNDDTWCLHILILFGLRAL  77

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*S  800
            VHQLWS+YSNMLF NRA R+++QG++F QID EWHWDNFLIL+AILA    +SFP L   
Sbjct  78   VHQLWSTYSNMLFLNRAHRINEQGVEFSQIDAEWHWDNFLILEAILAYLLCLSFPLLANL  137

Query  801  P  803
            P
Sbjct  138  P  138



>ref|XP_011073242.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Sesamum indicum]
Length=641

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 92/121 (76%), Gaps = 4/121 (3%)
 Frame = +3

Query  450  RKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW---EDIWCLHILVLTGLRGL  620
            R  +A LF+WPWENL NFKYLL GP+  K +YS ++KE     +D WCLHIL+L GLR L
Sbjct  19   RGDEALLFSWPWENLNNFKYLLYGPIAGKVLYS-IYKEKTIKNDDTWCLHILILFGLRAL  77

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*S  800
            VHQLWS+YSNMLF NRA R+++QG++F QID EWHWDNFLIL+AILA    +SFP L   
Sbjct  78   VHQLWSTYSNMLFLNRAHRINEQGVEFSQIDAEWHWDNFLILEAILAYLLCLSFPLLANL  137

Query  801  P  803
            P
Sbjct  138  P  138



>emb|CBI25242.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG++KY+L GP +A+ IYS++W+E+    WCLHIL+L  LRGLVHQLWSS
Sbjct  4    APLSAWPWENLGSYKYVLYGPFLARLIYSMIWEETRNPSWCLHILLLCALRGLVHQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Y NMLF  R   + +QGIDF+QID EWHWDNF+ILQA +A  A +SFPFL   P
Sbjct  64   YCNMLFITRNHWILRQGIDFKQIDPEWHWDNFIILQAFMAGMALLSFPFLTNLP  117



>ref|XP_002270033.2| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG++KY+L GP +A+ IYS++W+E+    WCLHIL+L  LRGLVHQLWSS
Sbjct  4    APLSAWPWENLGSYKYVLYGPFLARLIYSMIWEETRNPSWCLHILLLCALRGLVHQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Y NMLF  R   + +QGIDF+QID EWHWDNF+ILQA +A  A +SFPFL   P
Sbjct  64   YCNMLFITRNHWILRQGIDFKQIDPEWHWDNFIILQAFMAGMALLSFPFLTNLP  117



>ref|XP_007013964.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOY31583.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=632

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L  WPWENLG FKYLL GPL AK +YS +++++ +D+WCLHIL++  LRGL+HQLWSS
Sbjct  3    APLSTWPWENLGLFKYLLYGPLAAKVLYSWIYEDTLKDLWCLHILLICALRGLIHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Y +MLF  R +R+ QQG+DF+QID+EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   YGSMLFLTRNRRIKQQGVDFKQIDREWDWDNFIILQALLASMACLIFPSLDGLP  116



>ref|XP_002270946.1| PREDICTED: protein ECERIFERUM 3 [Vitis vinifera]
 emb|CBI36611.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG FKYLL GP I K +YS   +++  D WCLHIL+L  LRGL+HQ W S
Sbjct  5    AVLSAWPWENLGTFKYLLYGPFIGKLLYSKFHEDAQTDTWCLHILILCALRGLIHQSWCS  64

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            YSNMLF  R +R+ +QG+DF+QID+EW WDNF++LQA++AS A+  FPFL   P
Sbjct  65   YSNMLFLTRNRRIQKQGVDFKQIDREWDWDNFILLQALIASVAFYIFPFLSDLP  118



>gb|EYU21788.1| hypothetical protein MIMGU_mgv1a025856mg [Erythranthe guttata]
Length=633

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +3

Query  453  KKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE--SWEDIWCLHILVLTGLRGLVH  626
            +++A LF+WPW+NL NFKYLL GPLI K ++++  KE    ++IWCLHIL+L   R LVH
Sbjct  12   REEAPLFSWPWDNLQNFKYLLYGPLICKALHAIYTKEITKNDNIWCLHILILFYHRALVH  71

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            QLWSSY+NMLF NRA+R+ Q+G++F QID EWHWDNFLILQ  +AS +YMSF  L   P
Sbjct  72   QLWSSYTNMLFLNRARRIDQRGVEFNQIDAEWHWDNFLILQITVASLSYMSFSLLANLP  130



>emb|CBI25244.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG++KYLL GP +A+ IYS++W+++    WCLHIL+L  LRGLVHQLW S
Sbjct  4    APLSAWPWENLGSYKYLLYGPFLARLIYSMIWEKTQNPSWCLHILLLCALRGLVHQLWYS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Y NMLF  R + + +QGI+F+QID+EWHWDNF+ILQA +A    +SFPFL   P
Sbjct  64   YCNMLFITRNRWILRQGINFKQIDREWHWDNFIILQAFVAGMVLLSFPFLTNLP  117



>ref|XP_002270075.1| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG++KYLL GP +A+ IYS++W+++    WCLHIL+L  LRGLVHQLW S
Sbjct  4    APLSAWPWENLGSYKYLLYGPFLARLIYSMIWEKTQNPSWCLHILLLCALRGLVHQLWYS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Y NMLF  R + + +QGI+F+QID+EWHWDNF+ILQA +A    +SFPFL   P
Sbjct  64   YCNMLFITRNRWILRQGINFKQIDREWHWDNFIILQAFVAGMVLLSFPFLTNLP  117



>gb|KJB23545.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=525

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG FKYLL GPL AK +YS ++++S +D+WCLHILV+  LRGL+HQLW+S
Sbjct  3    APLSAWPWENLGVFKYLLYGPLAAKVLYSWIYEDSIKDLWCLHILVICALRGLIHQLWNS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            YS  LF  R +R+ Q+G+DF+QID+EW WDNFLIL A+LA  A + FP L   P
Sbjct  63   YSTTLFLTRNRRIKQEGVDFKQIDREWDWDNFLILHALLAYMACLIFPSLDDLP  116



>gb|KJB23543.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=611

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG FKYLL GPL AK +YS ++++S +D+WCLHILV+  LRGL+HQLW+S
Sbjct  3    APLSAWPWENLGVFKYLLYGPLAAKVLYSWIYEDSIKDLWCLHILVICALRGLIHQLWNS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            YS  LF  R +R+ Q+G+DF+QID+EW WDNFLIL A+LA  A + FP L   P
Sbjct  63   YSTTLFLTRNRRIKQEGVDFKQIDREWDWDNFLILHALLAYMACLIFPSLDDLP  116



>gb|KJB23544.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=625

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG FKYLL GPL AK +YS ++++S +D+WCLHILV+  LRGL+HQLW+S
Sbjct  3    APLSAWPWENLGVFKYLLYGPLAAKVLYSWIYEDSIKDLWCLHILVICALRGLIHQLWNS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            YS  LF  R +R+ Q+G+DF+QID+EW WDNFLIL A+LA  A + FP L   P
Sbjct  63   YSTTLFLTRNRRIKQEGVDFKQIDREWDWDNFLILHALLAYMACLIFPSLDDLP  116



>gb|KJB23541.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=624

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG FKYLL GPL AK +YS ++++S +D+WCLHILV+  LRGL+HQLW+S
Sbjct  3    APLSAWPWENLGVFKYLLYGPLAAKVLYSWIYEDSIKDLWCLHILVICALRGLIHQLWNS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            YS  LF  R +R+ Q+G+DF+QID+EW WDNFLIL A+LA  A + FP L   P
Sbjct  63   YSTTLFLTRNRRIKQEGVDFKQIDREWDWDNFLILHALLAYMACLIFPSLDDLP  116



>gb|KHG27245.1| Protein WAX2 [Gossypium arboreum]
Length=624

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG FKYLL GPL AK +YS ++++S +D+WCLHILV+  LRGL+HQLWSS
Sbjct  3    APLSAWPWENLGVFKYLLYGPLAAKVLYSWIYEDSIKDLWCLHILVICALRGLIHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            YS  LF  R +R+  +G+DF+QID+EW WDNFLIL A+LA  A + FP L   P
Sbjct  63   YSTTLFLTRNRRIKPEGVDFKQIDREWDWDNFLILHALLAYMACLIFPSLDDLP  116



>gb|KHG27244.1| Protein WAX2 [Gossypium arboreum]
Length=666

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L AWPWENLG FKYLL GPL AK +YS ++++S +D+WCLHILV+  LRGL+HQLWSS
Sbjct  3    APLSAWPWENLGVFKYLLYGPLAAKVLYSWIYEDSIKDLWCLHILVICALRGLIHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            YS  LF  R +R+  +G+DF+QID+EW WDNFLIL A+LA  A + FP L
Sbjct  63   YSTTLFLTRNRRIKPEGVDFKQIDREWDWDNFLILHALLAYMACLIFPSL  112



>gb|KDO62362.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=487

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            DA L AWPW+NLG FKY+L GPL+ K +YS V+++   + WCLHIL+++ LRGL+H LW+
Sbjct  2    DAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWN  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            S+SNMLF NRA++++Q+G+DF+QID EW+WDNF++LQA +AS  Y  FP
Sbjct  62   SFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFP  110



>ref|XP_004507787.1| PREDICTED: protein ECERIFERUM 3-like [Cicer arietinum]
Length=633

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI----WCLHILVLTGLRGLVHQ  629
            A L +WPWENLG FKY+L GPL+ K +Y L+++E   +     WCLH+L+L GLRGLVH 
Sbjct  3    APLSSWPWENLGIFKYVLYGPLVGKVVYGLLYEEEHSNSNLNWWCLHLLILCGLRGLVHV  62

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            LW SYSN+LF  R +R+ QQG+DF+QIDKEW WDNF+ILQA++ S  +  FPFL
Sbjct  63   LWCSYSNLLFLTRNRRILQQGVDFKQIDKEWDWDNFMILQALVGSICFYVFPFL  116



>gb|KDO62360.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62361.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=632

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            DA L AWPW+NLG FKY+L GPL+ K +YS V+++   + WCLHIL+++ LRGL+H LW+
Sbjct  2    DAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILIISVLRGLIHILWN  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            S+SNMLF NRA++++Q+G+DF+QID EW+WDNF++LQA +AS  Y  FP
Sbjct  62   SFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFP  110



>ref|XP_007221983.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
 gb|EMJ23182.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
Length=629

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
            A L AWPWE LG++KYLL GPLI K +YS++ ++  +   + WCLHIL+L  LRG VHQL
Sbjct  3    APLTAWPWEFLGSYKYLLFGPLIGKALYSIIHEDPLKVLMNSWCLHILILCALRGTVHQL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            WSSY+NMLF  R +R+ QQG+DF+QIDKEW WDNF+ILQ ++AS A    PFL
Sbjct  63   WSSYTNMLFLTRTRRILQQGVDFKQIDKEWDWDNFIILQGLIASTACYLLPFL  115



>ref|XP_010929211.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Elaeis guineensis]
Length=561

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW NLG +KYLL GPL+AK IYS  W++   D WCLH+LVL  LRGLVHQLW S
Sbjct  3    APLSSWPWNNLGVYKYLLYGPLVAKVIYSSAWEQGKPDRWCLHVLVLCALRGLVHQLWCS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            + NMLF  R +RV   G+DF QIDKEW WDNFLILQ+ + +    SFP
Sbjct  63   FGNMLFLTRRRRVLGDGVDFRQIDKEWDWDNFLILQSFIGALVCYSFP  110



>ref|XP_010929210.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Elaeis guineensis]
Length=619

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW NLG +KYLL GPL+AK IYS  W++   D WCLH+LVL  LRGLVHQLW S
Sbjct  3    APLSSWPWNNLGVYKYLLYGPLVAKVIYSSAWEQGKPDRWCLHVLVLCALRGLVHQLWCS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            + NMLF  R +RV   G+DF QIDKEW WDNFLILQ+ + +    SFP
Sbjct  63   FGNMLFLTRRRRVLGDGVDFRQIDKEWDWDNFLILQSFIGALVCYSFP  110



>ref|XP_008804903.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Phoenix dactylifera]
Length=565

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KYLL GPL+AK IYS  W++   D WCLHIL+L  LRG +HQLWSS
Sbjct  3    ALLSSWPWDNLGVYKYLLYGPLVAKAIYSSAWEQGKADQWCLHILILCSLRGFIHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
            + NMLF  R +RV   G+DF+QIDKEW WDNFLILQ+ + +  Y SF
Sbjct  63   FHNMLFLTRRRRVLSDGVDFKQIDKEWDWDNFLILQSFIGALVYYSF  109



>ref|XP_008804902.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Phoenix dactylifera]
Length=619

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KYLL GPL+AK IYS  W++   D WCLHIL+L  LRG +HQLWSS
Sbjct  3    ALLSSWPWDNLGVYKYLLYGPLVAKAIYSSAWEQGKADQWCLHILILCSLRGFIHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
            + NMLF  R +RV   G+DF+QIDKEW WDNFLILQ+ + +  Y SF
Sbjct  63   FHNMLFLTRRRRVLSDGVDFKQIDKEWDWDNFLILQSFIGALVYYSF  109



>ref|XP_006453492.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
 ref|XP_006474093.1| PREDICTED: protein ECERIFERUM 3-like [Citrus sinensis]
 gb|ESR66732.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
Length=632

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            DA L AWPW+NLG FKY+L GPL+ K +YS V+++   + WCLHIL ++ LRGL+H LW+
Sbjct  2    DAPLAAWPWDNLGMFKYVLYGPLVGKALYSWVYEDKRIEYWCLHILFISVLRGLIHILWN  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            S+SNMLF NR ++++Q+G+DF+QID EW+WDNF++LQA +AS  Y  FP
Sbjct  62   SFSNMLFLNRTRQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFP  110



>ref|XP_008223563.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Prunus mume]
Length=575

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI---WCLHILVLTGLRGLVHQL  632
            A L AWPWE LG++KYLL GPLI K +YS++ ++  + +   WCLHIL+L  LRG+VHQL
Sbjct  3    APLTAWPWEFLGSYKYLLFGPLIGKALYSIIHEDPLKVLMNSWCLHILILCALRGIVHQL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            WSSY+NMLF  R +R+ QQG+DF+QIDKEW WDNF+ILQ ++AS A     FL
Sbjct  63   WSSYTNMLFLTRTRRILQQGVDFKQIDKEWDWDNFIILQGLIASTACYLLQFL  115



>ref|XP_007154833.1| hypothetical protein PHAVU_003G1516000g [Phaseolus vulgaris]
 gb|ESW26827.1| hypothetical protein PHAVU_003G1516000g [Phaseolus vulgaris]
Length=410

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE--SWEDI-WCLHILVLTGLRGLVHQL  632
              L  WPWENLG FKYLL GP +AK +Y   + E  S+ ++ WCLH+L+L+GLRGL+H L
Sbjct  3    PPLSTWPWENLGIFKYLLYGPFVAKVVYEWFYNEEHSYYNLSWCLHLLILSGLRGLIHVL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            W SYS+MLF  R +R+ QQG+DF+QIDKEW WDNFLILQA++ S A   FPFL
Sbjct  63   WGSYSHMLFLTRNRRILQQGVDFKQIDKEWDWDNFLILQALVTSMACYMFPFL  115



>ref|XP_007154834.1| hypothetical protein PHAVU_003G1516000g, partial [Phaseolus vulgaris]
 gb|ESW26828.1| hypothetical protein PHAVU_003G1516000g, partial [Phaseolus vulgaris]
Length=409

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE--SWEDI-WCLHILVLTGLRGLVHQL  632
              L  WPWENLG FKYLL GP +AK +Y   + E  S+ ++ WCLH+L+L+GLRGL+H L
Sbjct  3    PPLSTWPWENLGIFKYLLYGPFVAKVVYEWFYNEEHSYYNLSWCLHLLILSGLRGLIHVL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            W SYS+MLF  R +R+ QQG+DF+QIDKEW WDNFLILQA++ S A   FPFL
Sbjct  63   WGSYSHMLFLTRNRRILQQGVDFKQIDKEWDWDNFLILQALVTSMACYMFPFL  115



>ref|XP_006350059.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=629

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            +  L  WPWE LG FKYLL GP +AK +YS   ++S    WCLH+L+L  LRGL++QLWS
Sbjct  2    EGLLSTWPWEKLGCFKYLLYGPFVAKVMYSRFQEDSIMATWCLHVLILCSLRGLIYQLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            S+SNMLF  R +R+ +QG+ F+QID+EW WDNF++LQAI+AS AY +FP
Sbjct  62   SFSNMLFLTRNRRIIKQGVGFKQIDEEWDWDNFILLQAIMASLAYYTFP  110



>ref|XP_008223562.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Prunus mume]
Length=638

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
            A L AWPWE LG++KYLL GPLI K +YS++ ++  +   + WCLHIL+L  LRG+VHQL
Sbjct  3    APLTAWPWEFLGSYKYLLFGPLIGKALYSIIHEDPLKVLMNSWCLHILILCALRGIVHQL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            WSSY+NMLF  R +R+ QQG+DF+QIDKEW WDNF+ILQ ++AS A     FL
Sbjct  63   WSSYTNMLFLTRTRRILQQGVDFKQIDKEWDWDNFIILQGLIASTACYLLQFL  115



>ref|XP_010914062.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Elaeis guineensis]
Length=619

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KYLL GPL+AK IYS  W++   D WCLHIL+L  LRG +HQLWSS
Sbjct  3    ALLSSWPWDNLGVYKYLLYGPLVAKVIYSSAWEQGKADQWCLHILILCALRGSIHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
            + NMLF  R +RV   G+DF+QID+EW WDNFLILQ+ + +  Y SF
Sbjct  63   FHNMLFLTRRRRVLSDGVDFKQIDEEWDWDNFLILQSFIGALVYYSF  109



>ref|XP_010914063.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Elaeis guineensis]
Length=596

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KYLL GPL+AK IYS  W++   D WCLHIL+L  LRG +HQLWSS
Sbjct  3    ALLSSWPWDNLGVYKYLLYGPLVAKVIYSSAWEQGKADQWCLHILILCALRGSIHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
            + NMLF  R +RV   G+DF+QID+EW WDNFLILQ+ + +  Y SF
Sbjct  63   FHNMLFLTRRRRVLSDGVDFKQIDEEWDWDNFLILQSFIGALVYYSF  109



>ref|XP_010545442.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Tarenaya hassleriana]
Length=523

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLV-WKESWEDIWCLHILVLTGLRGLVHQLWS  638
            AAL AWPW NLGN KYLL  PL A+ +YS V  +E+     CLHILV++ LRGLVH L+S
Sbjct  3    AALSAWPWGNLGNLKYLLYVPLAAQVLYSRVNEEENPRATLCLHILVISALRGLVHVLFS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            S+SNMLF  R +R+ QQG+DF QID EWHWDNF++LQAI+AS A    PFL   P
Sbjct  63   SFSNMLFLTRTRRIDQQGVDFNQIDHEWHWDNFILLQAIIASVACYMTPFLNSLP  117



>ref|XP_010545441.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Tarenaya hassleriana]
Length=629

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLV-WKESWEDIWCLHILVLTGLRGLVHQLWS  638
            AAL AWPW NLGN KYLL  PL A+ +YS V  +E+     CLHILV++ LRGLVH L+S
Sbjct  3    AALSAWPWGNLGNLKYLLYVPLAAQVLYSRVNEEENPRATLCLHILVISALRGLVHVLFS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            S+SNMLF  R +R+ QQG+DF QID EWHWDNF++LQAI+AS A    PFL   P
Sbjct  63   SFSNMLFLTRTRRIDQQGVDFNQIDHEWHWDNFILLQAIIASVACYMTPFLNSLP  117



>ref|XP_009622102.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana tomentosiformis]
Length=291

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            +A L +WPW+NLG+FKYLL GP  AK  YS   + S    WCLH+L+L  LRG+++QLWS
Sbjct  2    EAPLSSWPWQNLGSFKYLLYGPFFAKVTYSRYQEHSIWATWCLHVLILCSLRGIIYQLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            S+SNMLF  R +R+ + G+DF QIDKEW WDNF++L A++A+ AY  FP
Sbjct  62   SFSNMLFLTRNRRIIKGGVDFRQIDKEWDWDNFVLLHALMATLAYYMFP  110



>gb|EYU24562.1| hypothetical protein MIMGU_mgv1a002930mg [Erythranthe guttata]
Length=624

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +3

Query  453  KKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWC-LHILVLTGLRGLVHQ  629
            K +A  F+WPW+NL ++KYL+ GPL+ K +YS+   E   D W  LHIL+L  LR L+HQ
Sbjct  4    KNEAPFFSWPWQNLHSYKYLVYGPLVGKVVYSIHKGEIKNDSWFFLHILILFALRALIHQ  63

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            L+S+YS++LF NRA+++++ G++F+QID EWHWDNFLILQA +AS  YMSFP L   P
Sbjct  64   LFSTYSSLLFLNRARKINENGVEFDQIDAEWHWDNFLILQAAVASLLYMSFPSLNNFP  121



>ref|XP_010536953.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 3-like [Tarenaya 
hassleriana]
Length=621

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE-SWEDIWCLHILVLTGLRGLVHQLWS  638
            AAL AWPWENLGN KYLL GPL A+ IYS V +E +     CLHIL+L+ LRGLVH LWS
Sbjct  3    AALSAWPWENLGNLKYLLYGPLAAQVIYSRVHEEENTRATLCLHILILSALRGLVHVLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMS  779
            S+++MLF  R +R++ QG+DF QID EW+WDNF++LQAI+AS   YMS
Sbjct  63   SFAHMLFLTRTRRINPQGVDFNQIDHEWNWDNFILLQAIIASMVCYMS  110



>ref|XP_010452800.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L  WPWEN GN KY+L GPL+A+ +YS  ++E   + +WCLHIL++ G + LVHQLWS
Sbjct  3    ALLSTWPWENFGNLKYILYGPLVAQVVYSYAYEEDITKALWCLHILIICGFKALVHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMSFPFL  791
             ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQAI+AS   YMS P +
Sbjct  63   VFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIASLICYMSPPLM  114



>gb|KJB83321.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=514

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE+LG FKY+L GPL AK  YS +++++  +D+WC+HIL++  LRGL+HQLWS
Sbjct  3    APLSAWPWEHLGIFKYILYGPLAAKAWYSWMYEDNILKDLWCIHILLICTLRGLIHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SY+NM F  R + + QQG+DF+QID EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   SYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQAMLASMASLIFPSLNTLP  117



>ref|XP_003542310.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
 gb|KHN34764.1| Protein WAX2 [Glycine soja]
Length=629

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE--SWEDI-WCLHILVLTGLRGLVHQL  632
            A L AWPW+N G +KYLL GP + K +Y   + E  S+ ++ WCLH+L+L+GLRGL+H L
Sbjct  3    APLSAWPWDNFGTYKYLLYGPFVGKVLYEWFYGEEQSYYNLSWCLHLLILSGLRGLIHVL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            W SYS+M F  R +R+ Q+G+DF+QIDKEW WDNFLILQA++AS A   FPFL
Sbjct  63   WGSYSHMFFLTRNRRIVQKGVDFKQIDKEWDWDNFLILQALVASMACYMFPFL  115



>gb|KJB83319.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=413

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE+LG FKY+L GPL AK  YS +++++  +D+WC+HIL++  LRGL+HQLWS
Sbjct  3    APLSAWPWEHLGIFKYILYGPLAAKAWYSWMYEDNILKDLWCIHILLICTLRGLIHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SY+NM F  R + + QQG+DF+QID EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   SYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQAMLASMASLIFPSLNTLP  117



>gb|KJB83322.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=569

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE+LG FKY+L GPL AK  YS +++++  +D+WC+HIL++  LRGL+HQLWS
Sbjct  3    APLSAWPWEHLGIFKYILYGPLAAKAWYSWMYEDNILKDLWCIHILLICTLRGLIHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SY+NM F  R + + QQG+DF+QID EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   SYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQAMLASMASLIFPSLNTLP  117



>gb|KJB83320.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=490

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE+LG FKY+L GPL AK  YS +++++  +D+WC+HIL++  LRGL+HQLWS
Sbjct  3    APLSAWPWEHLGIFKYILYGPLAAKAWYSWMYEDNILKDLWCIHILLICTLRGLIHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SY+NM F  R + + QQG+DF+QID EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   SYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQAMLASMASLIFPSLNTLP  117



>gb|KJB83318.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=627

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE+LG FKY+L GPL AK  YS +++++  +D+WC+HIL++  LRGL+HQLWS
Sbjct  3    APLSAWPWEHLGIFKYILYGPLAAKAWYSWMYEDNILKDLWCIHILLICTLRGLIHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SY+NM F  R + + QQG+DF+QID EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   SYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQAMLASMASLIFPSLNTLP  117



>gb|KJB83323.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=624

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE+LG FKY+L GPL AK  YS +++++  +D+WC+HIL++  LRGL+HQLWS
Sbjct  3    APLSAWPWEHLGIFKYILYGPLAAKAWYSWMYEDNILKDLWCIHILLICTLRGLIHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SY+NM F  R + + QQG+DF+QID EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   SYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQAMLASMASLIFPSLNTLP  117



>ref|XP_010483318.1| PREDICTED: protein ECERIFERUM 3 [Camelina sativa]
 gb|AIE57504.1| CER3 [Camelina sativa]
Length=632

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L  WPWEN GN KY+L GPL+A+ +YS  ++E   + +WCLHIL++ GL+ LVH+LWS
Sbjct  3    ALLSTWPWENFGNLKYILYGPLVAQVVYSWAYEEDITKALWCLHILIICGLKALVHELWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMSFPFL  791
             ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQAI+AS   YMS P +
Sbjct  63   VFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIASLICYMSPPLM  114



>emb|CDY11848.1| BnaC03g12740D [Brassica napus]
Length=631

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
              L AWPWEN GN KYLL  PL A+ +YSL ++E  W   WCL+IL++ GL+GLVH LWS
Sbjct  2    TTLSAWPWENYGNLKYLLYAPLAAQVMYSLAYEEDYWRAFWCLNILIICGLKGLVHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFP  785
            +Y+NMLF  R  R++ +G+DF+QID EW+WDN+++LQAILAS   YMS P
Sbjct  62   TYNNMLFLTRTLRINPKGVDFKQIDHEWNWDNYILLQAILASMICYMSTP  111



>ref|XP_006279594.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
 gb|EOA12492.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
Length=629

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI-WCLHILVLTGLRGLVHQLWS  638
            A L AWPWEN GN KY+L  PL+A+ +YS V++E    + WCLHIL++ GL+ LVH+LWS
Sbjct  3    AFLSAWPWENFGNLKYVLYAPLVAQVVYSWVYEEDISKVLWCLHILIICGLKALVHELWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMSFPFLG*SP  803
             ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQA++AS   YMS P +   P
Sbjct  63   VFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAMIASLICYMSPPLMNSLP  118



>ref|XP_009798188.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            +A L +WPW+NLG+FKYLL GP +AK +YS   ++S    WCLH+L+L  LRGL++QLWS
Sbjct  2    EAPLSSWPWQNLGSFKYLLYGPFVAKVMYSRYQEDSIWATWCLHVLILCSLRGLIYQLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            S+SNMLF  R +R+ + G+DF+QIDKEW WDNF++L A++A+ A    P L
Sbjct  62   SFSNMLFLTRNRRIIKDGVDFKQIDKEWDWDNFVLLHAVMATLACYMLPNL  112



>ref|XP_004309858.1| PREDICTED: protein ECERIFERUM 3 [Fragaria vesca subsp. vesca]
Length=630

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE LG++KY+L GPLI K +YS+++++      WCLH+L++  LRGL++QLW+
Sbjct  3    APLSAWPWEYLGSYKYVLFGPLIWKALYSIMYEDVLPMQSWCLHVLIICALRGLIYQLWN  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            SYSNMLF  R +R+ +QG+DF+QID EWHWDNF+ILQ ++AS A    P+L
Sbjct  63   SYSNMLFLTRNRRIIKQGVDFKQIDAEWHWDNFIILQGLIASMACYLVPYL  113



>gb|KEH32582.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=633

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE-SWEDI--WCLHILVLTGLRGLVHQL  632
            A L +WPWEN G FKY+L GP++ K +Y ++ +E S+ ++  WC+H+LVL GLR L+H  
Sbjct  3    APLSSWPWENFGIFKYVLYGPIVGKVLYEILNEEPSYSNLSWWCIHLLVLCGLRTLLHVF  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            WSSYSNMLF  R +R+ QQG+DF+QIDKEW WDNFLILQ ++A+     FPFL
Sbjct  63   WSSYSNMLFLTRNRRILQQGVDFKQIDKEWDWDNFLILQTLVATLVSYIFPFL  115



>ref|XP_002308430.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
 gb|EEE91953.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
Length=633

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            AAL AWPWENLG +KYLL GPL+AK + + + + S++D WCLHIL++   R  +HQLWSS
Sbjct  3    AALSAWPWENLGIYKYLLYGPLLAKVLSTRILEGSFKDDWCLHILIICVARSSLHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFA-YMSFPFLG*SP  803
            Y  MLF  R +R++Q G DF+QIDKEW WDNF++LQA++AS A Y+  PF+   P
Sbjct  63   YVTMLFLTRNRRINQHGYDFKQIDKEWDWDNFILLQALIASMACYIDPPFIENVP  117



>ref|XP_011018104.1| PREDICTED: protein ECERIFERUM 3 [Populus euphratica]
Length=632

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
              L AWPWENLG +KYLL GPL+ K +Y+   + S++D WCLHIL++   R  +HQLW+S
Sbjct  3    GPLSAWPWENLGIYKYLLYGPLLGKVLYTRTQEGSFKDDWCLHILIICIARAFLHQLWNS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFA-YMSFPFLG*SP  803
            + NMLF  R +R+++QG DF+QIDKEW WDNF++LQA++AS + Y+  PF+G  P
Sbjct  63   FVNMLFLTRTRRINRQGYDFKQIDKEWDWDNFILLQALIASISCYIYPPFIGNVP  117



>gb|KHG30512.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=627

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPWE+LG FKY+L GPL AK  YS +++++  +D+WC+HIL++  LRG +HQLWS
Sbjct  3    APLSAWPWEHLGIFKYILYGPLAAKAWYSWMYEDNILKDLWCIHILLICTLRGFIHQLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SY+NM F  R + + QQG+DF+QID EW WDNF+ILQA+LAS A + FP L   P
Sbjct  63   SYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQAMLASMACLIFPSLNTLP  117



>ref|XP_003549515.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
Length=632

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE--SWEDI-WCLHILVLTGLRGLVHQL  632
            A L AWP EN G +KYLL GP + K +Y   + E  S+ ++ WCLH+L+L+GLRGL+H L
Sbjct  3    APLSAWPLENFGTYKYLLYGPFVGKVLYEWFYGEEHSYYNLSWCLHLLILSGLRGLIHVL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            W SYS+M F  R +R+ Q+G+DF+QIDKEW WDNFLILQA++AS A   FPFL
Sbjct  63   WGSYSHMFFLTRNRRIVQKGVDFKQIDKEWDWDNFLILQALVASMACYMFPFL  115



>ref|XP_008794400.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=619

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW +LG +KYLL GPLIAK +YS  W++   D WCLH+L+L  LRG VHQLW S
Sbjct  3    ALLSSWPWNSLGVYKYLLYGPLIAKVMYSSAWEQGQPDRWCLHVLILCVLRGQVHQLWCS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
            + NMLF  R +RV   G+DF+QIDKEW WDNFLILQ+ + + A  SF
Sbjct  63   FGNMLFLTRRRRVLGDGVDFKQIDKEWDWDNFLILQSFIGALACHSF  109



>gb|KHN17538.1| Protein WAX2 [Glycine soja]
Length=632

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE--SWEDI-WCLHILVLTGLRGLVHQL  632
            A L AWP EN G +KYLL GP + K +Y   + E  S+ ++ WCLH+L+L+GLRGL+H L
Sbjct  3    APLSAWPLENFGTYKYLLYGPFVGKVLYEWFYGEEHSYYNLSWCLHLLILSGLRGLIHVL  62

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            W SYS+M F  R +R+ Q+G+DF+QIDKEW WDNFLILQA++AS A   FPFL
Sbjct  63   WGSYSHMFFLTRNRRIVQKGVDFKQIDKEWDWDNFLILQALVASMACYMFPFL  115



>ref|XP_010443488.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES-WEDIWCLHILVLTGLRGLVHQLWS  638
            A L  WPWEN GN KY+L GPL+A+ +YS  ++E   + +WCLHIL++ GL+ LVH+LWS
Sbjct  3    ALLSTWPWENFGNLKYILYGPLVAQVVYSWAYEEDITKALWCLHILIICGLKALVHELWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMSFPFL  791
             ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQAI+A    YMS P +
Sbjct  63   VFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIAGLICYMSPPLM  114



>ref|XP_011012180.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=527

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            AAL +WPW+NLG +KYLL GPL+AK +Y+ + + S++D WCLHIL++   R  +HQLWSS
Sbjct  3    AALSSWPWDNLGIYKYLLYGPLLAKVLYTRILEGSFKDDWCLHILIICVARSSLHQLWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFA-YMSFPFLG*SP  803
            Y NMLF    +R++Q G DF+QIDKEW WDNF++LQA++AS A Y+  PF+   P
Sbjct  63   YVNMLFLTCNRRINQHGYDFKQIDKEWDWDNFILLQALIASMACYIDQPFIENVP  117



>ref|NP_200588.2| protein ECERIFERUM 3 [Arabidopsis thaliana]
 sp|Q8H1Z0.1|CER3_ARATH RecName: Full=Protein ECERIFERUM 3; AltName: Full=Protein FACELESS 
POLLEN 1; AltName: Full=Protein WAX2; AltName: Full=Protein 
YORE-YORE [Arabidopsis thaliana]
 gb|AAN06975.1| cuticle protein [Arabidopsis thaliana]
 dbj|BAC81644.1| YORE-YORE protein [Arabidopsis thaliana]
 dbj|BAD06945.1| faceless pollen-1 [Arabidopsis thaliana]
 gb|AED96953.1| protein ECERIFERUM 3 [Arabidopsis thaliana]
Length=632

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI-WCLHILVLTGLRGLVHQLWS  638
            A L AWPWEN GN KYLL  PL A+ +YS V++E    + WC+HIL++ GL+ LVH+LWS
Sbjct  3    AFLSAWPWENFGNLKYLLYAPLAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHELWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMSFPFL  791
             ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQAI+ S   YMS P +
Sbjct  63   VFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLM  114



>ref|XP_009417462.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE-SWEDIWCLHILVLTGLRGLVHQLWS  638
            A L +WPW+NLG +KYLL GP+IAK I S  W+E S E  WCLH+++L  LRGL++QLW 
Sbjct  3    APLSSWPWQNLGAYKYLLYGPIIAKVISSRPWEEESKEGRWCLHLMILFALRGLMYQLWY  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            S+ NMLF  R +R+ + G+DF+QID+EWHWDNFLILQ ++ + A + FP L
Sbjct  63   SFGNMLFLVRRRRIFKDGVDFKQIDQEWHWDNFLILQCMIGALACLIFPSL  113



>ref|XP_002864528.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40787.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
Length=632

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI-WCLHILVLTGLRGLVHQLWS  638
            A L AWPWEN GN KY L  PL A+ +YS V++E    + WC+HIL++ GL+ LVH+LWS
Sbjct  3    ALLSAWPWENFGNLKYFLYAPLAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHELWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASF-AYMSFPFL  791
             ++NMLF  R  R++ +GIDF+QID EWHWDN++ILQAI+ S   YMS P +
Sbjct  63   VFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLM  114



>gb|KHG04939.1| Protein WAX2 [Gossypium arboreum]
Length=625

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M KK   L AWPWENLG+FKY++ GPL A  +YS ++++S++  WC+HIL++  LRG +H
Sbjct  1    MAKK--PLSAWPWENLGSFKYVIYGPLAANVMYSWIYEDSYKHPWCVHILIICALRGFMH  58

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            QLW+SY+NMLF     R+ QQG++F+QID EW WDNF++LQ +LA+ A + FP
Sbjct  59   QLWNSYNNMLFLGNC-RIKQQGVEFKQIDNEWDWDNFILLQGLLATMACLMFP  110



>ref|XP_010047031.1| PREDICTED: protein ECERIFERUM 3 [Eucalyptus grandis]
 gb|KCW78780.1| hypothetical protein EUGRSUZ_C00214 [Eucalyptus grandis]
Length=624

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  468  LFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYS  647
            L AWPWENLG FKYLL GP +A+ +YS + +++ +  WCLH+L++ GLR   H L+ ++ 
Sbjct  5    LSAWPWENLGIFKYLLYGPFLAQVLYSRMGEDTAKSSWCLHLLIIWGLRSFTHVLFGAFG  64

Query  648  NMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            NMLF N ++R+ +QG+DF+QID+EW WDNFLILQA +AS AY  FP L   P
Sbjct  65   NMLFLNLSRRIIKQGVDFKQIDREWDWDNFLILQAFVASMAYYIFPILADLP  116



>gb|KJB27032.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=625

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M KK   L AWPWENLG+FKY + GPL A  +YS ++++S++  WC+HIL++  LRG +H
Sbjct  1    MAKK--PLSAWPWENLGSFKYAMYGPLAATVMYSWIYEDSYKHPWCVHILIICALRGFMH  58

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            QLW+SY+NMLF     R+ QQG++F+QID EW WDNF++LQ +LA+ A + FP
Sbjct  59   QLWNSYNNMLFLGNC-RIKQQGVEFKQIDNEWDWDNFILLQGLLATMACLMFP  110



>ref|XP_009132107.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=631

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPW N GN KYLL  PL A+ +YSL ++E +    WCL++L++ GL+GLVH LWS
Sbjct  2    ATLSAWPWGNYGNLKYLLYAPLAAQVVYSLAYEEDYSRAFWCLNVLIICGLKGLVHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFP  785
            +Y+NMLF  R  R++ +G+DF+QID EW WDN+++LQAILAS   YMS P
Sbjct  62   TYNNMLFLTRTLRINPKGVDFKQIDHEWDWDNYILLQAILASMICYMSTP  111



>emb|CDX88639.1| BnaA03g10100D [Brassica napus]
Length=631

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPW N GN KYLL  PL A+ +YSL ++E +    WCL++L++ GL+GLVH LWS
Sbjct  2    ATLSAWPWGNYGNLKYLLYAPLAAQVVYSLAYEEDYSRAFWCLNVLIICGLKGLVHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFP  785
            +Y+NMLF  R  R++ +G+DF+QID EW WDN+++LQAILAS   YMS P
Sbjct  62   TYNNMLFLTRTLRINLKGVDFKQIDHEWDWDNYILLQAILASMICYMSTP  111



>ref|XP_002325096.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
 gb|EEF03661.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
Length=652

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
              L AWPWENLG +KYLL GPL+ K +Y+   + S++  WCLHIL++   R L+HQLW+S
Sbjct  3    GPLSAWPWENLGVYKYLLYGPLLGKVLYTRTQEGSFKGDWCLHILIICIARALLHQLWNS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFA-YMSFPFL  791
            + NMLF  R +R+++QG DF+QIDKEW WDNF++LQA++AS + Y+  PF+
Sbjct  63   FVNMLFLTRTRRINRQGYDFKQIDKEWDWDNFILLQALIASISCYIYPPFI  113



>ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3-like [Cucumis sativus]
 gb|KGN65271.1| hypothetical protein Csa_1G294020 [Cucumis sativus]
Length=625

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPWENLG FKYLL GPL+A  +Y+L  + +    WCLHIL+++ LR  +H +WSS
Sbjct  3    APLASWPWENLGMFKYLLYGPLLANGLYTLYEEGNIIHNWCLHILLISLLRVGIHVVWSS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            YSNMLF  R +R+ QQG+DF+QID EW WDNFL+LQA++ S     FP LG  P
Sbjct  63   YSNMLFLTRNRRILQQGVDFKQIDMEWEWDNFLLLQALMTSMMVYLFPSLGNLP  116



>emb|CDX88642.1| BnaA03g10070D [Brassica napus]
Length=637

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
            A L AWPW N GN KYLL   L A+ +YSL ++E +    WCL+IL+  GL+G+VH  WS
Sbjct  2    ATLSAWPWGNYGNLKYLLYAALAAQVVYSLAYQEDYSRAFWCLNILISCGLKGIVHVFWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
            SY+NMLF  R  R++  G+DF+QID EWHWDN+++LQA+LA+   YMS P +
Sbjct  62   SYNNMLFLTRTLRINPNGVDFKQIDHEWHWDNYILLQAVLATMICYMSPPLM  113



>ref|XP_010103144.1| Protein WAX2 [Morus notabilis]
 gb|EXB94909.1| Protein WAX2 [Morus notabilis]
Length=623

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  468  LFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYS  647
            L +WPWEN G +KYL+ GPL AK I+S++ +++ ++ WCLHI +L   R  ++QLW+SY+
Sbjct  6    LSSWPWENFGIYKYLVLGPLFAKCIHSIIDEKTQKESWCLHICLLYLFRCFLYQLWTSYT  65

Query  648  NMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            NMLF  R +RV QQG+DF+QIDKEW+WDNFLILQA+ A      FP L
Sbjct  66   NMLFLTRNRRVIQQGVDFKQIDKEWNWDNFLILQALFAFTGCYIFPSL  113



>emb|CDY50795.1| BnaCnng19590D [Brassica napus]
Length=630

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
             A  AWPW N GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ GL+G +H LWS
Sbjct  2    VAFSAWPWGNFGNLKYLLYAPLAAQVVYSWAYEQDYSRALWCLHILIICGLKGFLHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQAI+AS   YMS P +
Sbjct  62   VYNNMLWVSRTLRINPNGVDFKQIDHEWHWDNYILLQAIIASIICYMSLPLM  113



>ref|XP_009120299.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Brassica rapa]
Length=630

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
             A  AWPW N GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ GL+G +H LWS
Sbjct  2    VAFSAWPWGNFGNLKYLLYAPLAAQVVYSWAYEQDYSRALWCLHILIICGLKGFLHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQAI+AS   YMS P +
Sbjct  62   VYNNMLWASRTLRINPNGVDFKQIDHEWHWDNYILLQAIIASIICYMSLPLM  113



>ref|XP_009120300.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Brassica rapa]
Length=630

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
             A  AWPW N GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ GL+G +H LWS
Sbjct  2    VAFSAWPWGNFGNLKYLLYAPLAAQVVYSWAYEQDYSRALWCLHILIICGLKGFLHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQAI+AS   YMS P +
Sbjct  62   VYNNMLWASRTLRINPNGVDFKQIDHEWHWDNYILLQAIIASIICYMSLPLM  113



>emb|CDY51280.1| BnaA10g11680D [Brassica napus]
Length=630

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
             A  AWPW N GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ GL+G +H LWS
Sbjct  2    VAFSAWPWGNFGNLKYLLYAPLAAQVVYSWAYEQDYSRALWCLHILIICGLKGFLHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             Y+NML+ +R  R++  G+DF+QID EWHWDN+++LQAI+AS   YMS P +
Sbjct  62   VYNNMLWASRTLRINPNGVDFKQIDHEWHWDNYILLQAIIASIICYMSLPLM  113



>emb|CDY11847.1| BnaC03g12730D [Brassica napus]
Length=635

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
              L AWPW N GN KYLL  PL A+  YSL ++E +    WCL+IL++ GL+GLVH  WS
Sbjct  2    VTLSAWPWGNYGNLKYLLYAPLAAQVAYSLAYQEDYSRAFWCLNILIICGLKGLVHVFWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             Y+NML+ +R  R++ +G+DF+QID EWHWDN+++LQAILA+   YMS P +
Sbjct  62   VYNNMLWVSRMLRINPKGVDFKQIDHEWHWDNYILLQAILATMICYMSPPLM  113



>emb|CDP02895.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
            A L  WPWE LG+FKY+L GP +AK +++   +++  + +WCLHIL+L  LR  ++  W+
Sbjct  3    ALLSTWPWEGLGSFKYILYGPFLAKILHARHQEDTCSQALWCLHILILCVLRCFMYHSWT  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SYSNMLF  R +R+ ++G+DF+QIDKEW WDNF++LQA LA+  +  FPFL   P
Sbjct  63   SYSNMLFLTRNRRIIKEGVDFKQIDKEWDWDNFILLQAALATLIFYKFPFLADLP  117



>ref|XP_006401167.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
 dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42620.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
Length=631

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
            A+L AWPW N GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ G++G+VH LWS
Sbjct  3    ASLSAWPWGNFGNLKYLLYAPLAAQVVYSWSYEKDYSRALWCLHILIICGIKGVVHVLWS  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             + NML+ +R  R++ +G+DF+QID EWHWDN+++LQAI+AS   YMS P +
Sbjct  63   VFHNMLWSSRTLRINPKGVDFKQIDHEWHWDNYILLQAIIASMICYMSTPIM  114



>ref|XP_009132284.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=580

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
              L AWPW N GN KYLL  PL A+  YSL ++E +    WCL+IL++ GL+GLVH  WS
Sbjct  2    VTLSAWPWGNYGNLKYLLYAPLAAQVAYSLAYQEDYSRAFWCLNILIICGLKGLVHVFWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             Y+NML+ +R  R++ +G+DF+QID EW WDN+++LQAILA+   YMS P +
Sbjct  62   VYNNMLWVSRTLRINPKGVDFKQIDHEWDWDNYILLQAILATMICYMSPPLM  113



>emb|CDY02769.1| BnaC02g11200D [Brassica napus]
Length=630

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
              L  WPWE+ GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ GL+GLVH LWS
Sbjct  2    VTLSVWPWESYGNLKYLLYAPLAAQVVYSWTYEQDYSRALWCLHILIICGLKGLVHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMS  779
             Y+NML+  R  R++  G+D +QID EWHWDN++ILQAI+AS   YMS
Sbjct  62   VYNNMLWVTRTLRINPNGVDVQQIDHEWHWDNYIILQAIIASMICYMS  109



>ref|XP_009387454.1| PREDICTED: protein ECERIFERUM 3-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPWEN+G++KY+L GPL+AK   +  W++     W LH+L+L GLR L +QLW S
Sbjct  3    APLSSWPWENMGSYKYMLYGPLVAK--AACEWRDGRSVGWSLHLLILFGLRSLTYQLWYS  60

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
            ++NMLFF R +RV  +G+DF+QID EW+WDNFLILQA+L S
Sbjct  61   FTNMLFFTRKRRVINEGVDFKQIDNEWNWDNFLILQALLGS  101



>emb|CDX88640.1| BnaA03g10090D [Brassica napus]
Length=600

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
              L AWPW N GN KYLL  PL A+  YSL ++E +    WCL+IL++ GL+GLVH  WS
Sbjct  2    VTLSAWPWGNYGNLKYLLYAPLAAQVAYSLAYQEDYSRAFWCLNILIICGLKGLVHVFWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMSFPFL  791
             Y+NML+ +R  R++ +G+DF+QID EW WDN+++LQA LA+   YMS P +
Sbjct  62   VYNNMLWVSRTLRINPKGVDFKQIDHEWDWDNYILLQATLATMICYMSPPLM  113



>ref|XP_009387452.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPWEN+G++KY+L GPL+AK   +  W++     W LH+L+L GLR L +QLW S
Sbjct  3    APLSSWPWENMGSYKYMLYGPLVAK--AACEWRDGRSVGWSLHLLILFGLRSLTYQLWYS  60

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
            ++NMLFF R +RV  +G+DF+QID EW+WDNFLILQA+L S
Sbjct  61   FTNMLFFTRKRRVINEGVDFKQIDNEWNWDNFLILQALLGS  101



>ref|XP_009387453.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPWEN+G++KY+L GPL+AK   +  W++     W LH+L+L GLR L +QLW S
Sbjct  3    APLSSWPWENMGSYKYMLYGPLVAK--AACEWRDGRSVGWSLHLLILFGLRSLTYQLWYS  60

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
            ++NMLFF R +RV  +G+DF+QID EW+WDNFLILQA+L S
Sbjct  61   FTNMLFFTRKRRVINEGVDFKQIDNEWNWDNFLILQALLGS  101



>ref|XP_009387450.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPWEN+G++KY+L GPL+AK   +  W++     W LH+L+L GLR L +QLW S
Sbjct  3    APLSSWPWENMGSYKYMLYGPLVAK--AACEWRDGRSVGWSLHLLILFGLRSLTYQLWYS  60

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
            ++NMLFF R +RV  +G+DF+QID EW+WDNFLILQA+L S
Sbjct  61   FTNMLFFTRKRRVINEGVDFKQIDNEWNWDNFLILQALLGS  101



>emb|CDY32747.1| BnaA02g08090D [Brassica napus]
Length=630

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
              L  WPWE+ GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ GL+GLVH LWS
Sbjct  2    VTLSVWPWESYGNLKYLLYAPLAAQVVYSWTYEQDYSRALWCLHILIICGLKGLVHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMS  779
             Y+NML+  R  R++  G+D +QID EWHWDN+++LQAI+AS   YMS
Sbjct  62   VYNNMLWVTRTLRINPNGVDSKQIDHEWHWDNYILLQAIIASMICYMS  109



>gb|EYU37115.1| hypothetical protein MIMGU_mgv1a021583mg [Erythranthe guttata]
Length=609

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWK-ESWEDIWCLHILVLTGLRGLVHQLWS  638
            A LFAWPWE +G+ K ++ G  + K +YS+ ++ ES ++ WCLHI ++  LR  V+QLW+
Sbjct  3    APLFAWPWEFMGSSKIVIYGVFLGKAMYSIYYQQESMKESWCLHIFIICMLRLFVYQLWT  62

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            SYSNMLF NR + + ++G+DF+QIDKEWHWDNF++LQAI+A+     F  L   P
Sbjct  63   SYSNMLFLNRNRIIVKKGVDFKQIDKEWHWDNFILLQAIVAALVLNVFRTLEKEP  117



>ref|XP_009126813.1| PREDICTED: protein ECERIFERUM 3 [Brassica rapa]
Length=630

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLVHQLWS  638
              L  WPWE+ GN KYLL  PL A+ +YS  +++ +   +WCLHIL++ GL+GLVH LWS
Sbjct  2    VTLSVWPWESYGNLKYLLYAPLAAQVVYSWTYEQDYSRALWCLHILIICGLKGLVHVLWS  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS-FAYMS  779
             Y+NML+  R  R++  G+D +QID EWHWDN+++LQAI+AS   YMS
Sbjct  62   VYNNMLWVTRTLRINPNGVDSKQIDHEWHWDNYILLQAIIASMICYMS  109



>ref|XP_010278025.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
 ref|XP_010278026.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
Length=619

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A+L  WPWEN G +KYLL GPL+AK +YS ++++  +D+WCLHIL++  LR  + QLW S
Sbjct  3    ASLSTWPWENFGIYKYLLYGPLVAKVLYSYLYEDIQKDMWCLHILLICTLRAAMFQLWCS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
              NM F  + +R+ QQ  DF QID+EW+W+NFLIL A +A  A   FP L   P
Sbjct  63   VCNMYFLTKNRRIVQQCPDFNQIDREWNWENFLILHAWIAFMACYMFPSLTEIP  116



>ref|XP_010904609.1| PREDICTED: protein ECERIFERUM 3-like [Elaeis guineensis]
Length=617

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 2/110 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW NLG +KYLL GPL+ + ++S  W     +  CLH+L+L GLRGLV+   +S
Sbjct  3    APLSSWPWGNLGAYKYLLYGPLVTEALHS--WVNGTSNDRCLHLLILCGLRGLVYHFRTS  60

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +RV   G+DF+QID+EW WDNFLILQA++ + A+   P L
Sbjct  61   FSNMLFLTRTRRVITDGVDFKQIDREWDWDNFLILQALIGAIAFCFVPSL  110



>ref|XP_011070158.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=626

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L+AWPWE LG+ K  + G  +AK +YS   +ES +D W LHI ++  LR L++Q W+S
Sbjct  3    APLYAWPWEILGSCKIAIYGFFLAKALYSRYQEESMKDAWSLHIFIVCMLRLLMYQAWTS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            YSNMLFF R +++ ++G+DF QIDKEW WDNF++LQAI+A  A   FP
Sbjct  63   YSNMLFFTRNRQIVKKGVDFRQIDKEWDWDNFILLQAIVAGLALYIFP  110



>gb|AEQ39063.1| putative sterol desaturase [Wolffia arrhiza]
Length=287

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 77/109 (71%), Gaps = 9/109 (8%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            + L++WPWE+LG+ KY+L GPL+ K I+S          WC+H+++L  +RG +H  W S
Sbjct  3    SPLYSWPWESLGSCKYVLYGPLLGKAIHS---------SWCMHVVLLCAMRGFIHTAWCS  53

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPF  788
            + NML+  R +RV ++G+DF+QID+EWHWDNFL+LQA +   A+  FP+
Sbjct  54   FGNMLYITRNRRVIKEGVDFKQIDREWHWDNFLLLQAFIGVGAWYVFPY  102



>ref|XP_011079338.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=625

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L+AWPWE LG +KY + G  +AK +YS+  +E  ++ WCLHI VL  LR  ++Q W+S
Sbjct  3    APLYAWPWEFLGCYKYGIYGIFLAKGMYSMYQEEITKERWCLHIFVLCMLRLAMYQAWTS  62

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            YSNMLF  R + + ++G+DF+QIDKEWHWDNF++LQ I+A      FP
Sbjct  63   YSNMLFLTRNRIIVKKGVDFKQIDKEWHWDNFILLQGIVAFSVLYMFP  110



>ref|XP_003578148.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
 ref|XP_010238185.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=619

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG FKY L GPL+ K + S  W+    D W L +LVL  LR   +QLWSS
Sbjct  4    AFLSSWPWDNLGLFKYALYGPLVGKAVASRAWERGSPDQWLLLLLVLFTLRAFTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            YSNMLF  R +R+ + G+DF QIDKEW WDNFLILQ ++A+ A+ +FP L
Sbjct  64   YSNMLFLTRRRRIVRDGVDFAQIDKEWDWDNFLILQILMAATAFYAFPSL  113



>ref|XP_004973574.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=618

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            +  L +WPWENLG +KYLLC PL+AK +    W+    D WC  +L+L  LR   +  W 
Sbjct  2    EPPLASWPWENLGTYKYLLCAPLLAKAVGGRAWESGSPDRWCFLLLLLFVLRAATYHSWG  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
             +SNMLF NR + + + G+D+EQIDKEWHWDNFLILQ  LA+ A  +FP L
Sbjct  62   IFSNMLFLNRRRVIVRDGVDYEQIDKEWHWDNFLILQLWLAAMALYAFPSL  112



>ref|XP_009766364.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            +A L  WPW NLG+FKYLL GPL+AK++YS   +++ ++ WCLHIL++  LR  +H  W+
Sbjct  2    EAPLSTWPWGNLGSFKYLLYGPLLAKWLYSRYQEDNIKETWCLHILIICLLRSSMHHTWN  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAY  773
            ++S+MLF  R +R+++ G+ F+QID EW WDNF++L  I+ S  +
Sbjct  62   AFSSMLFLTRNRRINKDGVGFKQIDNEWDWDNFILLHGIMGSIVF  106



>ref|XP_002528208.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF34165.1| sterol desaturase, putative [Ricinus communis]
Length=578

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M K  A   +W WEN G FKYLL GPL+AK I++   +   +D W LHIL+++ LR LV+
Sbjct  1    MGKTVAPFSSWAWENFGLFKYLLYGPLLAKVIHTQTQELRLKDDWFLHILIISFLRSLVY  60

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
             LWS + +MLF    +R+++QG DF+QID+EW+WDNF++LQA++ S A   FP L
Sbjct  61   LLWSCFVSMLFLTYNRRINKQGYDFKQIDREWNWDNFVLLQALIGSMACYMFPSL  115



>ref|XP_009587593.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana tomentosiformis]
Length=628

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            +A L  WPW+NLG+FKYLL GPL+AK++YS   +++ ++ WCLHIL++  LR  +H  W+
Sbjct  2    EAPLSTWPWDNLGSFKYLLYGPLLAKWLYSRYQEDNIKETWCLHILIICLLRCSMHHTWN  61

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAY  773
            ++S MLF  R ++++++G+ F+QID EW WDNF++L  I+ S  +
Sbjct  62   TFSGMLFLTRNRQINKEGVGFKQIDNEWDWDNFILLHGIMGSLVF  106



>dbj|BAK02959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG FKY+L GPL+ K + S  W+ +  D W   +L L  LR   +QLWSS
Sbjct  4    AFLSSWPWDNLGFFKYVLYGPLVGKALASRAWEPASPDHWLCLLLALFALRAFTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            YSNMLF  R +R+ + G+DFEQIDKEW WDNFLILQ ++AS A  +FP L
Sbjct  64   YSNMLFLTRRRRIVRDGVDFEQIDKEWDWDNFLILQILMASTALYAFPSL  113



>ref|XP_006343719.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=630

 Score =   119 bits (298),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES--WEDIWCLHILVLTGLRGLVHQL  632
            +++L  WPW+ LG+FKYLL GP IAK+ YS   +E+   E  WC HIL++  LR  +H +
Sbjct  2    ESSLSTWPWDYLGSFKYLLYGPFIAKWFYSRSQEENNMKEATWCFHILIICLLRCTIHSV  61

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAY  773
            W+++SNMLF  R +R+ ++G+DF+Q+D EW WDNF++LQA++ S  +
Sbjct  62   WNTFSNMLFLTRNRRIIKEGVDFKQVDNEWDWDNFILLQAMIGSLGF  108



>ref|XP_004242647.1| PREDICTED: protein ECERIFERUM 3 [Solanum lycopersicum]
Length=630

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 80/109 (73%), Gaps = 3/109 (3%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKES--WEDIWCLHILVLTGLRGLVHQL  632
            +++L  WPW+ LG FKYLL GP IAK+ YS   +E+   E  WCLHIL++  LR  +H +
Sbjct  2    ESSLSTWPWDFLGRFKYLLYGPFIAKWFYSRSQEENNMKEATWCLHILIICLLRCTMHSV  61

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL-ASFAYM  776
            W+++SNMLF  R +R+ ++G+DF+Q+D EW WDNF+ILQA++ AS  YM
Sbjct  62   WNTFSNMLFLTRNRRIIKEGVDFKQVDNEWDWDNFIILQAMIGASGFYM  110



>gb|EAZ44800.1| hypothetical protein OsJ_29433 [Oryza sativa Japonica Group]
Length=621

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L  PL+ K +    W+ +  D W L +LVL G+R L +QLWSS
Sbjct  4    AFLSSWPWDNLGAYKYVLYAPLVGKAVAGRAWERASPDHWLLLLLVLFGVRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +R+ + G+DF QID+EW WDNFLILQ  +A+ A+ +FP L
Sbjct  64   FSNMLFATRRRRIVRDGVDFGQIDREWDWDNFLILQVHMAAAAFYAFPSL  113



>ref|NP_001063227.1| Os09g0426800 [Oryza sativa Japonica Group]
 dbj|BAD33619.1| putative Gl1 protein [Oryza sativa Japonica Group]
 dbj|BAF25141.1| Os09g0426800 [Oryza sativa Japonica Group]
 gb|EAZ09166.1| hypothetical protein OsI_31436 [Oryza sativa Indica Group]
Length=619

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L  PL+ K +    W+ +  D W L +LVL G+R L +QLWSS
Sbjct  4    AFLSSWPWDNLGAYKYVLYAPLVGKAVAGRAWERASPDHWLLLLLVLFGVRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +R+ + G+DF QID+EW WDNFLILQ  +A+ A+ +FP L
Sbjct  64   FSNMLFATRRRRIVRDGVDFGQIDREWDWDNFLILQVHMAAAAFYAFPSL  113



>gb|KDP38762.1| hypothetical protein JCGZ_04115 [Jatropha curcas]
Length=628

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +3

Query  477  WPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNML  656
            WPW+N G +KYLL GPL+A+ IYS + +  +++ WCL ILV+  LR LV+  + S  NML
Sbjct  10   WPWQNFGLYKYLLFGPLLARMIYSQINEGVFKNDWCLQILVICILRALVYFFYDSLVNML  69

Query  657  FFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            F    +R++ QG DF+QIDKEW WDN +ILQ ++AS A   FP
Sbjct  70   FLTSTRRINPQGYDFKQIDKEWEWDNLIILQGLIASLACYIFP  112



>gb|EPS72440.1| hypothetical protein M569_02318, partial [Genlisea aurea]
Length=394

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  504  KYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVS  683
            +YLL GPL+   +Y   +    +  WC  +LV+  LR LVHQ WSSYS MLF NR +R+ 
Sbjct  2    QYLLYGPLVVNVLYMNYYYGGGQQSWCFLVLVVLALRALVHQFWSSYSCMLFLNRTRRID  61

Query  684  QQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +QGI++ QID+EWHWD+FLILQ  +ASF YMS P L
Sbjct  62   EQGIEYSQIDEEWHWDDFLILQTGIASFLYMSSPPL  97



>gb|KJB27033.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=610

 Score =   113 bits (283),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  504  KYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVS  683
            KY + GPL A  +YS ++++S++  WC+HIL++  LRG +HQLW+SY+NMLF     R+ 
Sbjct  3    KYAMYGPLAATVMYSWIYEDSYKHPWCVHILIICALRGFMHQLWNSYNNMLFLGNC-RIK  61

Query  684  QQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            QQG++F+QID EW WDNF++LQ +LA+ A + FP
Sbjct  62   QQGVEFKQIDNEWDWDNFILLQGLLATMACLMFP  95



>ref|XP_008443806.1| PREDICTED: protein ECERIFERUM 3 [Cucumis melo]
Length=611

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  501  FKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRV  680
            FKYLL GPL+A  +Y+L  + +    WCLHIL+++ LR  +H +WSSYSNMLF  R +R+
Sbjct  2    FKYLLYGPLLANGLYTLYEEGNIIHNWCLHILLISLLRVGIHVVWSSYSNMLFLTRNRRI  61

Query  681  SQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
             QQG+DF+QID EW WDNFL+L+A++ S     FP LG  P
Sbjct  62   LQQGVDFKQIDMEWEWDNFLLLEALMTSMMVYLFPSLGNLP  102



>ref|XP_010687696.1| PREDICTED: protein ECERIFERUM 3 [Beta vulgaris subsp. vulgaris]
Length=623

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 73/110 (66%), Gaps = 2/110 (2%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWK-ESWEDIWCLHILVLTGLRGLVHQLW  635
             A    WPWENLG+ KYLL GP +A  +  L W  E+  + W  HIL+L  LR  V+QLW
Sbjct  2    SAPFVNWPWENLGSHKYLLYGPFVAH-VAQLWWTGEAIRNTWSFHILLLCSLRYTVYQLW  60

Query  636  SSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Y NM F +  +R++QQG+DF+Q+D EW+WDNF+ILQA++ S     FP
Sbjct  61   HTYCNMHFLSLERRINQQGVDFKQVDHEWNWDNFIILQALVGSLILYMFP  110



>ref|XP_004173838.1| PREDICTED: protein ECERIFERUM 3-like, partial [Cucumis sativus]
Length=392

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  504  KYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVS  683
            +YLL GPL+A  +Y+L  + +    WCLHIL+++ LR  +H +WSSYSNMLF  R +R+ 
Sbjct  2    QYLLYGPLLANGLYTLYEEGNIIHNWCLHILLISLLRVGIHVVWSSYSNMLFLTRNRRIL  61

Query  684  QQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            QQG+DF+QID EW WDNFL+LQA++ S     FP LG  P
Sbjct  62   QQGVDFKQIDMEWEWDNFLLLQALMTSMMVYLFPSLGNLP  101



>ref|XP_004956872.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=620

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L GPL+ K   S  W+ +  D W L +LVL GLR L +QLWSS
Sbjct  4    AFLASWPWDNLGFYKYVLYGPLVGKAAASRAWEAASPDRWILLLLVLFGLRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +R+ + G+DFEQIDKEW WDNFL+LQ ++ + A+ +FP L
Sbjct  64   FSNMLFATRRRRIVRDGVDFEQIDKEWDWDNFLMLQVLMTATAFYAFPSL  113



>emb|CDO98263.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI--WCLHILVLTGLRGLVHQLW  635
            A LFAWPWE+ GN+KYL    L+AK++Y     E   +   WCLHIL+L  LRGL++QLW
Sbjct  49   APLFAWPWEHYGNYKYLFYVALLAKYLYPTTTTEEGTEGSSWCLHILLLFLLRGLLYQLW  108

Query  636  SSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            SSY  M F NR +R+S++GIDF+QID EW+WDNFLIL AI+A  AY SFP L
Sbjct  109  SSYDYMFFLNRTRRISEEGIDFKQIDAEWNWDNFLILHAIVAVLAYWSFPSL  160



>gb|EYU34298.1| hypothetical protein MIMGU_mgv1a0095731mg [Erythranthe guttata]
Length=338

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
               L+AWPWE L ++KY + G L+AK +YS   +E  E+ W +HI +++ +R  ++Q  +
Sbjct  2    SPPLYAWPWEFLASYKYAIYGILVAKGLYSKYQEE--EESWGIHIFIISMVRLCLYQACT  59

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG  794
            SYSNMLF  R +R+  +G+ F QIDKEW WDNF++LQAI+AS     FP  G
Sbjct  60   SYSNMLFLTRNRRIVNKGVGFHQIDKEWRWDNFILLQAIVASVMVYIFPTSG  111



>gb|ADE75704.1| unknown [Picea sitchensis]
Length=623

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  456  KDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLW  635
            K   L  WPW  L + KY+L GPLIAK +++ ++     D WC HIL+LT LR + +QLW
Sbjct  4    KSCFLLDWPWAYLESLKYVLYGPLIAKAVHTNLYGGKEADNWCFHILLLTSLRYVTYQLW  63

Query  636  SSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPF  788
            +++SNM   +   ++ ++G +F+Q+D+EW WDNFL+LQA +A+ A+   PF
Sbjct  64   ATFSNMYCLSHRYKICKKGAEFDQMDREWDWDNFLLLQAFMATAAHHFLPF  114



>gb|KJB83324.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=595

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  570  EDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQ  749
            +D+WC+HIL++  LRGL+HQLWSSY+NM F  R + + QQG+DF+QID EW WDNF+ILQ
Sbjct  8    KDLWCIHILLICTLRGLIHQLWSSYNNMFFLTRNRWIKQQGVDFKQIDDEWDWDNFIILQ  67

Query  750  AILASFAYMSFPFLG*SP  803
            A+LAS A + FP L   P
Sbjct  68   AMLASMASLIFPSLNTLP  85



>ref|XP_004951702.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Setaria italica]
Length=626

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 5/104 (5%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
              L +WPW +LG +KY+L GPL+ K +    W+E        W LH+LVL  +RGL++Q 
Sbjct  3    PPLSSWPWASLGQYKYMLFGPLVWKVVQE--WREQGGLPLGSWWLHLLVLFAVRGLIYQF  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
            W +Y NMLFF R +RV   G+DF QID EW WDNFLILQ ++ +
Sbjct  61   WFTYGNMLFFTRRRRVVADGVDFRQIDAEWDWDNFLILQTLIGA  104



>ref|XP_009400348.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWS  638
            +A L +WPW NLG +KY+L GP++AK   +  W+E     W LH+L+L  LR LV+QLW 
Sbjct  2    EAPLASWPWGNLGVYKYVLYGPIVAK--AACEWREGRSGGWSLHLLLLFALRSLVYQLWF  59

Query  639  SYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            S+ NMLF  R +RV + G+DF+QIDKEW WDNFLILQA+L S    + P L
Sbjct  60   SFGNMLFLTRRRRVVEDGVDFKQIDKEWDWDNFLILQALLGSMVLYAAPSL  110



>gb|AGT16346.1| glossy1 protein [Saccharum hybrid cultivar R570]
 gb|AGT16349.1| glossy1 protein [Saccharum hybrid cultivar R570]
Length=622

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L  PL+ K + S  W+ +  D W L +L+L GLR L +QLWSS
Sbjct  4    ALLASWPWDNLGFYKYVLYAPLVGKAVASRAWEAASPDRWILLLLLLFGLRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            YSNMLF  R +RV + G+DF QIDKEW WDNFLIL  ++A+ A  +FP L
Sbjct  64   YSNMLFATRRRRVVRDGVDFHQIDKEWDWDNFLILHVLMAATALYAFPSL  113



>ref|XP_003563334.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 77/115 (67%), Gaps = 8/115 (7%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE---SWEDI---WCLHILVLTGLRGLV  623
            + L +WPW  LG++KYLL GP++AK + +  W++   SW  +   WC+H+++L  LR L 
Sbjct  3    SPLSSWPWAALGSYKYLLYGPVVAKAVQA--WRDEESSWSSLMESWCVHLVLLLALRSLT  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPF  788
            +QLW SY NMLF  R +RV   G+DF+QID EWHWDN +++Q ++ +    S PF
Sbjct  61   YQLWFSYGNMLFLTRRRRVVPDGVDFQQIDAEWHWDNMVMMQTLIGAMVMNSSPF  115



>gb|ACN25333.1| unknown [Zea mays]
 gb|ACN28101.1| unknown [Zea mays]
 gb|AFW70399.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=627

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 5/105 (5%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQ  629
               L +WPW +LG +KY+L GPL+ K +    W+E        W LH+L+L   RGL +Q
Sbjct  3    PPPLSSWPWASLGQYKYVLLGPLVWKVLQE--WREQAGLPLGSWWLHLLLLFAARGLTYQ  60

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
             W SY NMLFF R +RV   G+DF QID EW WDNFL+LQ ++ +
Sbjct  61   FWFSYGNMLFFTRRRRVVADGVDFRQIDAEWDWDNFLVLQTLIGA  105



>gb|KHG04940.1| Protein WAX2 [Gossypium arboreum]
Length=571

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +3

Query  531  AKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQI  710
            A  +YS ++++S++  WC+HIL++  LRG +HQLW+SY+NMLF     R+ QQG++F+QI
Sbjct  10   ANVMYSWIYEDSYKHPWCVHILIICALRGFMHQLWNSYNNMLFLGNC-RIKQQGVEFKQI  68

Query  711  DKEWHWDNFLILQAILASFAYMSFP  785
            D EW WDNF++LQ +LA+ A + FP
Sbjct  69   DNEWDWDNFILLQGLLATMACLMFP  93



>ref|XP_008643558.1| PREDICTED: uncharacterized protein LOC100280351 isoform X1 [Zea 
mays]
Length=747

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 5/105 (5%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQ  629
               L +WPW +LG +KY+L GPL+ K +    W+E        W LH+L+L   RGL +Q
Sbjct  123  PPPLSSWPWASLGQYKYVLLGPLVWKVLQE--WREQAGLPLGSWWLHLLLLFAARGLTYQ  180

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
             W SY NMLFF R +RV   G+DF QID EW WDNFL+LQ ++ +
Sbjct  181  FWFSYGNMLFFTRRRRVVADGVDFRQIDAEWDWDNFLVLQTLIGA  225



>ref|XP_004965700.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=622

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 77/114 (68%), Gaps = 5/114 (4%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
            + L +WPW +LG++KYLL GPL+AK  ++  W+E+     D WCLH+L+L  LR L  QL
Sbjct  3    SPLASWPWASLGSYKYLLYGPLVAKAAHA--WRETGSPPLDSWCLHLLLLLALRSLTFQL  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG  794
            W SY NMLFF R +RV + G+DF QID EW WDN +ILQ ++A+    S  F G
Sbjct  61   WFSYGNMLFFTRRRRVVKDGVDFRQIDAEWDWDNLVILQTLIAAMVANSPAFPG  114



>ref|XP_002451653.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
 gb|EES04629.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
Length=630

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 9/108 (8%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI-------WCLHILVLTGLRGL  620
            A L +WPW +LG++KY L GPL  K +    W+E  +         W LH+L+L  +RGL
Sbjct  3    APLSSWPWTSLGDYKYALLGPLAWKVVQE--WREQGQGALPLVLGSWWLHLLLLFVVRGL  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
             +Q W +Y NMLFF R +RV   G+DF QID EW WDNFL+LQ ++ +
Sbjct  61   TYQFWFTYGNMLFFTRRRRVVADGVDFRQIDAEWDWDNFLVLQTLIGA  108



>gb|AFW87578.1| hypothetical protein ZEAMMB73_499314, partial [Zea mays]
Length=431

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
            A L +WPW +LG++KYLL GPL+AK  ++  W+E+       WCLH+L+L  LR L  QL
Sbjct  3    APLASWPWASLGSYKYLLYGPLVAKVAHA--WRETGSLPLGSWCLHLLLLLALRSLTFQL  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPF  788
            W SY NMLFF R +RV + G+DF QID EW WDN +ILQ ++A+ A  S  F
Sbjct  61   WFSYGNMLFFTRRRRVVKDGVDFRQIDAEWDWDNMVILQTLVAAVAMGSAAF  112



>ref|XP_008658046.1| PREDICTED: uncharacterized protein LOC100192547 isoform X1 [Zea 
mays]
 gb|AFW87577.1| gl1 protein [Zea mays]
Length=622

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
            A L +WPW +LG++KYLL GPL+AK  ++  W+E+       WCLH+L+L  LR L  QL
Sbjct  3    APLASWPWASLGSYKYLLYGPLVAKVAHA--WRETGSLPLGSWCLHLLLLLALRSLTFQL  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPF  788
            W SY NMLFF R +RV + G+DF QID EW WDN +ILQ ++A+ A  S  F
Sbjct  61   WFSYGNMLFFTRRRRVVKDGVDFRQIDAEWDWDNMVILQTLVAAVAMGSAAF  112



>ref|NP_001266321.1| gl1 protein [Zea mays]
 gb|ACG43105.1| gl1 protein [Zea mays]
Length=622

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
            A L +WPW +LG++KYLL GPL+AK  ++  W+E+       WCLH+L+L  LR L  QL
Sbjct  3    APLASWPWASLGSYKYLLYGPLVAKVAHA--WRETGSLPLGSWCLHLLLLLALRSLTFQL  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPF  788
            W SY NMLFF R +RV + G+DF QID EW WDN +ILQ ++A+ A  S  F
Sbjct  61   WFSYGNMLFFTRRRRVVKDGVDFRQIDAEWDWDNMVILQTLVAAVAMGSAAF  112



>dbj|BAJ85064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=660

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE---SWEDIWCLHILVLTGLRGLVHQL  632
            + L +WPW  LG +KYLL GPL+A    +  W+E   +  D WCLH+L+L  LR L HQL
Sbjct  41   SPLSSWPWAGLGAYKYLLYGPLVAGVAQA--WREQGGAPTDSWCLHLLLLLALRSLTHQL  98

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMS--FP  785
            W SY+NMLFF R  RV   G+DF QID EW WDN +I+Q +L + A  S  FP
Sbjct  99   WFSYANMLFFTRRHRVVPDGVDFVQIDAEWDWDNMVIMQTLLGAMAISSPVFP  151



>ref|XP_009390985.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW +LG +KY+LCGPL+A  I +  W++     W LH+L+L  LR L +QLW S
Sbjct  3    APLSSWPWASLGIYKYVLCGPLVA--IAAREWRDGRAGGWWLHLLLLFVLRSLTYQLWYS  60

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            ++NMLF  R +RV + G++F+QID EW WDNFLILQA+L S      P
Sbjct  61   FANMLFLTRTRRVIKDGVEFKQIDSEWDWDNFLILQALLGSVVLCRAP  108



>ref|XP_006657201.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=623

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 75/113 (66%), Gaps = 7/113 (6%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKE-SWEDI---WCLHILVLTGLRGLVHQ  629
            + L +WPW  LG++KYLL GP++ K +    W+E  W  +   WCLH++VL  LR L +Q
Sbjct  3    SPLSSWPWAFLGSYKYLLYGPVVGKVVQE--WREQGWAGLGSSWCLHLVVLLALRSLTYQ  60

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPF  788
            LW SY NMLFF R +RV   G+DF QID EW WDN +I+Q ++A+ A +S P 
Sbjct  61   LWFSYGNMLFFTRRRRVVDVGVDFHQIDTEWDWDNMVIMQTLIAA-ALVSSPL  112



>ref|XP_002437383.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
 gb|EER88750.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
Length=623

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 12/118 (10%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI-------WCLHILVLTGLRGL  620
            A L +WPW +LG++KYLL GP++A+      W+E+   +       WCLH+L+L  LR L
Sbjct  3    APLASWPWASLGSYKYLLYGPVVAQ-----AWRETGSLLPLALGSSWCLHLLLLLALRSL  57

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG  794
              QLW SY NMLFF R +RV + G+DF QID EW WDN +ILQ ++A+    S  F G
Sbjct  58   TFQLWFSYGNMLFFTRRRRVVKDGVDFRQIDAEWDWDNMVILQTLIAAAVVGSPAFPG  115



>ref|XP_006646964.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=633

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 5/106 (5%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI---WCLHILVLTGLRGLVHQL  632
              L +WPW +LG++KY+L GP++ K      W+E        W LH+L+L   RGL +Q 
Sbjct  4    PPLSSWPWASLGSYKYVLYGPVVWKVAEE--WREQGAAPVGSWWLHLLLLFAARGLTYQF  61

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFA  770
            W SY NMLFF R +RV    +DF Q+D EW WDN ++LQ ++ + A
Sbjct  62   WFSYGNMLFFTRRRRVVPDSVDFRQVDAEWDWDNLVLLQTLIGATA  107



>gb|AAB87597.1| gl1 [Zea mays]
 tpg|DAA61564.1| TPA: glossy1 [Zea mays]
Length=319

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L GPL+ K + S  W+ +  D W L +L+L GLR L +QLWSS
Sbjct  4    ALLASWPWDNLGFYKYVLYGPLVGKAVASRAWEAASPDRWILLLLLLFGLRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +RV + G+DF+QIDKEW WDNFLIL A++A+ A  +FP L
Sbjct  64   FSNMLFATRRRRVVRDGVDFDQIDKEWDWDNFLILHALMAAAALCAFPSL  113



>tpg|DAA61565.1| TPA: glossy1 [Zea mays]
Length=278

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L GPL+ K + S  W+ +  D W L +L+L GLR L +QLWSS
Sbjct  4    ALLASWPWDNLGFYKYVLYGPLVGKAVASRAWEAASPDRWILLLLLLFGLRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +RV + G+DF+QIDKEW WDNFLIL A++A+ A  +FP L
Sbjct  64   FSNMLFATRRRRVVRDGVDFDQIDKEWDWDNFLILHALMAAAALCAFPSL  113



>gb|ACG36324.1| hypothetical protein [Zea mays]
Length=135

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (59%), Gaps = 5/97 (5%)
 Frame = +3

Query  459  DAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQ  629
               L +WPW +LG +KY+L GPL+ K +    W+E        W LH+L+L   RGL +Q
Sbjct  3    PPPLSSWPWASLGQYKYVLLGPLVWKVLQE--WREQAGLPLGSWWLHLLLLFAARGLTYQ  60

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFL  740
             W SY NMLFF R +RV   G+DF QID EW W   L
Sbjct  61   FWFSYGNMLFFTRRRRVVADGVDFRQIDAEWDWKKIL  97



>dbj|BAJ85039.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWC---LHILVLTGLRGLVHQL  632
              L +WPW +LG +KY L  PL+ K      W E          LH+L+L   RGL +Q 
Sbjct  3    PPLSSWPWASLGIYKYFLLAPLVWKVAQE--WTEQGGAPLGSRWLHLLLLFSARGLTYQF  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            W SYSNMLF  R +RV   G+DF Q+D EW WDNFL+LQ ++ + A ++ P L
Sbjct  61   WFSYSNMLFLTRRRRVVPDGVDFRQVDHEWDWDNFLVLQTLIGA-ALVNGPLL  112



>dbj|BAJ87617.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWC---LHILVLTGLRGLVHQL  632
              L +WPW +LG +KY L  PL+ K      W E          LH+L+L   RGL +Q 
Sbjct  3    PPLSSWPWASLGIYKYFLLAPLVWKVAQE--WTEQGGAPLGSRWLHLLLLFSARGLTYQF  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            W SYSNMLF  R +RV   G+DF Q+D EW WDNFL+LQ ++ + A ++ P L
Sbjct  61   WFSYSNMLFLTRRRRVVPDGVDFRQVDHEWDWDNFLVLQTLIGA-ALVNGPLL  112



>gb|EEC72610.1| hypothetical protein OsI_06088 [Oryza sativa Indica Group]
Length=628

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 17/110 (15%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWK--ESWED-------IWCLHILVLTGLR  614
              L +WPW +LG++KY+L G        ++VWK  E W          W LH+L+L   R
Sbjct  4    PPLSSWPWASLGSYKYVLYG--------AVVWKVAEEWRQQGAAPVGSWWLHLLLLFAAR  55

Query  615  GLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
            GL +Q W SY NMLFF R +RV    +DF Q+D EW WDNFL+LQ ++ +
Sbjct  56   GLTYQFWFSYGNMLFFTRRRRVVPDSVDFRQVDAEWDWDNFLLLQTLIGA  105



>ref|NP_001046080.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAD28002.1| putative glossy1 protein [Oryza sativa Japonica Group]
 dbj|BAF07994.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAG90034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 17/110 (15%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWK--ESWED-------IWCLHILVLTGLR  614
              L +WPW +LG++KY+L G        ++VWK  E W          W LH+L+L   R
Sbjct  4    PPLSSWPWASLGSYKYVLYG--------AVVWKVAEEWRQQGAAPVGSWWLHLLLLFAAR  55

Query  615  GLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
            GL +Q W SY NMLFF R +RV    +DF Q+D EW WDNFL+LQ ++ +
Sbjct  56   GLTYQFWFSYGNMLFFTRRRRVVPDSVDFRQVDAEWDWDNFLLLQTLIGA  105



>ref|XP_003570600.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 63/114 (55%), Gaps = 21/114 (18%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-------------DIWCLHILVL  602
             AL +WPW +LG +KY L  PL         WK + E             D W LH+L L
Sbjct  3    PALSSWPWASLGVYKYFLLAPL--------AWKAAQEWRGKQGGGAVLPVDSWWLHLLAL  54

Query  603  TGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILAS  764
               RGL +Q W SYS+MLF  R +RV   G+DF Q+D EW WDNFL+LQ ++ +
Sbjct  55   FWARGLTYQFWYSYSSMLFLTRRRRVVPDGVDFRQVDLEWDWDNFLLLQTLIGA  108



>ref|NP_001058237.1| Os06g0653000 [Oryza sativa Japonica Group]
 dbj|BAD37412.1| putative Gl1 [Oryza sativa Japonica Group]
 dbj|BAF20151.1| Os06g0653000 [Oryza sativa Japonica Group]
 gb|EEE66138.1| hypothetical protein OsJ_22195 [Oryza sativa Japonica Group]
Length=627

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 8/114 (7%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE----DIWCLHILVLTGLRGLVHQ  629
            + L +WPW  LG++KYLL GP++ K +    W+E         WCLH+++L  LR L +Q
Sbjct  7    SPLSSWPWAFLGSYKYLLYGPVVGKVVQE--WREQGRLPLGTSWCLHLILLLALRSLTYQ  64

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMS--FP  785
            LW SY NMLFF R +RV   G+DF QID EW WDN +I+Q ++A+    S  FP
Sbjct  65   LWFSYGNMLFFTRRRRVVDDGVDFRQIDTEWDWDNMVIMQTLIAAVLVTSRVFP  118



>ref|NP_001105247.1| glossy1 [Zea mays]
 gb|AAR97643.1| Gl1 protein [Zea mays]
Length=621

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L GPL+ K + S  W+ +  D W L +L+L GLR L +QLWSS
Sbjct  4    ALLASWPWDNLGLYKYVLYGPLVGKAVASRAWEAASPDRWILLLLLLFGLRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +RV + G+DF+QIDKEW WDNFLIL A++A+ A  +FP L
Sbjct  64   FSNMLFATRRRRVVRDGVDFDQIDKEWDWDNFLILHALMAAAALCAFPSL  113



>gb|AAR90847.1| glossy1 protein [Zea mays]
Length=621

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L GPL+ K + S  W+ +  D W L +L+L GLR L +QLWSS
Sbjct  4    ALLASWPWDNLGFYKYVLYGPLVGKAVASRAWEAASPDRWILLLLLLFGLRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +RV + G+DF+QIDKEW WDNFLIL A++A+ A  +FP L
Sbjct  64   FSNMLFATRRRRVVRDGVDFDQIDKEWDWDNFLILHALMAAAALCAFPSL  113



>tpg|DAA61563.1| TPA: glossy1 [Zea mays]
Length=621

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG +KY+L GPL+ K + S  W+ +  D W L +L+L GLR L +QLWSS
Sbjct  4    ALLASWPWDNLGFYKYVLYGPLVGKAVASRAWEAASPDRWILLLLLLFGLRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
            +SNMLF  R +RV + G+DF+QIDKEW WDNFLIL A++A+ A  +FP L
Sbjct  64   FSNMLFATRRRRVVRDGVDFDQIDKEWDWDNFLILHALMAAAALCAFPSL  113



>gb|EPS65188.1| hypothetical protein M569_09590, partial [Genlisea aurea]
Length=223

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = +3

Query  501  FKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRV  680
            F+ +L G L+A+ IYS       +  W LH+ +L  LR L+HQLWS+YSN LF    + +
Sbjct  1    FQIVLYGLLLARAIYSF----HQDCCWGLHVFLLCMLRLLMHQLWSAYSNTLFLTHNRLI  56

Query  681  SQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             ++G+ F QID+E HWDNF++LQAI+ S    +FP
Sbjct  57   LKKGVGFRQIDQELHWDNFILLQAIVTSVVLHAFP  91



>gb|EMS58990.1| Protein WAX2 [Triticum urartu]
Length=532

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSS  641
            A L +WPW+NLG FKY+L GPL+ K      W+ +  D W   +L L  LR L +QLWSS
Sbjct  4    AFLSSWPWDNLGFFKYVLYGPLVGKAWGGRAWEAASPDRWLCLLLALFALRALTYQLWSS  63

Query  642  YSNMLFFNRAKRVSQQGIDFEQIDKEWHW  728
            YSNMLF  R +R+ + G+DFEQIDKEW W
Sbjct  64   YSNMLFLTRRRRIVRDGVDFEQIDKEWDW  92



>gb|ACN25689.1| unknown [Zea mays]
 gb|AFW87576.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=635

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 75/125 (60%), Gaps = 18/125 (14%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE---DIWCLHILVLTGLRGLVHQL  632
            A L +WPW +LG++KYLL GPL+AK  ++  W+E+       WCLH+L+L  LR L  QL
Sbjct  3    APLASWPWASLGSYKYLLYGPLVAKVAHA--WRETGSLPLGSWCLHLLLLLALRSLTFQL  60

Query  633  WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHW-------------DNFLILQAILASFAY  773
            W SY NMLFF R +RV + G+DF QID EW               DN +ILQ ++A+ A 
Sbjct  61   WFSYGNMLFFTRRRRVVKDGVDFRQIDAEWDCWCASSDWLELLLRDNMVILQTLVAAVAM  120

Query  774  MSFPF  788
             S  F
Sbjct  121  GSAAF  125



>gb|EMT05456.1| Protein WAX2 [Aegilops tauschii]
Length=575

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 66/99 (67%), Gaps = 7/99 (7%)
 Frame = +3

Query  504  KYLLCGPLIAKFIYSLVWKE---SWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAK  674
            +Y+L GPL+AK      W+E   +  D WCLH+L+L  LR L+HQLW SY+NMLFF R +
Sbjct  8    RYVLYGPLVAKVAQE--WREQGGAPTDSWCLHLLLLLALRSLIHQLWFSYANMLFFTRRR  65

Query  675  RVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMS--FP  785
            RV   G+DF QID EW WDN +I+Q +L + A  S  FP
Sbjct  66   RVVPDGVDFHQIDAEWDWDNMVIMQTLLGAMAISSPLFP  104



>gb|EMT23422.1| Protein WAX2 [Aegilops tauschii]
Length=694

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 70/130 (54%), Gaps = 21/130 (16%)
 Frame = +3

Query  462  AALFAWPWENLGNFK----YLLCGPL--IAKFIY-SLVWKESWEDIWC-----------L  587
              L +WPW +LG +K    +LL  P   +  F+   LVWK + E  W            L
Sbjct  3    PPLSSWPWASLGIYKARTEHLLVHPYYRVNYFLLGPLVWKVAQE--WAEQGGAPLGSRWL  60

Query  588  HILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL-AS  764
            H+L+L   RGL +Q W SYSNMLF  R +RV   G+DF Q+D EW WDNFL+LQ ++ A+
Sbjct  61   HLLLLFSARGLTYQFWFSYSNMLFLTRRRRVVPDGVDFRQVDHEWDWDNFLVLQTLIGAA  120

Query  765  FAYMSFPFLG  794
                  P  G
Sbjct  121  LVNGPLPLPG  130



>gb|EMS47164.1| Protein WAX2 [Triticum urartu]
Length=710

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%), Gaps = 7/100 (7%)
 Frame = +3

Query  501  FKYLLCGPLIAKFIYSLVWKE---SWEDIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRA  671
             +Y+L GPL+A+   +  W+E   +  D WCLH+L+L  LR L HQLW SY+NMLFF R 
Sbjct  16   LQYVLYGPLVAQVAQA--WREQGGAPTDSWCLHLLLLLALRSLTHQLWFSYANMLFFTRR  73

Query  672  KRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMS--FP  785
            +RV   G+DF QID EW WDN +I+Q +L + A  S  FP
Sbjct  74   RRVVPDGVDFRQIDAEWDWDNMVIMQTLLGAMAISSPVFP  113



>gb|KDP34470.1| hypothetical protein JCGZ_12753 [Jatropha curcas]
Length=281

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K   L  WPW +LG+FKYL+ GP IA+ IYS   KE  E D++   I  +  LR L 
Sbjct  1    MASKPGILTEWPWRSLGSFKYLILGPWIAQSIYSFTVKEEKERDLFNFIIFPVLILRFLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILA  761
            +Q+W S+S  L     KR+  + I+FEQ+++E +WD+ +ILQ IL+
Sbjct  61   NQIWISFSRYLTAKGRKRIVDKDIEFEQLERESNWDDQIILQGILS  106



>ref|XP_002509294.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70552.1| predicted protein [Micromonas sp. RCC299]
Length=620

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  +    + +PWE++G+FKYLL  P +A     L       D W  H+LV+  +R +  
Sbjct  1    MALRPGPAYKFPWEDMGSFKYLLFVPFVATAALGL----DDADNWAYHMLVIAAIRYVHA  56

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG  794
            Q W S S +    +  ++  +GID++Q+D+E HWD+++ILQAI+ +  +   P+LG
Sbjct  57   QFWISLSRIHAVTQHTKIQAKGIDYKQVDREDHWDDYIILQAIIMTLVH-KMPYLG  111



>gb|AAA33934.1| lipid transfer protein, partial [Senecio odorus]
Length=524

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  579  WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            WC HILV++ LR  ++  +++  NMLF  R +R+  Q IDF QIDKEW+WDNF+ILQA++
Sbjct  9    WCFHILVISLLRFNLYMWYTNICNMLFLTRNRRILHQSIDFNQIDKEWNWDNFVILQALI  68

Query  759  ASFAYMSFP  785
            AS A   FP
Sbjct  69   ASLAIYMFP  77



>ref|XP_002973631.1| hypothetical protein SELMODRAFT_99824, partial [Selaginella moellendorffii]
 gb|EFJ25291.1| hypothetical protein SELMODRAFT_99824, partial [Selaginella moellendorffii]
Length=226

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS--LVWKESWEDIWCLHILVLTGLRGL  620
            M    A L  WPWE LGN KY++  P +AK  +S     + S  D W  H+++L  LR L
Sbjct  1    MGVSTAPLADWPWETLGNLKYIMFAPFVAKAAHSHFFAARHSSTDSWWFHLVLLVFLRYL  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
              Q W + S + F  +  ++ Q  + +EQ+D+E+H DN +I Q++  + A++  P
Sbjct  61   QQQAWITVSRLYFLVKKYQIQQFALSYEQVDREFHCDNHMIFQSLALAAAHVWIP  115



>ref|XP_002960347.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
 gb|EFJ37886.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
Length=626

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI--WCLHILVLTGLRGLVHQLW  635
            A L +WPW  LGN+KY +  P  A+ +Y+  +  +++D   WCLHI VL  +R       
Sbjct  7    APLSSWPWTFLGNYKYWISVPFAARALYANFYNAAYKDTDNWCLHIFVLCLIRYQTFFYA  66

Query  636  SSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAY  773
            S + ++    +  RVS   I FEQ+D+E+HWDNF+ILQ ++A  A+
Sbjct  67   SLFQHLHGVVKKHRVSAFKITFEQLDREFHWDNFIILQGLIALAAH  112



>ref|XP_002967368.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
 gb|EFJ31967.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
Length=626

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  462  AALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDI--WCLHILVLTGLRGLVHQLW  635
            A L +WPW  LGN+KY +  P  A+ +Y+  +  +++D   WCLHI VL  +R       
Sbjct  7    APLSSWPWTFLGNYKYWISVPFAARALYANFYNAAYKDTDNWCLHIFVLCLIRYQTFFYA  66

Query  636  SSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAY  773
            S + ++    +  RVS   I FEQ+D+E+HWDNF+ILQ ++A  A+
Sbjct  67   SLFQHLHGVVKKHRVSAFKITFEQLDREFHWDNFIILQGLIALAAH  112



>ref|XP_001781794.1| predicted protein [Physcomitrella patens]
 gb|EDQ53442.1| predicted protein [Physcomitrella patens]
Length=625

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K+A L  WPWE LG+FKYL+  P + + + ++++    E D W +H+  L   R   
Sbjct  1    MVAKEAFLAEWPWERLGHFKYLVYAPFVGRLLQTIIYGTGLEPDNWAMHMFFLMVARYFH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             QLW S S + +      V ++   +EQ+D+E+H DN L+LQ I  S A+  FP
Sbjct  61   QQLWVSASRVPWLTEKFVVDERQSGYEQVDREYHSDNHLMLQLIFISVAHSWFP  114



>ref|XP_002964260.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
 gb|EFJ34593.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
Length=615

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLV  623
            M      L  WPWE LG+FKYLL  PL+A  + S +  E    D + LHILVL  LR + 
Sbjct  1    MAINPGLLTHWPWERLGSFKYLLYLPLVANAVRSAMTPEGRSRDNFSLHILVLAALRYIQ  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             QLW + +++    +  +V  +G+ F+Q+D+E  W++F++LQA++
Sbjct  61   GQLWITVTSVHDIVKKHQVQTKGMKFDQLDRERDWEDFILLQALM  105



>ref|XP_009760059.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Nicotiana sylvestris]
Length=618

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWK--ESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW  LGNFKYLL  P +   IYS +    ES  DI  + IL     R +
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
             +Q+W+S S         R+  + I+F+Q+D+E +WD+ +IL  ++   AY+ F
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKF  114



>ref|XP_009760057.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=623

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWK--ESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW  LGNFKYLL  P +   IYS +    ES  DI  + IL     R +
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
             +Q+W+S S         R+  + I+F+Q+D+E +WD+ +IL  ++   AY+ F
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKF  114



>ref|XP_009760058.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=622

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWK--ESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW  LGNFKYLL  P +   IYS +    ES  DI  + IL     R +
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
             +Q+W+S S         R+  + I+F+Q+D+E +WD+ +IL  ++   AY+ F
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKF  114



>ref|XP_002989550.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
 gb|EFJ09426.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
Length=621

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESW-EDIWCLHILVLTGLRGLV  623
            M      L  WPWE LG+FKYLL  PL+A  + S +  E    D + LHILVL  LR + 
Sbjct  1    MAINPGLLTHWPWERLGSFKYLLYLPLVANAVRSAMTPEGRSRDNFSLHILVLAALRYIQ  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             QLW + +++    +  +V  +G+ F+Q+D+E  W++F++LQA++
Sbjct  61   GQLWITVTSVHDIVKKHQVQTKGMKFDQLDRERDWEDFILLQALM  105



>ref|XP_003061467.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54097.1| predicted protein [Micromonas pusilla CCMP1545]
Length=628

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 5/116 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K    + +PWE++G FKYLL  P +A    ++       D WC H+L +  +R +  
Sbjct  1    MALKPGFGYKFPWEDMGTFKYLLFVPFVA----TVALGRDDADDWCWHMLAIAAVRYVHS  56

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG  794
            Q W S S +    +  ++  +GID++QID+E HWD+++ILQ I+ +  +   P LG
Sbjct  57   QFWISLSRVHAVTQHTKIQAKGIDYKQIDREDHWDDYIILQLIVMTLVHKC-PGLG  111



>ref|XP_003625024.1| Protein WAX2 [Medicago truncatula]
 gb|ABN07985.1| Sterol desaturase [Medicago truncatula]
 gb|AES81242.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 2/113 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPWE LG+FK+++  P IA  IY+ +W E   D     I     +R L +
Sbjct  1    MASKPGILTNWPWEPLGSFKFVIVIPWIAHSIYTFIWGE--RDPVYYIIFPFALVRMLHN  58

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            Q+W+S S         R+  +G++FEQ+D+E HWD+ ++   ++   AY  FP
Sbjct  59   QIWTSVSRYQTAKGKNRIVDKGLEFEQVDRETHWDDQMLFTVLVYCIAYFIFP  111



>gb|EEE56435.1| hypothetical protein OsJ_05611 [Oryza sativa Japonica Group]
Length=550

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  579  WCLHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            W LH+L+L   RGL +Q W SY NMLFF R +RV    +DF Q+D EW WDNFL+LQ ++
Sbjct  29   WWLHLLLLFAARGLTYQFWFSYGNMLFFTRRRRVVPDSVDFRQVDAEWDWDNFLLLQTLI  88

Query  759  AS  764
             +
Sbjct  89   GA  90



>gb|EAZ01917.1| hypothetical protein OsI_23945 [Oryza sativa Indica Group]
Length=631

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = +3

Query  507  YLLCGPLIAKFIYSLVWKESWE----DIWCLHILVLTGLRGLVHQLWSSYSNMLFFNRAK  674
            YLL GP++ K +    W+E         WCLH+++L  LR L +QLW SY NMLFF R +
Sbjct  14   YLLYGPVVGKVVQE--WREQGRLPLGTSWCLHLILLLALRSLTYQLWFSYGNMLFFTRRR  71

Query  675  RVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMS--FP  785
            RV   G+DF QID EW WDN +I+Q ++A+    S  FP
Sbjct  72   RVVDDGVDFRQIDTEWDWDNMVIMQTLIAAVLVTSRVFP  110



>ref|XP_009625188.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=626

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 60/114 (53%), Gaps = 2/114 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVW--KESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW  LGNFKYLL  P +   IYS      ES  DI  + IL L   R +
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFFMGKDESQRDIAYIIILPLLLSRVI  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
             +Q+W S S         R+  + I+F+Q+D+E +WD+ +IL  ++   AY+ F
Sbjct  61   HNQIWISLSRYRTTKGDNRILDKSIEFDQVDRERNWDDQIILNGMVFYVAYLKF  114



>gb|EMS51792.1| Protein WAX2 [Triticum urartu]
Length=423

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLT--GLRGL  620
            M  +   L  WPW+ +GNFKYL+  P++    Y ++ K  W DI   + L+L    LR +
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMTK-GWGDIDLAYSLILPSLALRMI  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  +GI+FEQ+D+E  WD+ ++   +L    Y++ P
Sbjct  60   HNQIWISLSRYQTARSKHRIVDRGIEFEQVDRERGWDDQIVFNGLLFYAGYLAMP  114



>ref|XP_010324966.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum lycopersicum]
Length=626

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 2/114 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS--LVWKESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW +LGNFKYL+  P +   IYS  +  +ES  D   + I +   +R +
Sbjct  1    MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
             HQ+W S S         R+  + I+F+Q+D+E +WD+ +I   +    AY+ F
Sbjct  61   HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKF  114



>dbj|BAJ85405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLT--GLRGL  620
            M  +   L  WPW+ +GNFKYL+  P++    Y  V  + W DI   + L+L    LR +
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYR-VMNKGWGDIDLAYALILPSLALRMI  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  +GI+F+Q+D+E  WD+ ++   +L    Y++ P
Sbjct  60   HNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIVFNGLLFYVGYLAIP  114



>ref|XP_004229695.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum lycopersicum]
Length=625

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 2/114 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS--LVWKESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW +LGNFKYL+  P +   IYS  +  +ES  D   + I +   +R +
Sbjct  1    MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
             HQ+W S S         R+  + I+F+Q+D+E +WD+ +I   +    AY+ F
Sbjct  61   HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKF  114



>ref|XP_002454185.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
 gb|EES07161.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
Length=619

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  +   L  WPW+ LGNFKYL+ GP++      +V +  W DI     L+L  L  R  
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMGPVVVDGARRVVAR-GWGDIDLAFALILPSLLLRMA  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S +         R+  +GI+FEQ+D+E  WD+ +IL  +L    Y++ P
Sbjct  60   HNQIWISAARYQTARSKHRIVDRGIEFEQVDRERGWDDQIILNGLLFYAGYLAIP  114



>gb|AFW72383.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=172

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  +   L  WPW+ LGNFKYL+  P+       +V    W DI     L+L  L  R +
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVV-ARGWGDIDLAFALILPSLLLRMV  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S +         R+  +GI+F+Q+D+E  WD+ +IL  +L    Y++ P
Sbjct  60   HNQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIP  114



>ref|XP_002975687.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
 gb|EFJ23316.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
Length=628

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 2/115 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS--LVWKESWEDIWCLHILVLTGLRGL  620
            M    A L  WPWE LGN KY++  P +AK  +S     + S  D W  H+++L  LR L
Sbjct  1    MGVSTAPLADWPWETLGNLKYIMFAPFVAKAAHSHFFAARHSSTDSWWFHLVLLVLLRYL  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
              Q W + S + F  +  ++ Q  + +EQ+D+E+H DN +I Q++  + A++  P
Sbjct  61   QQQAWITVSRLYFLVKKYQIQQFALSYEQVDREFHCDNHMIFQSLALAAAHVWIP  115



>gb|KHG15491.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=612

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+FKY+L  PLI + IYS + K+   D+  L +      R L +
Sbjct  1    MASKPGILTDWPWKPLGSFKYILLVPLITEHIYSFMEKDEDIDVSKLVLFPFMLWRMLHN  60

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            QLW S S  L      ++  +GI+F+Q+D+E  WD+ ++  AIL
Sbjct  61   QLWISLSRYLTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAIL  104



>ref|NP_001169009.1| hypothetical protein [Zea mays]
 gb|ACN31395.1| unknown [Zea mays]
 gb|AFW72381.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=174

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  +   L  WPW+ LGNFKYL+  P+       +V    W DI     L+L  L  R +
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVV-ARGWGDIDLAFALILPSLLLRMV  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S +         R+  +GI+F+Q+D+E  WD+ +IL  +L    Y++ P
Sbjct  60   HNQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIP  114



>ref|XP_002464501.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
 gb|EER91499.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
Length=619

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 65/112 (58%), Gaps = 4/112 (4%)
 Frame = +3

Query  459  DAALFA-WPWENLGNFKYLLCGPLIAKFIYSLVWKESWE--DIWCLHILVLTGLRGLVHQ  629
            +  LF  WPW+ LGNFKYLL  P +A  +Y LV  + W+  D+  + I     LR L +Q
Sbjct  4    NPGLFTEWPWKKLGNFKYLLVAPWVAHGVY-LVATKGWKAADLGYMAIFPSLLLRMLQNQ  62

Query  630  LWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            +W + S +      +++  +GI+FEQ+D+E +WD+ ++L  IL    +M  P
Sbjct  63   VWITVSRLQNARGRRQIVDRGIEFEQVDRERNWDDQILLSGILMYLGFMYIP  114



>gb|EMS58602.1| Protein WAX2 [Triticum urartu]
Length=222

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = +3

Query  459  DAALFA-WPWENLGNFKYLLCGPLIAKFIYSLV---WKESWEDIWCLHILVLTGLRGLVH  626
            +  LF+ WPW+ LG+FKY++  P +A  I  +    W+E+  D+  L IL    LRGL +
Sbjct  4    NPGLFSEWPWKMLGSFKYVVLAPWVAHGIQQVATKGWREA--DLGYLVILPSMILRGLHN  61

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            Q W + S +      +++  +GI+FEQID+E +WD+ +IL AIL     +  P
Sbjct  62   QAWITVSRLQNARGKRQIVDRGIEFEQIDRERNWDDQIILSAILLFLGALHLP  114



>ref|XP_003575378.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  +   L  WPW+ LGNFKYL+  P++    + ++ K  W DI   + L+L  L  R +
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVVVHGAHRVMTK-GWGDIDLAYALILPSLLLRMI  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  +GI+F+Q+D+E  WD+ +I   +L    Y++ P
Sbjct  60   HNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIIFNGLLFYAGYLAMP  114



>ref|XP_010255639.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nelumbo nucifera]
Length=654

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 5/118 (4%)
 Frame = +3

Query  408  NGAVHKEEEGNTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWC  584
            N   H+EE     M      L +WPW+ LG+FKY++  P +A  IYS V K+  + D+  
Sbjct  85   NFEAHQEET----MATTPGPLTSWPWQKLGSFKYVVLAPWVAHSIYSFVTKDPKDRDLTN  140

Query  585  LHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            L IL     R + HQ W + +         R+  +GI+FEQ+D+E +WD+ ++L  IL
Sbjct  141  LLILPYLLWRLVHHQAWITLARHQTAKSKHRILDKGIEFEQVDRERNWDDLILLNGIL  198



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 5/118 (4%)
 Frame = +3

Query  408  NGAVHKEEEGNTLMRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWC  584
            N   H+EE     M      L +WPW+ LG+FKY++  P +A  IYS V K+  + D+  
Sbjct  85   NFEAHQEET----MATTPGPLTSWPWQKLGSFKYVVLAPWVAHSIYSFVTKDPKDRDLTN  140

Query  585  LHILVLTGLRGLVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            L IL     R + HQ W + +         R+  +GI+FEQ+D+E +WD+ ++L  IL
Sbjct  141  LLILPYLLWRLVHHQAWITLARHQTAKSKHRILDKGIEFEQVDRERNWDDLILLNGIL  198



>ref|XP_002990278.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
 gb|EFJ08693.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
Length=620

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = +3

Query  468  LFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYS  647
            L  WPW+ +G +KY L  P+     +S     S  D WC HILV+  LR  ++Q WSS++
Sbjct  7    LGCWPWQRMGTYKYHLFLPIFLSAAHSHYLGTSPRDNWCFHILVIAALRYTLYQAWSSFA  66

Query  648  NMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILA  761
             +    +  ++    + +EQ+D+E+  DN +IL ++LA
Sbjct  67   RLHAVVKHHQIISYALTYEQVDREFDCDNGIILHSLLA  104



>ref|XP_006354678.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 58/114 (51%), Gaps = 2/114 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVW--KESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW +LGN KYL+  P +   IYS     +ES  D   + I     +R +
Sbjct  1    MATKPGILTEWPWASLGNLKYLVLAPFVGHSIYSFFMGKEESQRDFSYIFIFFYIVMRMV  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSF  782
             HQ+W S S         R+  + I+F+Q+D+E +WD+ +IL  ++    Y+ F
Sbjct  61   HHQMWISLSRYRTAKGDNRILDRSIEFDQVDRETNWDDQIILNGVVFYIGYLKF  114



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 3/106 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M      L  WPW+ LGNFKYL+  P +A  IYS V K   +  W  ++L+   L  R L
Sbjct  1    MATTPGPLTNWPWQKLGNFKYLVLAPWVAHSIYSFVSKGPKDGDWT-NLLIFPYLLWRML  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             HQ W + +         R+  +GI+FEQ+D+E +WD+ ++L  IL
Sbjct  60   HHQAWITLARYQTAKSKHRILDRGIEFEQVDRERNWDDLILLNGIL  105



>ref|XP_002961424.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
 gb|EFJ36684.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
Length=620

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = +3

Query  468  LFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVHQLWSSYS  647
            L  WPW+ +G +KY L  P+     +S     S  D WC HILV+  LR  ++Q WSS++
Sbjct  7    LGCWPWQRMGTYKYHLFLPIFLSAAHSHYLGTSPRDNWCFHILVIAALRYALYQAWSSFA  66

Query  648  NMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILA  761
             +    +  ++    + +EQ+D+E+  DN +IL ++LA
Sbjct  67   RLHAVVKHHQIISYALTYEQVDREFDCDNGIILHSLLA  104



>gb|ACA14353.1| TCER1 [Triticum aestivum]
Length=619

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLT--GLRGL  620
            M  +   L  WPW+ +GNFKYL+  P++    Y  V  + W DI   + L+L    LR +
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYR-VMNKGWGDIDLAYSLILPSLALRMI  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W   S         R+  +GI+F+Q+D+E  WD+ ++   +L    Y++ P
Sbjct  60   HNQIWIGLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIVFNGLLFYVGYLAMP  114



>gb|ABD28319.2| Sterol desaturase [Medicago truncatula]
Length=493

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 61/113 (54%), Gaps = 2/113 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+FK+++  P IA  +YS +W E   D     I     +R L +
Sbjct  10   MASKPGILTDWPWKPLGSFKFMILSPWIAHSMYSFIWGE--RDPVYHVIFPFMLIRMLHN  67

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            Q+W S S         ++  +G++FEQ+D+E +WD+ ++  A++    YM FP
Sbjct  68   QIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFP  120



>emb|CBI16764.3| unnamed protein product [Vitis vinifera]
Length=246

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LG+FKY++  P +   IYSL+ K+  E    +++L    L  R L
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYSLIIKDGKERD-PVYVLFFPFLLWRTL  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P
Sbjct  60   HNQIWISLSRYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILP  114



>ref|XP_006647531.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=619

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  +   L  WPW+ LGNFKY++  P++    + +V K  W DI   + L+L  L  R +
Sbjct  1    MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGAHRVVSK-GWGDIDLAYSLILPSLLLRMI  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  +GI+F+Q+D+E  WD+ ++   +L    Y++ P
Sbjct  60   HNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLLFYVGYLAMP  114



>gb|EMT33049.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLT--GLRGL  620
            M  +   L  WPW+ +GNFKYL+  P++    Y  V  + W DI   + L+L    LR +
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYR-VMNKGWGDIDLAYSLILPSLALRMI  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  + I+FEQ+D+E  WD+ ++   +L    Y++ P
Sbjct  60   HNQIWISLSRYQTARSKHRIVDRDIEFEQVDRERGWDDQIVFNGLLFYVGYLAMP  114



>ref|XP_003625020.1| Protein WAX2 [Medicago truncatula]
 gb|AES81238.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 61/113 (54%), Gaps = 2/113 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+FK+++  P IA  +YS +W E   D     I     +R L +
Sbjct  1    MASKPGILTDWPWKPLGSFKFMILSPWIAHSMYSFIWGE--RDPVYHVIFPFMLIRMLHN  58

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            Q+W S S         ++  +G++FEQ+D+E +WD+ ++  A++    YM FP
Sbjct  59   QIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFP  111



>ref|XP_003081883.1| faceless pollen-1 (ISS) [Ostreococcus tauri]
Length=675

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  +    + +PW N+G  KY +  P    F+ ++   +   D +C H+L +   R +  
Sbjct  55   MATRPGVWYDFPWANVGALKYAVFAP----FVLAVALGKDDADSFCWHLLAIAAARYVNA  110

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            QLW S S +  + R  R+  +GIDF+Q+D+E HWD++++LQ ++
Sbjct  111  QLWISLSRVHAWTRNTRIQAKGIDFKQVDREDHWDDYILLQTLV  154



>ref|XP_010255640.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=627

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 57/114 (50%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K   L  WPW+ LGNFKY++  P +   IY  V K+  E D+  L        R L 
Sbjct  1    MASKPGPLTNWPWQKLGNFKYVVLAPWVVHSIYQFVTKDENERDVGYLLTFPFLLSRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             QLW S +         R+  +GI+FEQ+D+E +WD+ +IL  I+       FP
Sbjct  61   SQLWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGIVNYIIPQIFP  114



>emb|CEF99557.1| Uncharacterised domain Wax2, C-terminal [Ostreococcus tauri]
Length=621

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  +    + +PW N+G  KY +  P    F+ ++   +   D +C H+L +   R +  
Sbjct  1    MATRPGVWYDFPWANVGALKYAVFAP----FVLAVALGKDDADSFCWHLLAIAAARYVNA  56

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            QLW S S +  + R  R+  +GIDF+Q+D+E HWD++++LQ ++
Sbjct  57   QLWISLSRVHAWTRNTRIQAKGIDFKQVDREDHWDDYILLQTLV  100



>ref|XP_007041185.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOX97016.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=612

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LGNFKY +  P +    YSL+  +  ++    + L+   L  R L
Sbjct  1    MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLMSKGEKEANLTYHLIFPFLMTRVL  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  +GIDFEQ+D+E +WD+ +IL  IL     M  P
Sbjct  61   HNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMP  115



>ref|XP_002265189.2| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI16762.3| unnamed protein product [Vitis vinifera]
Length=619

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGL--RG  617
            M  K   L  WPW  LGNFKY++  P     IYS V K+  E DI   H L+   L  R 
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIYSFVVKDEKERDI--SHFLIFPFLLWRM  58

Query  618  LVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            L +QLW S S         R+  +GI+FEQ+D+E +WD+ +I   I+    Y + P
Sbjct  59   LHNQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYITYFTVP  114



>gb|KJB67450.1| hypothetical protein B456_010G191300 [Gossypium raimondii]
Length=671

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSL-VWKESWEDIWCLHILVLTGLRGLV  623
            M  +   L  WPW+ LG+FKY++  P I + IYS+ V  E   D++ L IL L   R L 
Sbjct  48   MASEPGILTDWPWKPLGSFKYIILAPWITESIYSIIVGDEKGWDVFNLTILPLMLWRMLH  107

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             QLW S S         R+  +GI+F+Q+D+E +WD+ ++  AI+       FP
Sbjct  108  SQLWISLSRYRTAKGTNRIVDKGIEFDQVDRERNWDDQILFNAIIFYLGNKYFP  161



>ref|XP_009586962.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=617

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M      L  WPW++LG+FKY++  P IA  +Y L  KE  E D   L IL     R L 
Sbjct  1    MATTPGFLTDWPWKHLGSFKYVILAPWIAHSVYCLATKEQHETDSTNLLILPFLLSRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            +QLW S+S         R+  +GI+F+Q+D+E +WD+ +IL  IL
Sbjct  61   NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGIL  105



>ref|XP_007041186.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX97017.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=620

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LGNFKY +  P +    YSL+  +  ++    + L+   L  R L
Sbjct  1    MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLMSKGEKEANLTYHLIFPFLMTRVL  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  +GIDFEQ+D+E +WD+ +IL  IL     M  P
Sbjct  61   HNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMP  115



>gb|KJB76287.1| hypothetical protein B456_012G081500 [Gossypium raimondii]
Length=631

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+FKY++  PLI + IYS + K+   D+  L +      R L +
Sbjct  8    MASKPGILTDWPWKPLGSFKYIILVPLITEHIYSFMVKDEDIDVSKLALFPFVLWRMLHN  67

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            QLW S S         ++  +GI+F+Q+D+E  WD+ ++  AIL     +  P
Sbjct  68   QLWISLSRYRTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAILFYLGNIYVP  120



>ref|XP_009410811.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=620

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS-LVWKESWEDIWCLHILVLTGLRGLV  623
            M  +   L  WPW+ LGN KY+L  PL+A  ++  +  K    D++   I+    +R L 
Sbjct  1    MASQPGPLTQWPWQRLGNMKYVLLAPLLAHSVHKFMTVKPEDRDMFNFLIIPSLLMRLLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             QLW + S M   N    +  + +DFEQ+D+E +WD+ +I  AILA       P
Sbjct  61   AQLWITLSRMKTANSKHSIVDKSLDFEQVDRERNWDDQIIFTAILAYVVNKVIP  114



>ref|XP_001420263.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98556.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=621

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (57%), Gaps = 4/109 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K  AL+ +PW   G+ KY +  P    F+ ++   +   D +C H+L +  LR    
Sbjct  1    MATKPGALYDFPWAEWGSMKYAVFLP----FVATVALGKDDGDSFCWHLLAIAALRYASA  56

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAY  773
            QLW S S +  + R  R+  +GIDF+Q+D+E +WD++++LQ ++ +  +
Sbjct  57   QLWISLSRVHAWTRKTRIQARGIDFKQVDREDNWDDYILLQTLVIALVH  105



>gb|KJB76257.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=631

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW+ LG+FKY++  PLIA+ IYS + K++ +DI    + +   +  R L
Sbjct  8    MASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDN-KDIDVSKLALFPSMLWRML  66

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             +QLW S S       + ++  +GI+F+Q+D+E  WD+ ++  AIL
Sbjct  67   HNQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAIL  112



>gb|KJB76256.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=642

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW+ LG+FKY++  PLIA+ IYS + K++ +DI    + +   +  R L
Sbjct  8    MASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDN-KDIDVSKLALFPSMLWRML  66

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             +QLW S S       + ++  +GI+F+Q+D+E  WD+ ++  AIL
Sbjct  67   HNQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAIL  112



>ref|XP_010661477.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=354

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LG+FKY++  P +   IYSL+ K+  E    +++L    L  R L
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYSLIIKDGKERD-PVYVLFFPFLLWRTL  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P
Sbjct  60   HNQIWISLSRYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILP  114



>gb|KJB76252.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=533

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW+ LG+FKY++  PLIA+ IYS + K++ +DI    + +   +  R L
Sbjct  8    MASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDN-KDIDVSKLALFPSMLWRML  66

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             +QLW S S       + ++  +GI+F+Q+D+E  WD+ ++  AIL
Sbjct  67   HNQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAIL  112



>gb|KJB76288.1| hypothetical protein B456_012G081500 [Gossypium raimondii]
Length=488

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+FKY++  PLI + IYS + K+   D+  L +      R L +
Sbjct  8    MASKPGILTDWPWKPLGSFKYIILVPLITEHIYSFMVKDEDIDVSKLALFPFVLWRMLHN  67

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            QLW S S         ++  +GI+F+Q+D+E  WD+ ++  AIL
Sbjct  68   QLWISLSRYRTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAIL  111



>gb|KJB76254.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
 gb|KJB76255.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=489

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW+ LG+FKY++  PLIA+ IYS + K++ +DI    + +   +  R L
Sbjct  8    MASKPGLLTDWPWKPLGSFKYIILVPLIAEHIYSFMVKDN-KDIDVSKLALFPSMLWRML  66

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             +QLW S S       + ++  +GI+F+Q+D+E  WD+ ++  AIL
Sbjct  67   HNQLWISLSRYRIAKGSNKIVDKGIEFDQVDRERDWDDHIMFSAIL  112



>emb|CBI16761.3| unnamed protein product [Vitis vinifera]
Length=631

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGL--RG  617
            M  K   L  WPW  LGNFKY++  P     +YS + K+  E D+   H L+   L  R 
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDV--AHFLIFPFLLWRM  58

Query  618  LVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            L +QLW S S         R+  +GI+FEQ+D+E +WD+ +I   I+   AY + P
Sbjct  59   LHNQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLP  114



>gb|KJB67446.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=528

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K   L  WPW  LG+FKY++ GP + + IYS++ K+  E D+    ++     R L 
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILGPWVTETIYSIMVKDPKEWDLTNFSVIPFMLWRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            +QLW S S         R+  +GI+F+Q+D+E +WD+ ++   IL
Sbjct  61   NQLWISLSRYRTAKGTNRIVDKGIEFDQVDRERNWDDQILFNGIL  105



>ref|XP_003625022.1| Protein WAX2 [Medicago truncatula]
 gb|ABD28316.1| Sterol desaturase [Medicago truncatula]
 gb|AES81240.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 6/115 (5%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVW--KESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW+ LG+FK+++  P I   IYS +W  ++  + + C  ILV    R L
Sbjct  1    MASKPGILTNWPWKPLGSFKFVILIPWIGHSIYSFIWVERDPIQYLICPFILV----RML  56

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S S         ++  + ++FEQ+D+E +WD+ ++  A+L    YM FP
Sbjct  57   HNQIWISISRYETARGKSKIVDKSLEFEQVDRETNWDDQILFTALLYYIGYMIFP  111



>gb|KFK42593.1| hypothetical protein AALP_AA1G015500 [Arabis alpina]
Length=628

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  +  AL  WPW  LG+FKYLL  PL+   ++S V  E  E      ++V   L  +VH
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVIASMHSYVTSEEDEKDLGRLLIVALMLWRIVH  60

Query  627  QL-WSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             L W S S        K++  + I+FEQ+D+E  WD+ +I   +L   A M  P
Sbjct  61   SLIWISVSRQRTAKGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLAIMKLP  114



>ref|XP_002263787.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGL--RG  617
            M  K   L  WPW  LGNFKY++  P     +YS + K+  E D+   H L+   L  R 
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDV--AHFLIFPFLLWRM  58

Query  618  LVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            L +QLW S S         R+  +GI+FEQ+D+E +WD+ +I   I+   AY + P
Sbjct  59   LHNQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLP  114



>gb|KJB67445.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=624

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K   L  WPW  LG+FKY++ GP + + IYS++ K+  E D+    ++     R L 
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILGPWVTETIYSIMVKDPKEWDLTNFSVIPFMLWRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            +QLW S S         R+  +GI+F+Q+D+E +WD+ ++   IL
Sbjct  61   NQLWISLSRYRTAKGTNRIVDKGIEFDQVDRERNWDDQILFNGIL  105



>ref|XP_001783415.1| predicted protein [Physcomitrella patens]
 gb|EDQ51755.1| predicted protein [Physcomitrella patens]
Length=626

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (53%), Gaps = 4/117 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K  AL  +PW +LG +KY L  P  AK + + +      D WC H+L+ + LR L  
Sbjct  1    MATKPGALTEYPWTSLGAWKYTLFLPFAAKAVQTNLLGGHEVDNWCFHMLLSSALRYLHG  60

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHW----DNFLILQAILASFAYMSFP  785
            Q W S S   +     R+  +GI+F+Q+D+E +W    D++++L  I A+  +   P
Sbjct  61   QAWMSLSRCHWLTGKYRIQTKGINFDQVDRESNWYNSSDDYILLHIITATLVHEILP  117



>ref|XP_001782380.1| predicted protein [Physcomitrella patens]
 gb|EDQ52834.1| predicted protein [Physcomitrella patens]
Length=621

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS-LVWKESWEDIWCLHILVLTGLRGLV  623
            M ++ A L  WPWE+LGN+KY    P + K   S  +   +  D W  ++LVL   R  V
Sbjct  1    MGEQAAVLAEWPWESLGNYKYWFYAPFLFKLFQSYFLGVRAAGDTWYFYMLVLMIGRYAV  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFL  791
             Q W++ + +    +   +    + FEQID+E+H DN ++LQ +  S A+  FP L
Sbjct  61   QQFWNTLTRLHSLVQKYEIHAYAVGFEQIDREFHSDNHIMLQFLFISLAHAWFPGL  116



>gb|ACR38546.1| unknown [Zea mays]
 gb|AFW72382.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=623

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  +   L  WPW+ LGNFKYL+  P+       +V +  W DI     L+L  L  R +
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVVAR-GWGDIDLAFALILPSLLLRMV  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S +         R+  +GI+F+Q+D+E  WD+ +IL  +L    Y++ P
Sbjct  60   HNQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIP  114



>gb|AES88391.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (53%), Gaps = 2/119 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+ K+++  P IA  IYS +W E     + +   +L  +R L +
Sbjct  1    MASKAGILTNWPWKPLGSLKFVILSPWIAHSIYSFIWVERDPTYYLIFPYIL--VRMLHN  58

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Q+W S S        +R+  +G++F+Q+D+E +WD+ ++  A++    Y  FP     P
Sbjct  59   QIWISISRYQTAKGKRRIVDKGLEFDQVDRETNWDDQILFTALMFYILYTIFPMAANLP  117



>ref|XP_003574039.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 5/116 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLV---WKESWEDIWCLHILVLTGLRG  617
            M      L  WPW+ LG+FKYL+  P +A   + L    W+E+  D+  + IL    LR 
Sbjct  1    MATNPGFLSEWPWKRLGSFKYLVLAPWVAHGFHQLATKGWRET--DLGYIAILPSMLLRA  58

Query  618  LVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            L +Q W + S +      K++  +GI+FEQ+D+E +WD+ +IL AIL     +  P
Sbjct  59   LHNQAWITVSRLQNARGRKQIVDRGIEFEQVDRERNWDDQIILSAILFYLGALHLP  114



>ref|XP_006418508.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
 gb|ESQ36861.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
Length=631

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  +  AL  WPW +LG+FKYLL  PL+   ++S V  E  E D+  L I+ L   R + 
Sbjct  1    MASRPGALTEWPWSSLGSFKYLLVAPLVMASMHSYVTAEDEEKDLGRLAIVALMLWRIVH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             Q+W S +        K++  + I+FEQ+D+E  WD+ +I   +L   A    P
Sbjct  61   SQIWISVARQRTAMGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANFKLP  114



>gb|EMT06855.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 62/106 (58%), Gaps = 5/106 (5%)
 Frame = +3

Query  477  WPWENLGNFKYLLCGPLIAKFIYSLV---WKESWEDIWCLHILVLTGLRGLVHQLWSSYS  647
            WPW+ LG+FKY++  P +A  +  +    W+E+  D+  L IL    LRGL +Q W + S
Sbjct  11   WPWKRLGSFKYVVLAPWVAHGVQQVATKGWREA--DLGYLVILPSMMLRGLHNQAWITVS  68

Query  648  NMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +      +++  +GI+FEQID+E +WD+ +IL AIL     +  P
Sbjct  69   RLQNARGKRQIVDRGIEFEQIDRERNWDDQIILSAILFFLGALHLP  114



>gb|KHG03871.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=599

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K   L  WPW  LG+FKY++ GP + + I+S++ K+  E D+    ++     R L 
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILGPWVMETIHSIMVKDPQEWDLTNFTVIPFMLWRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            +QLW S+S         R+  +GI+F+Q+D+E +WD+ ++   IL   A    P
Sbjct  61   NQLWISFSRYRTAKGTNRIVDKGIEFDQVDREKNWDDQILFNGILFFLANKYVP  114



>ref|XP_004953128.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=620

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 2/115 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  +   L  WPW+ LGNFKY++  P++      +     W ++     L+L  L  R +
Sbjct  1    MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGSRRVAGAGGWGELDLAFALILPSLLLRMV  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S +         R+  +GIDF+Q+D+E  WD+ +IL  +L   AY+  P
Sbjct  61   HNQIWISAARYQTARSKHRIVDRGIDFDQVDRERGWDDQIILNGLLFYVAYLLIP  115



>emb|CAN60676.1| hypothetical protein VITISV_029045 [Vitis vinifera]
Length=557

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 3/121 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LG+FKY++  P +   IY+L+ K+  E    +++L    L  R L
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERD-PVYVLFFPFLLWRAL  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*S  800
             +Q+W S +         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P +   
Sbjct  60   HNQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHM  119

Query  801  P  803
            P
Sbjct  120  P  120



>ref|XP_002262785.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38118.3| unnamed protein product [Vitis vinifera]
Length=620

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 3/121 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LG+FKY++  P +   IY+L+ K+  E    +++L    L  R L
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERD-PVYVLFFPFLLWRAL  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*S  800
             +Q+W S +         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P +   
Sbjct  60   HNQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHM  119

Query  801  P  803
            P
Sbjct  120  P  120



>ref|XP_009600723.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 2/112 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS--LVWKESWEDIWCLHILVLTGLRGL  620
            M  K   L  WPW  LGNFKYL+  P +   IY+  +   ES  DI  L IL L   R +
Sbjct  31   MASKPGILTEWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIGYLIILPLLLSRVI  90

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYM  776
             +Q+W S S         R+  + I+F+QID+E +WD+ +I   ++    Y+
Sbjct  91   HNQIWISLSRYRTAKGNNRIVDKSIEFDQIDRESNWDDQIIFNGLIYYIGYL  142



>ref|NP_171721.3| protein CER1-like 1 [Arabidopsis thaliana]
 sp|F4HVX7.1|CERL1_ARATH RecName: Full=Protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27399.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=627

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  +  AL  WPW  LG+FKYLL  PL+   ++S V     E D+  L I+VL   R + 
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             Q+W S S         ++  + I+FEQ+D+E  WD+ +I   +L   A +  P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLP  114



>ref|NP_973742.1| protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27398.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=623

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  +  AL  WPW  LG+FKYLL  PL+   ++S V     E D+  L I+VL   R + 
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             Q+W S S         ++  + I+FEQ+D+E  WD+ +I   +L   A +  P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLP  114



>gb|AAC24373.1| CER1-like protein [Arabidopsis thaliana]
Length=604

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  +  AL  WPW  LG+FKYLL  PL+   ++S V     E D+  L I+VL   R + 
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             Q+W S S         ++  + I+FEQ+D+E  WD+ +I   +L   A +  P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLP  114



>ref|XP_002262647.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38119.3| unnamed protein product [Vitis vinifera]
Length=620

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LG+FKY++  P +   IY+L+ K+  E    +++L    L  R L
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERD-PVYVLFFPFLLWRTL  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S +         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P
Sbjct  60   HNQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILP  114



>emb|CAA65199.1| CER1-like [Arabidopsis thaliana]
Length=622

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  +  AL  WPW  LG+FKYLL  PL+   ++S V     E D+  L I+VL   R + 
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             Q+W S S         ++  + I+FEQ+D+E  WD+ +I   +L   A +  P
Sbjct  61   SQIWISVSRQRTGKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLP  114



>emb|CAA65200.1| CER1-like [Arabidopsis thaliana]
Length=623

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  +  AL  WPW  LG+FKYLL  PL+   ++S V     E D+  L I+VL   R + 
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             Q+W S S         ++  + I+FEQ+D+E  WD+ +I   +L   A +  P
Sbjct  61   SQIWISVSRQRTGKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLP  114



>emb|CAN81825.1| hypothetical protein VITISV_014168 [Vitis vinifera]
Length=2166

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGL--RGL  620
            M  K   L  WPW++LG+FKY++  P +   IY+L+ K+  E    +++L    L  R L
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDP-VYVLFFPFLLWRTL  59

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             +Q+W S +         R+  + I+FEQ+D+E +WD+ ++L  IL    YM  P
Sbjct  60   HNQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILP  114



>ref|XP_003633900.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 57/114 (50%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K   L  WPW  LGNFKY++  P     I+S + K+  E D+    I      R L 
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            +QLW S S         R+  +GI+FEQ+D+E +WD+ +I   I+   AY   P
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILP  114



>ref|XP_010479268.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
 ref|XP_010496715.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=630

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 2/115 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS--LVWKESWEDIWCLHILVLTGLRGL  620
            M  K  AL  WPW  LG+FKYLL  P +   ++S   V  E  +D   L I+VL   R +
Sbjct  1    MASKPGALTEWPWSPLGSFKYLLVAPFVMASMHSYVTVADEDHKDFSRLMIVVLMLWRIV  60

Query  621  VHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
              Q+W S S         ++  + I+FEQ+D+E  WD+ +I   +L   A +  P
Sbjct  61   HSQIWISVSRQRTAKGTTKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLP  115



>emb|CBI16759.3| unnamed protein product [Vitis vinifera]
Length=256

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGL--RG  617
            M  K   L  WPW  LGNFKY++  P     I+S + K+  E D+   H L+   L  R 
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDV--AHFLIFPFLLWRM  58

Query  618  LVHQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            L +QLW S S         R+  +GI+FEQ+D+E +WD+ +I   I+   AY   P
Sbjct  59   LHNQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILP  114



>emb|CBI16760.3| unnamed protein product [Vitis vinifera]
Length=2763

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 56/114 (49%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYS-LVWKESWEDIWCLHILVLTGLRGLV  623
            M  K   L  WPW  LGNFKY++  P     I+S LV  E   D+    I      R L 
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
            +QLW S S         R+  +GI+FEQ+D+E +WD+ +I   I+   AY   P
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILP  114



>emb|CDP09363.1| unnamed protein product [Coffea canephora]
Length=611

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  K   L+ WPW  LGNFKY++  P +    Y  + K++ + ++    +L    LR L 
Sbjct  1    MASKPGILYDWPWTPLGNFKYVVLAPWVIHHTYPYMVKDASDRNLPMFLVLPFLLLRMLH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            +Q+W SYS         R+  + I+FEQID+E +WD+ +I   I+
Sbjct  61   NQIWISYSRYRTAKGTNRIVDKSIEFEQIDRERNWDDNIIFNGIV  105



>ref|XP_006306997.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
 gb|EOA39895.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
Length=629

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M  +  AL  WPW  LGNFKYLL  P +   +++ V     E D+  L I+ L   R + 
Sbjct  1    MASRPGALTEWPWSPLGNFKYLLVAPFVMASMHTYVTVADEEKDLSRLMIVALMLWRIIH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFP  785
             Q+W S S        +++  + I+FEQ+D+E  WD+ +I   +L   A +  P
Sbjct  61   SQIWISVSRQRTAKGTRKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLP  114



>ref|XP_009797701.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=617

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M      L  WPW++LG+FKY++  P IA   Y L  KE  E      ++V   L  +VH
Sbjct  1    MATTPGFLTDWPWKHLGSFKYVILAPWIAHSFYCLATKEQEERDSTNLLIVPFLLSRMVH  60

Query  627  -QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
             QLW S+S         R+  +GI+F+Q+D+E +WD+ +IL  IL
Sbjct  61   NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGIL  105



>gb|AES88379.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=600

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 2/119 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+FK+++  P IA  IYS +W E  +D     I     +R L  
Sbjct  1    MASKPGILTNWPWKPLGSFKFVILSPWIAHSIYSFIWVE--QDPSYYIIFPYMFVRMLHS  58

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Q+W S S         R+  + ++FEQ+D+E +WD+ ++L A+     Y  FP     P
Sbjct  59   QIWISISRYQTAKGKNRIVDKCLEFEQVDRETNWDDQILLTALTFYILYTIFPMAANLP  117



>ref|XP_004166202.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus]
Length=172

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 1/105 (1%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWE-DIWCLHILVLTGLRGLV  623
            M      L  WPW+ LG+FKY++  P +   IY  V K+  E D+ CL I      R + 
Sbjct  1    MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  624  HQLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAIL  758
            +Q+W S S         R+  +GI+F+Q+D+E +WD+ ++L  +L
Sbjct  61   NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLL  105



>ref|XP_003606182.1| Protein WAX2 [Medicago truncatula]
Length=594

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 2/119 (2%)
 Frame = +3

Query  447  MRKKDAALFAWPWENLGNFKYLLCGPLIAKFIYSLVWKESWEDIWCLHILVLTGLRGLVH  626
            M  K   L  WPW+ LG+FK+++  P IA  IYS +W E  +D     I     +R L  
Sbjct  1    MASKPGILTNWPWKPLGSFKFVILSPWIAHSIYSFIWVE--QDPSYYIIFPYMFVRMLHS  58

Query  627  QLWSSYSNMLFFNRAKRVSQQGIDFEQIDKEWHWDNFLILQAILASFAYMSFPFLG*SP  803
            Q+W S S         R+  + ++FEQ+D+E +WD+ ++L A+     Y  FP     P
Sbjct  59   QIWISISRYQTAKGKNRIVDKCLEFEQVDRETNWDDQILLTALTFYILYTIFPMAANLP  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005