BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043J04

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777666.1|  PREDICTED: eukaryotic translation initiation...    402   1e-137   Nicotiana sylvestris
ref|XP_009629813.1|  PREDICTED: eukaryotic translation initiation...    401   2e-137   Nicotiana tomentosiformis
ref|XP_011095354.1|  PREDICTED: eukaryotic translation initiation...    399   1e-136   Sesamum indicum [beniseed]
ref|XP_003517705.1|  PREDICTED: eukaryotic translation initiation...    397   8e-136   Glycine max [soybeans]
ref|XP_004489218.1|  PREDICTED: eukaryotic translation initiation...    396   3e-135   Cicer arietinum [garbanzo]
ref|XP_009777665.1|  PREDICTED: eukaryotic translation initiation...    394   2e-134   Nicotiana sylvestris
gb|KDP38201.1|  hypothetical protein JCGZ_04844                         392   5e-134   Jatropha curcas
ref|XP_008340535.1|  PREDICTED: eukaryotic translation initiation...    392   8e-134   Malus domestica [apple tree]
ref|XP_004492932.1|  PREDICTED: eukaryotic translation initiation...    392   8e-134   Cicer arietinum [garbanzo]
gb|KCW69349.1|  hypothetical protein EUGRSUZ_F02830                     389   9e-134   Eucalyptus grandis [rose gum]
ref|XP_007157442.1|  hypothetical protein PHAVU_002G070400g             392   9e-134   Phaseolus vulgaris [French bean]
ref|XP_009351622.1|  PREDICTED: eukaryotic translation initiation...    391   2e-133   Pyrus x bretschneideri [bai li]
ref|XP_008443373.1|  PREDICTED: eukaryotic translation initiation...    390   3e-133   Cucumis melo [Oriental melon]
ref|XP_006351166.1|  PREDICTED: eukaryotic translation initiation...    390   3e-133   Solanum tuberosum [potatoes]
ref|XP_002521889.1|  eukaryotic translation initiation factor 3 s...    390   3e-133   Ricinus communis
gb|KCW69348.1|  hypothetical protein EUGRSUZ_F02830                     389   4e-133   Eucalyptus grandis [rose gum]
ref|XP_008220972.1|  PREDICTED: eukaryotic translation initiation...    390   4e-133   Prunus mume [ume]
emb|CDP20306.1|  unnamed protein product                                390   5e-133   Coffea canephora [robusta coffee]
ref|XP_004136687.1|  PREDICTED: eukaryotic translation initiation...    390   6e-133   Cucumis sativus [cucumbers]
gb|EYU22708.1|  hypothetical protein MIMGU_mgv1a009949mg                389   8e-133   Erythranthe guttata [common monkey flower]
gb|AES67165.2|  eukaryotic translation initiation factor 3 subunit I    389   9e-133   Medicago truncatula
ref|XP_007222666.1|  hypothetical protein PRUPE_ppa008567mg             388   3e-132   Prunus persica
ref|XP_010937470.1|  PREDICTED: eukaryotic translation initiation...    388   3e-132   Elaeis guineensis
ref|XP_008350825.1|  PREDICTED: eukaryotic translation initiation...    388   3e-132   
ref|XP_008389128.1|  PREDICTED: eukaryotic translation initiation...    388   4e-132   
ref|XP_010062244.1|  PREDICTED: eukaryotic translation initiation...    388   4e-132   Eucalyptus grandis [rose gum]
ref|XP_009389562.1|  PREDICTED: eukaryotic translation initiation...    387   5e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010275012.1|  PREDICTED: eukaryotic translation initiation...    384   5e-132   Nelumbo nucifera [Indian lotus]
gb|EYU22777.1|  hypothetical protein MIMGU_mgv1a009964mg                386   1e-131   Erythranthe guttata [common monkey flower]
ref|XP_004250371.1|  PREDICTED: eukaryotic translation initiation...    386   2e-131   Solanum lycopersicum
gb|KDO58632.1|  hypothetical protein CISIN_1g020461mg                   384   5e-131   Citrus sinensis [apfelsine]
ref|XP_010926275.1|  PREDICTED: eukaryotic translation initiation...    385   5e-131   Elaeis guineensis
ref|XP_006591952.1|  PREDICTED: eukaryotic translation initiation...    385   5e-131   Glycine max [soybeans]
gb|KDO58631.1|  hypothetical protein CISIN_1g020461mg                   384   7e-131   Citrus sinensis [apfelsine]
ref|XP_006448046.1|  hypothetical protein CICLE_v10015917mg             384   8e-131   
ref|XP_010249002.1|  PREDICTED: eukaryotic translation initiation...    383   2e-130   Nelumbo nucifera [Indian lotus]
ref|XP_008808069.1|  PREDICTED: eukaryotic translation initiation...    383   3e-130   Phoenix dactylifera
ref|XP_007016708.1|  Transducin/WD40 repeat-like superfamily prot...    383   3e-130   
ref|XP_006448047.1|  hypothetical protein CICLE_v10015917mg             383   3e-130   Citrus clementina [clementine]
ref|XP_010275011.1|  PREDICTED: eukaryotic translation initiation...    382   4e-130   Nelumbo nucifera [Indian lotus]
ref|XP_010557463.1|  PREDICTED: eukaryotic translation initiation...    382   4e-130   Tarenaya hassleriana [spider flower]
ref|XP_002285281.1|  PREDICTED: eukaryotic translation initiation...    382   5e-130   Vitis vinifera
ref|XP_003534423.1|  PREDICTED: eukaryotic translation initiation...    380   3e-129   Glycine max [soybeans]
gb|KJB26173.1|  hypothetical protein B456_004G228300                    377   5e-129   Gossypium raimondii
gb|KJB56104.1|  hypothetical protein B456_009G106100                    378   5e-129   Gossypium raimondii
gb|KHG16392.1|  Eukaryotic translation initiation factor 3 subuni...    379   8e-129   Gossypium arboreum [tree cotton]
ref|XP_008782131.1|  PREDICTED: eukaryotic translation initiation...    379   9e-129   Phoenix dactylifera
ref|XP_003596914.1|  Eukaryotic translation initiation factor 3 s...    379   1e-128   
gb|EPS73291.1|  hypothetical protein M569_01462                         378   2e-128   Genlisea aurea
gb|KJB56102.1|  hypothetical protein B456_009G106100                    378   2e-128   Gossypium raimondii
ref|XP_010521568.1|  PREDICTED: eukaryotic translation initiation...    378   3e-128   Tarenaya hassleriana [spider flower]
gb|EPS65969.1|  hypothetical protein M569_08807                         377   4e-128   Genlisea aurea
gb|KJB56100.1|  hypothetical protein B456_009G106100                    376   2e-127   Gossypium raimondii
ref|XP_010111947.1|  Eukaryotic translation initiation factor 3 s...    380   2e-127   
gb|ABK94219.1|  unknown                                                 376   2e-127   Populus trichocarpa [western balsam poplar]
gb|KJB26172.1|  hypothetical protein B456_004G228300                    375   5e-127   Gossypium raimondii
ref|XP_002311556.2|  TGF-beta receptor-interacting protein 1            374   1e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011021700.1|  PREDICTED: eukaryotic translation initiation...    374   1e-126   Populus euphratica
ref|XP_011024978.1|  PREDICTED: eukaryotic translation initiation...    371   1e-125   Populus euphratica
ref|XP_009151956.1|  PREDICTED: eukaryotic translation initiation...    369   8e-125   Brassica rapa
gb|KFK37423.1|  hypothetical protein AALP_AA4G255300                    367   4e-124   Arabis alpina [alpine rockcress]
emb|CDY13713.1|  BnaA06g32100D                                          367   8e-124   Brassica napus [oilseed rape]
ref|XP_006294579.1|  hypothetical protein CARUB_v10023615mg             367   8e-124   Capsella rubella
ref|XP_004297796.1|  PREDICTED: eukaryotic translation initiation...    363   2e-122   Fragaria vesca subsp. vesca
ref|XP_010425732.1|  PREDICTED: eukaryotic translation initiation...    363   3e-122   Camelina sativa [gold-of-pleasure]
emb|CDY71621.1|  BnaAnng38210D                                          363   4e-122   Brassica napus [oilseed rape]
gb|ABK26793.1|  unknown                                                 362   5e-122   Picea sitchensis
gb|ABR18068.1|  unknown                                                 362   7e-122   Picea sitchensis
ref|NP_973697.1|  TGF-beta receptor interacting protein 1               359   7e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514644.1|  PREDICTED: eukaryotic translation initiation...    362   7e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010502959.1|  PREDICTED: eukaryotic translation initiation...    362   7e-122   Camelina sativa [gold-of-pleasure]
ref|XP_009129412.1|  PREDICTED: eukaryotic translation initiation...    360   2e-121   Brassica rapa
emb|CDY34145.1|  BnaA02g28950D                                          360   3e-121   Brassica napus [oilseed rape]
ref|NP_182152.2|  transducin/WD40 repeat-like superfamily protein       359   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182151.1|  TGF-beta receptor interacting protein 1               358   3e-120   Arabidopsis thaliana [mouse-ear cress]
gb|AAK43862.1|AF370485_1  eukaryotic translation initiation facto...    357   4e-120   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19940.1|  AT2G46280                                              357   6e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395438.1|  hypothetical protein EUTSA_v10004580mg             355   1e-119   
gb|AAC62877.1|  eukaryotic translation initiation factor 3 delta ...    356   1e-119   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43524.1|  putative eukaryotic translation initiation facto...    356   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AIZ68198.1|  eukaryotic translation initiation factor 3 subuni...    355   3e-119   Ornithogalum longebracteatum [sea-onion]
emb|CDY03970.1|  BnaC02g36850D                                          366   6e-119   
ref|XP_006395439.1|  hypothetical protein EUTSA_v10004580mg             353   1e-118   Eutrema salsugineum [saltwater cress]
ref|XP_001757566.1|  predicted protein                                  353   3e-118   
ref|XP_002315834.2|  TGF-beta receptor-interacting protein 1            350   4e-117   
gb|AAG53616.1|AF285835_1  eukaryotic initiation factor 3I1 subunit      349   6e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49079.1|  TGF-beta receptor interacting protein 1 homolog         348   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882057.1|  hypothetical protein ARALYDRAFT_322284             349   1e-116   
ref|XP_010506629.1|  PREDICTED: eukaryotic translation initiation...    348   6e-116   Camelina sativa [gold-of-pleasure]
ref|XP_002862549.1|  eukaryotic translation initiation factor 3 d...    347   7e-116   
ref|XP_010508042.1|  PREDICTED: eukaryotic translation initiation...    348   7e-116   Camelina sativa [gold-of-pleasure]
gb|EEC83341.1|  hypothetical protein OsI_28738                          343   1e-115   Oryza sativa Indica Group [Indian rice]
ref|NP_001147501.1|  eukaryotic translation initiation factor 3 s...    345   2e-115   Zea mays [maize]
ref|XP_002882056.1|  TGF-beta receptor interacting protein 1            345   3e-115   Arabidopsis lyrata subsp. lyrata
ref|XP_008670966.1|  PREDICTED: eukaryotic translation initiation...    344   8e-115   Zea mays [maize]
ref|XP_004955547.1|  PREDICTED: eukaryotic translation initiation...    343   2e-114   Setaria italica
ref|XP_002461510.1|  hypothetical protein SORBIDRAFT_02g003760          342   3e-114   Sorghum bicolor [broomcorn]
gb|AFM95335.1|  eukaryotic translation initiation factor 3 subunit i    342   4e-114   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85385.1|  predicted protein                                      342   4e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001061508.1|  Os08g0308100                                       341   8e-114   
ref|XP_010678072.1|  PREDICTED: eukaryotic translation initiation...    341   1e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003577379.1|  PREDICTED: eukaryotic translation initiation...    341   1e-113   Brachypodium distachyon [annual false brome]
ref|XP_001763986.1|  predicted protein                                  340   2e-113   
ref|NP_001055036.1|  Os05g0256000                                       339   4e-113   
ref|XP_007215753.1|  hypothetical protein PRUPE_ppa009367mg             337   9e-113   
gb|EAZ42270.1|  hypothetical protein OsJ_26838                          340   1e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001758941.1|  predicted protein                                  338   2e-112   
ref|XP_002988251.1|  hypothetical protein SELMODRAFT_269383             332   3e-110   Selaginella moellendorffii
ref|XP_006471278.1|  PREDICTED: eukaryotic translation initiation...    325   2e-109   Citrus sinensis [apfelsine]
ref|XP_006663589.1|  PREDICTED: eukaryotic translation initiation...    296   2e-96    
ref|XP_004977275.1|  PREDICTED: eukaryotic translation initiation...    286   9e-92    
ref|XP_001418365.1|  predicted protein                                  280   5e-90    Ostreococcus lucimarinus CCE9901
ref|XP_003079673.1|  TGF-beta receptor-interacting protein 1 (ISS)      280   1e-89    Ostreococcus tauri
ref|XP_003059370.1|  predicted protein                                  270   1e-85    Micromonas pusilla CCMP1545
ref|XP_002500789.1|  predicted protein                                  268   3e-85    Micromonas commoda
gb|EMS51995.1|  Eukaryotic translation initiation factor 3 subunit I    259   2e-81    Triticum urartu
ref|XP_008386512.1|  PREDICTED: eukaryotic translation initiation...    252   3e-81    Malus domestica [apple tree]
gb|KJB56101.1|  hypothetical protein B456_009G106100                    256   4e-81    Gossypium raimondii
ref|XP_007512918.1|  predicted protein                                  253   2e-79    Bathycoccus prasinos
gb|KDO58633.1|  hypothetical protein CISIN_1g020461mg                   249   1e-78    Citrus sinensis [apfelsine]
ref|XP_005647023.1|  TGF-beta receptor-interacting protein 1            247   4e-77    Coccomyxa subellipsoidea C-169
gb|ETO77218.1|  hypothetical protein F444_07544                         233   2e-71    Phytophthora parasitica P1976
ref|XP_008904158.1|  hypothetical protein PPTG_10533                    233   3e-71    Phytophthora parasitica INRA-310
ref|XP_009538303.1|  hypothetical protein PHYSODRAFT_551045             231   9e-71    Phytophthora sojae
ref|XP_002899797.1|  eukaryotic translation initiation factor 3 s...    229   5e-70    Phytophthora infestans T30-4
ref|XP_011401093.1|  Eukaryotic translation initiation factor 3 s...    223   8e-68    Auxenochlorella protothecoides
ref|XP_001693266.1|  eukaryotic initiation factor                       221   5e-67    Chlamydomonas reinhardtii
ref|XP_002957235.1|  eukaryotic translation initiation factor 3i        216   7e-65    Volvox carteri f. nagariensis
gb|KIZ03352.1|  Eukaryotic translation initiation factor 3 subunit I    216   8e-65    Monoraphidium neglectum
ref|XP_009821601.1|  hypothetical protein H257_00561                    206   4e-61    Aphanomyces astaci
ref|XP_005535289.1|  eukaryotic translation initiation factor eIF...    206   4e-61    Cyanidioschyzon merolae strain 10D
ref|XP_005761487.1|  hypothetical protein EMIHUDRAFT_438175             206   8e-61    Emiliania huxleyi CCMP1516
ref|XP_008613397.1|  translation initiation factor 3 subunit I          202   9e-60    Saprolegnia diclina VS20
gb|EMT33770.1|  hypothetical protein F775_29343                         205   1e-59    
emb|CCA18540.1|  eukaryotic translation initiation factor 3 subun...    202   2e-59    Albugo laibachii Nc14
ref|XP_005707349.1|  translation initiation factor eIF-3 subunit 2      201   2e-59    Galdieria sulphuraria
ref|XP_008862518.1|  hypothetical protein H310_01239                    201   5e-59    Aphanomyces invadans
gb|KJB56103.1|  hypothetical protein B456_009G106100                    198   1e-58    Gossypium raimondii
ref|XP_004341724.1|  eTGF-beta receptor-interacting protein, puta...    192   1e-55    Acanthamoeba castellanii str. Neff
gb|AAM94012.1|  TGF-beta receptor-interacting protein 1                 188   1e-54    Griffithsia japonica
gb|EPY53170.1|  translation initiation factor eIF3i                     188   3e-54    Schizosaccharomyces cryophilus OY26
ref|XP_004364074.2|  Trip1-PA                                           186   2e-53    Capsaspora owczarzaki ATCC 30864
ref|XP_001603140.1|  PREDICTED: eukaryotic translation initiation...    186   2e-53    Nasonia vitripennis
gb|ELU14583.1|  hypothetical protein CAPTEDRAFT_180537                  185   4e-53    Capitella teleta
gb|ACD65081.1|  eukaryotic translation initiation factor                185   5e-53    Forcipomyia taiwana
ref|XP_001868509.1|  eukaryotic translation initiation factor 3 s...    185   8e-53    Culex quinquefasciatus
ref|XP_001656392.1|  AAEL013144-PA                                      184   1e-52    Aedes aegypti
gb|KJE92223.1|  Trip1-PA                                                183   3e-52    Capsaspora owczarzaki ATCC 30864
gb|EPX75306.1|  translation initiation factor eIF3i                     183   3e-52    Schizosaccharomyces octosporus yFS286
ref|XP_002021487.1|  GL26537                                            182   6e-52    Drosophila persimilis
emb|CDP11954.1|  unnamed protein product                                175   7e-52    Coffea canephora [robusta coffee]
ref|XP_008549768.1|  PREDICTED: eukaryotic translation initiation...    182   1e-51    Microplitis demolitor
ref|XP_005718524.1|  Translation initiation factor eIF3, subunit I      182   1e-51    Chondrus crispus [carageen]
ref|XP_002078185.1|  GD22675                                            181   2e-51    Drosophila simulans
ref|NP_523478.1|  Trip1                                                 181   2e-51    Drosophila melanogaster
ref|XP_001968738.1|  GG24335                                            181   2e-51    Drosophila erecta
ref|XP_011254946.1|  PREDICTED: eukaryotic translation initiation...    181   2e-51    Camponotus floridanus
ref|XP_011055583.1|  PREDICTED: eukaryotic translation initiation...    181   2e-51    Acromyrmex echinatior
ref|XP_011160448.1|  PREDICTED: eukaryotic translation initiation...    180   3e-51    Solenopsis invicta [imported red fire ant]
dbj|BAA13849.1|  unnamed protein product                                181   4e-51    Schizosaccharomyces pombe
ref|XP_011337589.1|  PREDICTED: eukaryotic translation initiation...    180   5e-51    Ooceraea biroi
ref|XP_001965147.1|  GF23646                                            179   8e-51    
ref|XP_008210954.1|  PREDICTED: eukaryotic translation initiation...    179   1e-50    
ref|XP_002088703.1|  Trip1                                              179   1e-50    
ref|NP_594958.1|  translation initiation factor eIF3i                   178   2e-50    Schizosaccharomyces pombe
gb|EFZ22632.1|  hypothetical protein SINV_00160                         178   3e-50    
ref|XP_011314062.1|  PREDICTED: eukaryotic translation initiation...    178   3e-50    Fopius arisanus
gb|KFH67131.1|  translation initiation factor eIF-3 subunit 2           177   4e-50    Mortierella verticillata NRRL 6337
ref|XP_006003298.1|  PREDICTED: eukaryotic translation initiation...    177   4e-50    Latimeria chalumnae
gb|AAU89474.1|  putative translation initiation factor 3 subunit ...    176   6e-50    Aedes aegypti
ref|XP_001688930.1|  AGAP006607-PB                                      176   7e-50    Anopheles gambiae str. PEST
ref|XP_011501372.1|  PREDICTED: eukaryotic translation initiation...    177   9e-50    Ceratosolen solmsi marchali
emb|CCI46504.1|  unnamed protein product                                176   1e-49    Albugo candida
ref|XP_005181692.1|  PREDICTED: eukaryotic translation initiation...    176   1e-49    Musca domestica
ref|NP_001279068.1|  eukaryotic translation initiation factor 3, ...    176   1e-49    Callorhinchus milii [Australian ghost shark]
ref|XP_002167671.1|  PREDICTED: eukaryotic translation initiation...    176   1e-49    Hydra vulgaris
ref|XP_316636.4|  AGAP006607-PA                                         176   1e-49    Anopheles gambiae str. PEST
ref|XP_011145247.1|  PREDICTED: eukaryotic translation initiation...    176   2e-49    Harpegnathos saltator
ref|XP_007249463.1|  PREDICTED: eukaryotic translation initiation...    176   2e-49    Astyanax mexicanus [blind cave fish]
ref|XP_001989068.1|  GH10244                                            176   2e-49    Drosophila grimshawi
emb|CDR46246.1|  RHTO0S12e02014g1_1                                     176   3e-49    Rhodotorula toruloides
emb|CCG84178.1|  protein of unknown function                            175   3e-49    Taphrina deformans PYCC 5710
ref|XP_006806095.1|  PREDICTED: eukaryotic translation initiation...    175   4e-49    Neolamprologus brichardi [lyretail cichlid]
ref|XP_003443814.1|  PREDICTED: eukaryotic translation initiation...    175   4e-49    Oreochromis niloticus
gb|ETN60290.1|  eukaryotic translation initiation factor 3 subunit      175   5e-49    Anopheles darlingi [American malaria mosquito]
ref|XP_005102454.1|  PREDICTED: eukaryotic translation initiation...    174   6e-49    Aplysia californica
ref|NP_001156064.1|  eukaryotic translation initiation factor 3 s...    174   7e-49    Acyrthosiphon pisum
ref|XP_008553489.1|  PREDICTED: eukaryotic translation initiation...    174   7e-49    Microplitis demolitor
ref|XP_011445956.1|  PREDICTED: eukaryotic translation initiation...    174   7e-49    Crassostrea gigas
ref|XP_002051937.1|  GJ17275                                            174   8e-49    
ref|XP_011180318.1|  PREDICTED: eukaryotic translation initiation...    174   9e-49    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011198986.1|  PREDICTED: eukaryotic translation initiation...    174   1e-48    Bactrocera dorsalis [papaya fruit fly]
gb|EGI64611.1|  Eukaryotic translation initiation factor 3 subunit I    174   1e-48    Acromyrmex echinatior
gb|KDE03916.1|  eukaryotic translation initiation factor 3 subunit I    174   1e-48    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|ACQ58286.1|  Eukaryotic translation initiation factor 3 subunit I    174   1e-48    Anoplopoma fimbria
ref|XP_006676014.1|  hypothetical protein BATDEDRAFT_84729              174   2e-48    Batrachochytrium dendrobatidis JAM81
ref|XP_010902262.1|  PREDICTED: eukaryotic translation initiation...    173   2e-48    Esox lucius
ref|XP_003707661.1|  PREDICTED: eukaryotic translation initiation...    173   2e-48    Megachile rotundata
gb|KIW74742.1|  eukaryotic translation initiation factor 3 subunit I    174   2e-48    Fonsecaea pedrosoi CBS 271.37
gb|KIO29603.1|  hypothetical protein M407DRAFT_167483                   173   2e-48    Tulasnella calospora MUT 4182
gb|EMS23252.1|  translation initiation factor eIF-3 subunit 2           174   3e-48    Rhodotorula toruloides NP11
ref|XP_392780.2|  PREDICTED: eukaryotic translation initiation fa...    173   3e-48    Apis mellifera [bee]
ref|NP_001280295.1|  uncharacterized protein LOC100162604               173   3e-48    Acyrthosiphon pisum
gb|ERZ95383.1|  hypothetical protein GLOINDRAFT_341253                  173   3e-48    
ref|XP_003228758.1|  PREDICTED: eukaryotic translation initiation...    172   3e-48    Anolis carolinensis [Carolina anole]
sp|B4NW98.2|EIF3I_DROYA  RecName: Full=Eukaryotic translation ini...    172   3e-48    Drosophila yakuba
sp|B3MVL6.2|EIF3I_DROAN  RecName: Full=Eukaryotic translation ini...    172   3e-48    Drosophila ananassae
ref|NP_001187527.1|  eukaryotic translation initiation factor 3 s...    172   4e-48    Ictalurus punctatus
ref|XP_005102453.1|  PREDICTED: eukaryotic translation initiation...    172   5e-48    
emb|CDR44437.1|  CYFA0S14e02718g1_1                                     172   5e-48    Cyberlindnera fabianii
gb|EKC38588.1|  Eukaryotic translation initiation factor 3 subunit I    172   6e-48    Crassostrea gigas
ref|XP_008294825.1|  PREDICTED: eukaryotic translation initiation...    172   7e-48    Stegastes partitus
ref|XP_007563815.1|  PREDICTED: eukaryotic translation initiation...    172   7e-48    Poecilia formosa
ref|XP_005812506.1|  PREDICTED: eukaryotic translation initiation...    172   8e-48    Xiphophorus maculatus
ref|XP_009047818.1|  hypothetical protein LOTGIDRAFT_200332             171   1e-47    Lottia gigantea
ref|NP_001133273.1|  Eukaryotic translation initiation factor 3 s...    171   1e-47    Salmo salar
ref|XP_008079360.1|  WD40 repeat-like protein                           171   1e-47    Glarea lozoyensis ATCC 20868
gb|ACO09379.1|  Eukaryotic translation initiation factor 3 subunit 2    171   2e-47    Osmerus mordax
ref|NP_998155.1|  eukaryotic translation initiation factor 3 subu...    171   2e-47    Danio rerio [leopard danio]
ref|XP_002001737.1|  GI15375                                            171   2e-47    
ref|XP_003500685.1|  PREDICTED: eukaryotic translation initiation...    171   2e-47    Cricetulus griseus [Chinese hamsters]
gb|EFN80704.1|  Eukaryotic translation initiation factor 3 subunit I    171   2e-47    Harpegnathos saltator
emb|CDP11515.1|  unnamed protein product                                167   2e-47    Coffea canephora [robusta coffee]
ref|XP_004531427.1|  PREDICTED: eukaryotic translation initiation...    171   2e-47    Ceratitis capitata [medfly]
ref|XP_002115720.1|  expressed hypothetical protein                     170   3e-47    Trichoplax adhaerens
gb|KHN14569.1|  Eukaryotic translation initiation factor 3 subunit I    166   4e-47    Glycine soja [wild soybean]
ref|XP_004074467.1|  PREDICTED: eukaryotic translation initiation...    170   4e-47    Oryzias latipes [Japanese rice fish]
gb|AGM32572.1|  WD40 domain containing protein                          169   4e-47    Coptotermes formosanus
gb|AAI27353.1|  eif3s2 protein                                          170   4e-47    Xenopus tropicalis [western clawed frog]
ref|NP_001015781.1|  eukaryotic translation initiation factor 3 s...    169   5e-47    Xenopus tropicalis [western clawed frog]
gb|ADO28015.1|  eukaryotic translation initiation factor 3 subunit i    169   5e-47    Ictalurus furcatus
ref|XP_003387873.1|  PREDICTED: eukaryotic translation initiation...    169   6e-47    
gb|EFN69223.1|  Eukaryotic translation initiation factor 3 subunit I    169   6e-47    Camponotus floridanus
ref|XP_005302240.1|  PREDICTED: eukaryotic translation initiation...    169   6e-47    Chrysemys picta bellii
emb|CDQ91911.1|  unnamed protein product                                169   6e-47    Oncorhynchus mykiss
ref|XP_008330275.1|  PREDICTED: eukaryotic translation initiation...    169   6e-47    
ref|XP_003969003.1|  PREDICTED: eukaryotic translation initiation...    169   7e-47    Takifugu rubripes [tiger puffer]
ref|XP_008330274.1|  PREDICTED: eukaryotic translation initiation...    169   8e-47    Cynoglossus semilaevis [half-smooth tongue sole]
emb|CAF99511.1|  unnamed protein product                                169   9e-47    Tetraodon nigroviridis
ref|XP_007170666.1|  PREDICTED: eukaryotic translation initiation...    169   9e-47    Balaenoptera acutorostrata scammoni
gb|KFB49333.1|  AGAP006607-PA-like protein                              169   9e-47    Anopheles sinensis
ref|XP_008330273.1|  PREDICTED: eukaryotic translation initiation...    170   9e-47    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001903926.1|  hypothetical protein                               169   1e-46    Podospora anserina S mat+
dbj|BAD96203.1|  eukaryotic translation initiation factor 3, subu...    169   1e-46    Homo sapiens [man]
gb|AAR10222.1|  similar to Drosophila melanogaster Trip1                164   1e-46    Drosophila yakuba
ref|XP_006274867.1|  PREDICTED: eukaryotic translation initiation...    169   1e-46    Alligator mississippiensis
ref|NP_001040433.1|  eukaryotic translation initiation factor 3 s...    169   1e-46    Bombyx mori [silk moth]
sp|B4LUA5.2|EIF3I_DROVI  RecName: Full=Eukaryotic translation ini...    168   1e-46    Drosophila virilis
ref|NP_001087664.1|  eukaryotic translation initiation factor 3 s...    168   2e-46    Xenopus laevis [clawed frog]
ref|XP_008419625.1|  PREDICTED: eukaryotic translation initiation...    168   2e-46    Poecilia reticulata
gb|KDR14214.1|  hypothetical protein L798_11754                         169   2e-46    Zootermopsis nevadensis
ref|XP_006117620.1|  PREDICTED: eukaryotic translation initiation...    168   2e-46    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007399384.1|  hypothetical protein PHACADRAFT_261788             168   2e-46    Phanerochaete carnosa HHB-10118-sp
ref|XP_007775247.1|  WD40 repeat-like protein                           167   3e-46    Coniophora puteana RWD-64-598 SS2
gb|KIW28535.1|  eukaryotic translation initiation factor 3 subunit I    167   3e-46    Cladophialophora immunda
gb|KIY02597.1|  eukaryotic translation initiation factor 3 subunit I    167   3e-46    Fonsecaea multimorphosa CBS 102226
ref|XP_003276408.2|  PREDICTED: eukaryotic translation initiation...    167   4e-46    Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001108507.1|  eukaryotic translation initiation factor 3 s...    167   4e-46    Rattus norvegicus [brown rat]
ref|XP_009013860.1|  hypothetical protein HELRODRAFT_185422             167   4e-46    Helobdella robusta
ref|XP_006094311.1|  PREDICTED: eukaryotic translation initiation...    167   4e-46    Myotis lucifugus
ref|XP_006694969.1|  eukaryotic translation initiation factor 3-l...    168   4e-46    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_008155232.1|  PREDICTED: eukaryotic translation initiation...    167   4e-46    Eptesicus fuscus
ref|XP_006895022.1|  PREDICTED: eukaryotic translation initiation...    167   4e-46    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006862226.1|  PREDICTED: eukaryotic translation initiation...    167   4e-46    Chrysochloris asiatica
ref|XP_008064944.1|  PREDICTED: eukaryotic translation initiation...    168   4e-46    
ref|XP_007404086.1|  hypothetical protein MELLADRAFT_41438              167   4e-46    Melampsora larici-populina 98AG31
ref|XP_003801293.1|  PREDICTED: eukaryotic translation initiation...    167   5e-46    
ref|NP_003748.1|  eukaryotic translation initiation factor 3 subu...    167   5e-46    Homo sapiens [man]
gb|AAV38402.1|  eukaryotic translation initiation factor 3, subun...    167   5e-46    synthetic construct
ref|XP_005395112.1|  PREDICTED: eukaryotic translation initiation...    167   5e-46    
ref|NP_001231553.1|  eukaryotic translation initiation factor 3, ...    167   5e-46    Sus scrofa [pigs]
ref|XP_003487069.1|  PREDICTED: eukaryotic translation initiation...    167   6e-46    Bombus impatiens
ref|XP_002921914.2|  PREDICTED: eukaryotic translation initiation...    168   6e-46    Ailuropoda melanoleuca
ref|XP_007432017.1|  PREDICTED: eukaryotic translation initiation...    167   6e-46    Python bivittatus
ref|XP_008723623.1|  eukaryotic translation initiation factor 3 s...    167   6e-46    Cladophialophora carrionii CBS 160.54
ref|XP_004591787.1|  PREDICTED: eukaryotic translation initiation...    167   6e-46    
gb|AAX41399.1|  eukaryotic translation initiation factor 3 subuni...    167   6e-46    synthetic construct
ref|XP_006994436.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    167   6e-46    
ref|NP_061269.1|  eukaryotic translation initiation factor 3 subu...    167   6e-46    Mus musculus [mouse]
ref|XP_010619869.1|  PREDICTED: eukaryotic translation initiation...    167   6e-46    
ref|NP_001015628.1|  eukaryotic translation initiation factor 3 s...    167   6e-46    
ref|XP_007948641.1|  PREDICTED: eukaryotic translation initiation...    167   6e-46    
ref|NP_001126286.1|  eukaryotic translation initiation factor 3 s...    167   6e-46    
dbj|BAE42882.1|  unnamed protein product                                167   6e-46    
ref|XP_005878403.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    167   7e-46    
ref|XP_004705070.1|  PREDICTED: eukaryotic translation initiation...    166   7e-46    
ref|NP_001157823.1|  eukaryotic translation initiation factor 3 s...    166   7e-46    
gb|KFM68458.1|  Eukaryotic translation initiation factor 3 subunit I    166   7e-46    
ref|XP_002173377.1|  translation initiation factor eIF3i                166   8e-46    
gb|KIM93051.1|  hypothetical protein OIDMADRAFT_107011                  167   8e-46    
ref|XP_005058303.1|  PREDICTED: eukaryotic translation initiation...    166   8e-46    
ref|XP_008692694.1|  PREDICTED: eukaryotic translation initiation...    166   8e-46    
ref|XP_007092475.1|  PREDICTED: eukaryotic translation initiation...    166   8e-46    
ref|XP_004406473.1|  PREDICTED: eukaryotic translation initiation...    166   9e-46    
ref|NP_001075647.1|  eukaryotic translation initiation factor 3 s...    166   1e-45    
ref|XP_005317802.1|  PREDICTED: eukaryotic translation initiation...    166   1e-45    
ref|XP_007125162.1|  PREDICTED: eukaryotic translation initiation...    166   1e-45    
ref|XP_006777450.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    167   1e-45    
gb|EPQ15220.1|  Eukaryotic translation initiation factor 3 subunit I    166   1e-45    
ref|XP_007725205.1|  eukaryotic translation initiation factor 3 s...    166   1e-45    
sp|E3LB80.2|EIF3I_PUCGT  RecName: Full=Eukaryotic translation ini...    166   1e-45    
ref|XP_006019466.1|  PREDICTED: eukaryotic translation initiation...    166   1e-45    
ref|NP_001157867.1|  eukaryotic translation initiation factor 3 s...    166   1e-45    
ref|XP_007755968.1|  eukaryotic translation initiation factor 3 s...    166   1e-45    
gb|EHB12852.1|  Eukaryotic translation initiation factor 3 subunit I    167   1e-45    
ref|XP_002840508.1|  hypothetical protein                               166   1e-45    
gb|ACH44280.1|  putative eukaryotic translation initiation factor...    166   2e-45    
ref|XP_001503867.4|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    166   2e-45    
ref|XP_005139430.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    166   2e-45    
gb|AAX36269.1|  eukaryotic translation initiation factor 3 subuni...    165   2e-45    
ref|XP_004485231.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    167   2e-45    
ref|XP_004266574.1|  PREDICTED: eukaryotic translation initiation...    165   2e-45    
emb|CEP61303.1|  LALA0S02e11386g1_1                                     166   2e-45    
gb|KIW69713.1|  eukaryotic translation initiation factor 3 subunit I    166   2e-45    
ref|XP_007523336.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    165   2e-45    
ref|XP_535328.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic tran...    166   2e-45    
dbj|BAM18089.1|  eukaryotic translation initiation factor 3 subun...    165   3e-45    
ref|XP_004603791.1|  PREDICTED: eukaryotic translation initiation...    165   3e-45    
gb|EPZ33787.1|  hypothetical protein O9G_004435                         165   3e-45    
ref|XP_007734179.1|  eukaryotic translation initiation factor 3 s...    165   3e-45    
ref|XP_007873769.1|  hypothetical protein PNEG_01801                    165   3e-45    
ref|XP_010574327.1|  PREDICTED: eukaryotic translation initiation...    165   3e-45    
ref|XP_008712178.1|  eukaryotic translation initiation factor 3 s...    165   3e-45    
ref|XP_007748455.1|  eukaryotic translation initiation factor 3 s...    165   3e-45    
ref|XP_004850898.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    167   3e-45    
ref|XP_008491107.1|  PREDICTED: eukaryotic translation initiation...    165   3e-45    
ref|XP_004372060.1|  PREDICTED: eukaryotic translation initiation...    166   4e-45    
ref|XP_006631418.1|  PREDICTED: eukaryotic translation initiation...    164   4e-45    
emb|CCJ29421.1|  unnamed protein product                                164   4e-45    
gb|EHH14557.1|  hypothetical protein EGK_00504                          164   4e-45    
ref|XP_006054762.1|  PREDICTED: eukaryotic translation initiation...    166   4e-45    
gb|EFB27372.1|  hypothetical protein PANDA_010855                       164   4e-45    
ref|XP_011273467.1|  hypothetical protein BN7_4251                      165   4e-45    
ref|XP_004900249.1|  PREDICTED: eukaryotic translation initiation...    166   5e-45    
gb|EDL30181.1|  eukaryotic translation initiation factor 3, subun...    164   5e-45    
gb|ELR48735.1|  Eukaryotic translation initiation factor 3 subunit I    164   5e-45    
ref|XP_010168387.1|  PREDICTED: eukaryotic translation initiation...    164   6e-45    
gb|KFP75614.1|  Eukaryotic translation initiation factor 3 subunit I    164   6e-45    
ref|XP_009068306.1|  PREDICTED: eukaryotic translation initiation...    164   6e-45    
gb|KFX89447.1|  hypothetical protein V490_07014                         164   7e-45    
ref|XP_009283047.1|  PREDICTED: eukaryotic translation initiation...    164   7e-45    
gb|EFN80705.1|  Eukaryotic translation initiation factor 3 subunit I    164   7e-45    
gb|KFP00122.1|  Eukaryotic translation initiation factor 3 subunit I    164   7e-45    
ref|XP_003338224.1|  translation initiation factor eIF-3 subunit 2      165   8e-45    
gb|KFY09000.1|  hypothetical protein V492_05712                         164   9e-45    
ref|XP_005142501.1|  PREDICTED: eukaryotic translation initiation...    164   9e-45    
ref|XP_001226603.1|  conserved hypothetical protein                     164   1e-44    
ref|XP_008633416.1|  PREDICTED: eukaryotic translation initiation...    163   1e-44    
gb|KFO60217.1|  Eukaryotic translation initiation factor 3 subunit I    163   1e-44    
gb|EOB00694.1|  Eukaryotic translation initiation factor 3 subunit I    163   1e-44    
ref|XP_007492943.1|  PREDICTED: eukaryotic translation initiation...    163   1e-44    
gb|KFV75063.1|  Eukaryotic translation initiation factor 3 subunit I    163   1e-44    
ref|XP_002066637.1|  GK24461                                            163   1e-44    
ref|XP_005239876.1|  PREDICTED: eukaryotic translation initiation...    163   1e-44    
ref|XP_003650868.1|  hypothetical protein THITE_2110768                 164   1e-44    
ref|XP_009929570.1|  PREDICTED: eukaryotic translation initiation...    163   1e-44    
gb|KIM30962.1|  hypothetical protein M408DRAFT_327876                   163   1e-44    
ref|XP_003844805.1|  similar to eukaryotic translation initiation...    163   2e-44    
ref|XP_010721802.1|  PREDICTED: eukaryotic translation initiation...    164   2e-44    
gb|EIF45267.1|  eukaryotic translation initiation factor 3 subunit      164   2e-44    
ref|XP_010574326.1|  PREDICTED: eukaryotic translation initiation...    163   2e-44    
gb|KDD75202.1|  hypothetical protein H632_c812p0                        162   2e-44    
ref|XP_009906815.1|  PREDICTED: eukaryotic translation initiation...    163   2e-44    
gb|EFQ28334.1|  WD domain-containing protein                            163   2e-44    
ref|XP_007468733.1|  PREDICTED: eukaryotic translation initiation...    166   2e-44    
gb|ENH79852.1|  eukaryotic translation initiation factor 3 39 kda...    163   3e-44    
gb|EMD39788.1|  hypothetical protein CERSUDRAFT_112055                  162   3e-44    
gb|KHJ35878.1|  putative eukaryotic translation initiation factor 3     162   3e-44    
ref|XP_005020506.1|  PREDICTED: eukaryotic translation initiation...    163   3e-44    
ref|XP_003765492.1|  PREDICTED: eukaryotic translation initiation...    163   3e-44    
ref|XP_001639587.1|  predicted protein                                  162   4e-44    
gb|ELK02020.1|  Eukaryotic translation initiation factor 3 subunit I    166   4e-44    
gb|KFY64993.1|  hypothetical protein V496_02881                         162   4e-44    
gb|KHN32457.1|  Eukaryotic translation initiation factor 3 subunit I    159   4e-44    
gb|KFZ10578.1|  hypothetical protein V501_05126                         162   4e-44    
gb|KIV96617.1|  eukaryotic translation initiation factor 3 subunit I    162   4e-44    
gb|KIW54434.1|  eukaryotic translation initiation factor 3 subunit I    162   5e-44    
ref|XP_007363750.1|  WD40 repeat-like protein                           162   5e-44    
gb|ACO10455.1|  Eukaryotic translation initiation factor 3 subunit I    162   5e-44    
gb|KEF62513.1|  eukaryotic translation initiation factor 3 subunit I    162   5e-44    
ref|XP_007680736.1|  hypothetical protein BAUCODRAFT_286498             162   6e-44    
gb|KDN63708.1|  putative WD domain-containing protein                   162   6e-44    
gb|KIX06858.1|  eukaryotic translation initiation factor 3 subunit I    162   6e-44    
gb|ACO13175.1|  Eukaryotic translation initiation factor 3 subunit I    161   7e-44    
gb|AEE62555.1|  unknown                                                 161   7e-44    
ref|XP_009579506.1|  PREDICTED: eukaryotic translation initiation...    161   8e-44    
ref|XP_009155937.1|  eukaryotic translation initiation factor 3 s...    161   8e-44    
gb|KFZ50593.1|  Eukaryotic translation initiation factor 3 subunit I    161   9e-44    
ref|XP_009646824.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    161   1e-43    
ref|XP_007275339.1|  eukaryotic translation initiation factor 3 s...    161   1e-43    
ref|XP_004679476.1|  PREDICTED: eukaryotic translation initiation...    161   1e-43    
gb|AER57865.1|  eukaryotic translation initiation factor 3 subunit I    161   1e-43    
ref|XP_003006338.1|  eukaryotic translation initiation factor 3 3...    160   1e-43    
gb|KFM11279.1|  Eukaryotic translation initiation factor 3 subunit I    160   1e-43    
gb|KIP10178.1|  hypothetical protein PHLGIDRAFT_101502                  160   1e-43    
gb|KFY29465.1|  hypothetical protein V491_00021                         160   2e-43    
gb|KGK36833.1|  hypothetical protein JL09_g4016                         161   2e-43    
gb|EPB87416.1|  eukaryotic translation initiation factor 3 subunit I    160   2e-43    
emb|CCU81582.1|  eukaryotic translation initiation factor 3             160   2e-43    
gb|ELR06011.1|  eukaryotic translation initiation factor 3 subunit I    160   2e-43    
emb|CCF41099.1|  eukaryotic translation initiation factor 3 subun...    160   2e-43    
emb|CEP16495.1|  hypothetical protein                                   160   2e-43    
ref|XP_003345898.1|  hypothetical protein SMAC_06299                    160   2e-43    
gb|KFR06105.1|  Eukaryotic translation initiation factor 3 subunit I    160   2e-43    
ref|XP_006901315.1|  PREDICTED: eukaryotic translation initiation...    160   2e-43    
dbj|GAD97183.1|  conserved hypothetical protein                         162   2e-43    
ref|XP_001557202.1|  eukaryotic translation initiation factor 3         160   2e-43    
gb|KFQ08008.1|  Eukaryotic translation initiation factor 3 subunit I    160   2e-43    
gb|KDQ25934.1|  hypothetical protein PLEOSDRAFT_1066937                 160   2e-43    
emb|CDS04160.1|  hypothetical protein LRAMOSA07115                      160   3e-43    
gb|EIE82800.1|  hypothetical protein RO3G_07505                         160   3e-43    
ref|XP_003686526.1|  hypothetical protein TPHA_0G02570                  160   3e-43    
gb|EHK41282.1|  hypothetical protein TRIATDRAFT_301894                  160   3e-43    
ref|XP_003686473.1|  hypothetical protein TPHA_0G02030                  160   3e-43    
emb|CCA68444.1|  probable TIF34-translation initiation factor eIF...    160   3e-43    
ref|XP_002489628.1|  Subunit of the core complex of translation i...    160   3e-43    
emb|CDH49815.1|  eukaryotic translation initiation factor 3subunit      159   3e-43    
ref|XP_003664486.1|  hypothetical protein MYCTH_2307366                 160   3e-43    
ref|XP_010140742.1|  PREDICTED: eukaryotic translation initiation...    159   3e-43    
gb|KDQ15156.1|  hypothetical protein BOTBODRAFT_55005                   160   4e-43    
ref|XP_967415.1|  PREDICTED: eukaryotic translation initiation fa...    159   4e-43    
dbj|GAN06336.1|  eukaryotic translation initiation factor 3             159   4e-43    
gb|KIW11246.1|  eukaryotic translation initiation factor 3 subunit I    159   5e-43    
emb|CBN79425.1|  eukaryotic initiation factor eIF3 i subunit p36        158   5e-43    
ref|XP_007590242.1|  eukaryotic translation initiation factor 3 s...    159   5e-43    
ref|XP_006957701.1|  WD40 repeat-like protein                           159   6e-43    
gb|ESZ97118.1|  eukaryotic translation initiation factor 3 subunit 2    159   7e-43    
ref|XP_638213.1|  WD40 repeat-containing protein                        159   7e-43    
ref|XP_010759779.1|  eukaryotic translation initiation factor 3 s...    159   7e-43    
emb|CEJ88530.1|  Putative Eukaryotic translation initiation facto...    159   9e-43    
gb|KDQ62747.1|  hypothetical protein JAAARDRAFT_30657                   159   9e-43    
gb|KIW43678.1|  eukaryotic translation initiation factor 3 subunit I    159   9e-43    
gb|EDL30182.1|  eukaryotic translation initiation factor 3, subun...    155   1e-42    
ref|XP_011391197.1|  putative translation initiation factor eIF3 ...    159   1e-42    
ref|XP_956549.1|  eukaryotic translation initiation factor 3 subu...    159   1e-42    
ref|XP_003233083.1|  eukaryotic translation initiation factor 3 s...    158   1e-42    
gb|KEZ38705.1|  hypothetical protein SAPIO_CDS10728                     158   1e-42    
gb|EFX80147.1|  hypothetical protein DAPPUDRAFT_304176                  158   1e-42    
gb|KFW07927.1|  Eukaryotic translation initiation factor 3 subunit I    158   1e-42    
gb|EHK16486.1|  hypothetical protein TRIVIDRAFT_82783                   158   1e-42    
ref|XP_006963216.1|  predicted protein                                  158   1e-42    
emb|CEI97063.1|  Putative Eukaryotic translation initiation facto...    158   2e-42    
gb|KDN45029.1|  Eukaryotic translation initiation factor 3 subunit I    158   2e-42    
gb|KDB36155.1|  eukaryotic translation initiation factor 3 subunit I    158   2e-42    
gb|KFH40680.1|  Eukaryotic translation initiation factor 3 subuni...    158   2e-42    
ref|XP_002670116.1|  predicted protein                                  158   2e-42    
gb|KIW89036.1|  eukaryotic translation initiation factor 3 subunit I    158   2e-42    
gb|EFX03738.1|  eukaryotic translation initiation factor 3 subunit      158   2e-42    
ref|XP_003017741.1|  hypothetical protein ARB_04624                     158   2e-42    
gb|KFP10887.1|  Eukaryotic translation initiation factor 3 subunit I    157   2e-42    
ref|XP_007350612.1|  WD40 repeat-like protein                           157   2e-42    
ref|XP_007844868.1|  eukaryotic translation initiation factor 3 s...    157   2e-42    
gb|ERT02986.1|  eukaryotic translation initiation factor 3 subunit I    157   2e-42    
gb|EHJ63876.1|  eukaryotic translation initiation factor 3 subunit I    157   2e-42    
ref|XP_001595804.1|  eukaryotic translation initiation factor 3         157   3e-42    
gb|EWG40623.1|  eukaryotic translation initiation factor 3 subunit I    157   3e-42    
gb|EMT63386.1|  Eukaryotic translation initiation factor 3 subunit I    157   4e-42    
emb|CCK70464.1|  hypothetical protein KNAG_0E02020                      157   4e-42    
emb|CEG69327.1|  Putative Eukaryotic translation initiation facto...    157   4e-42    
ref|XP_002789752.1|  eukaryotic translation initiation factor 3 3...    157   5e-42    
ref|XP_003034029.1|  hypothetical protein SCHCODRAFT_66951              157   5e-42    
ref|XP_499703.1|  YALI0A02695p                                          157   5e-42    
ref|XP_002556539.1|  KLTH0H15752p                                       157   5e-42    
ref|XP_008024458.1|  hypothetical protein SETTUDRAFT_168745             157   6e-42    
ref|XP_009216201.1|  eukaryotic translation initiation factor 3 3...    156   6e-42    
gb|EJU03377.1|  WD40 repeat-like protein                                156   6e-42    
emb|CDK24887.1|  unnamed protein product                                156   7e-42    
emb|CBQ69136.1|  probable TIF34-translation initiation factor eIF...    157   7e-42    
ref|XP_003051107.1|  predicted protein                                  156   7e-42    
gb|KIL96311.1|  hypothetical protein FAVG1_01055                        156   7e-42    
gb|KFO34423.1|  Eukaryotic translation initiation factor 3 subunit I    163   7e-42    
ref|XP_007324107.1|  hypothetical protein SERLADRAFT_479895             156   8e-42    
gb|EST09283.1|  Eukaryotic translation initiation factor 3 subunit I    156   8e-42    
ref|XP_002122597.1|  PREDICTED: eukaryotic translation initiation...    155   9e-42    
gb|KIL66728.1|  hypothetical protein M378DRAFT_346878                   155   1e-41    
gb|EMP28420.1|  Alpha-taxilin                                           163   1e-41    
gb|KFA62828.1|  hypothetical protein S40285_03799                       155   1e-41    
gb|AAW25130.1|  SJCHGC02831 protein                                     155   1e-41    
gb|ACO15193.1|  Eukaryotic translation initiation factor 3 subunit I    155   1e-41    
ref|XP_449079.1|  hypothetical protein                                  155   1e-41    
ref|XP_003171390.1|  eukaryotic translation initiation factor 3 s...    155   1e-41    
ref|XP_003739333.1|  PREDICTED: eukaryotic translation initiation...    155   1e-41    
ref|XP_003289568.1|  hypothetical protein DICPUDRAFT_88573              155   2e-41    
ref|XP_002582844.1|  eukaryotic translation initiation factor 3 3...    155   2e-41    
dbj|GAA98846.1|  hypothetical protein E5Q_05534                         155   2e-41    
ref|XP_007007848.1|  hypothetical protein TREMEDRAFT_72409              156   2e-41    
gb|KIV82023.1|  eukaryotic translation initiation factor 3 subunit I    155   2e-41    
sp|A5DGL8.2|EIF3I_PICGU  RecName: Full=Eukaryotic translation ini...    155   2e-41    
gb|AAY32924.1|  TGF-beta receptor interacting protein 1                 155   2e-41    
gb|KIM53562.1|  hypothetical protein SCLCIDRAFT_432511                  155   2e-41    
ref|XP_002286220.1|  predicted protein                                  155   2e-41    
emb|CDI55194.1|  probable TIF34-translation initiation factor eIF...    155   2e-41    
ref|XP_002153410.1|  eukaryotic translation initiation factor 3 s...    155   2e-41    
ref|XP_001818333.1|  eukaryotic translation initiation factor 3 s...    155   2e-41    
ref|XP_004179253.1|  hypothetical protein TBLA_0B09190                  155   2e-41    
ref|XP_007380240.1|  WD40 repeat-like protein                           155   3e-41    
gb|KIH86806.1|  translation initiation factor 3 subunit I               155   3e-41    
gb|KIK23476.1|  hypothetical protein PISMIDRAFT_453749                  154   3e-41    
ref|XP_001208970.1|  eukaryotic translation initiation factor 3 s...    154   3e-41    
dbj|GAM40932.1|  translation initiation factor                          154   3e-41    



>ref|XP_009777666.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Nicotiana sylvestris]
Length=326

 Score =   402 bits (1032),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQ+ KLWDV+TGTQLFTFNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61   SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRI+ DP DQ GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD ETGK+
Sbjct  121  AIHVKRISKDPSDQVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDVETGKI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKKGITSL KS+DGSHFITGSLD
Sbjct  181  LKESDKEVGHKKGITSLQKSVDGSHFITGSLD  212


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L       GH   +     S D S  ITGS D++ KLWD+
Sbjct  161  IISAGEDAVIRIWDVETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T +  +  + P  +V  +            D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 + +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----QEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_009629813.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Nicotiana tomentosiformis]
Length=326

 Score =   401 bits (1030),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQ+ KLWDV+TGTQLFTFNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61   SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRI+ DP DQ GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD ETGK+
Sbjct  121  AIHVKRISRDPSDQIGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDVETGKI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKKGITSL KS+DGSHFITGSLD
Sbjct  181  LKESDKEVGHKKGITSLQKSVDGSHFITGSLD  212


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L       GH   +     S D S  ITGS D++ KLWD+
Sbjct  161  IISAGEDAVIRIWDVETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T +  +  + P  +V  +            D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 + +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----QEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_011095354.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Sesamum indicum]
Length=326

 Score =   399 bits (1026),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CDI
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWSCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDVKTGT L+TFNFDSP RSVDFAVGD+LAV+TTDPFMGLPS
Sbjct  61   SRDSTRLITGSADQTAKLWDVKTGTPLYTFNFDSPARSVDFAVGDRLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+KRIA DPEDQTGESVL +KG QGRINRAVWGPLN+TIIS GEDSV+RIWD+ETGKL
Sbjct  121  AIHIKRIARDPEDQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDSVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKK ITSL+KS DGSHF+TGSLD
Sbjct  181  LKESDKEDGHKKPITSLSKSTDGSHFLTGSLD  212


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD+
Sbjct  161  IISAGEDSVIRIWDSETGKLLKESDKEDGHKKPITSLSKSTDGSHFLTGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T   + T+  + P  +V      D  V     D  AV TTD   G   A    +I +  
Sbjct  221  RTLKLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_003517705.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   397 bits (1020),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM LPS
Sbjct  61   SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA+DP +QTGESVL +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIANDPAEQTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGHKK +TSLAKS DGSHF+TGSLD
Sbjct  181  LKESDKESGHKKTVTSLAKSADGSHFLTGSLD  212


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +L+KG +  +    +      + S  +D    +W ++ G+ L       GH   V     
Sbjct  140  LLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKTVTSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ +LWD +T T + T+  + P  +V      D  V     D  AV 
Sbjct  200  SADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_004489218.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   396 bits (1017),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLWDV++G QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSGRLITGSADQTAKLWDVQSGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP+DQTGES+L +KG QGRINRA+WGPLN+TIIS GEDSV+RIWD+ETGKL
Sbjct  121  AIHVKRIAKDPKDQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGHKK ITSLAKS DGSHF+TGSLD
Sbjct  181  LKESDKESGHKKTITSLAKSADGSHFLTGSLD  212


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDSVVRIWDSETGKLLKESDKESGHKKTITSLAKSADGSHFLTGSLDKSSKLWDA  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T + + T+  + P  +V  +            D  AV TTD   G   A    +I    
Sbjct  221  RTLSLVKTYVTERPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRV  314



>ref|XP_009777665.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nicotiana sylvestris]
Length=331

 Score =   394 bits (1012),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 201/217 (93%), Gaps = 5/217 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQ+ KLWDV+TGTQLFTFNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61   SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPED-----QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  605
            AIHVKRI+ DP D     + GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD 
Sbjct  121  AIHVKRISKDPSDRILCTEVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDV  180

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ETGK+LKESD+E GHKKGITSL KS+DGSHFITGSLD
Sbjct  181  ETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLD  217


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L       GH   +     S D S  ITGS D++ KLWD+
Sbjct  166  IISAGEDAVIRIWDVETGKILKESDKEVGHKKGITSLQKSVDGSHFITGSLDKSAKLWDI  225

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T +  +  + P  +V  +            D  AV TTD   G   A    +I    
Sbjct  226  RTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  283

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 + +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  284  -----QEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  319



>gb|KDP38201.1| hypothetical protein JCGZ_04844 [Jatropha curcas]
Length=326

 Score =   392 bits (1008),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLW+V+TGTQL++FNFDSP R+VDF+VGDKLAV+TTDPFM LPS
Sbjct  61   SRDSMRLITGSADQTAKLWNVQTGTQLYSFNFDSPARAVDFSVGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQTGESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPADQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKK ITSL KS DGSHF+TGSLD
Sbjct  181  LKESDKEVGHKKTITSLTKSSDGSHFVTGSLD  212


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD+
Sbjct  161  IISAGEDAVIRIWDSETGKLLKESDKEVGHKKTITSLTKSSDGSHFVTGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V  +            D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_008340535.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   392 bits (1007),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIASDPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIASDPEDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKE+D E GHKK ITSLAKS+DGSHF+TGSLD
Sbjct  181  LKENDPEVGHKKTITSLAKSVDGSHFLTGSLD  212


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ KLWD +T T + T+  + P  +V      D  V     D   V 
Sbjct  200  SVDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASMVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRSGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_004492932.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   392 bits (1007),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V++G QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSGRLITGSADQTVKLWNVQSGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQTGES+L +KG QGRINRA+WGPLN+TIIS GEDSV+RIWD+ETGKL
Sbjct  121  AIHVKRIAKDPADQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGHKK +TSL KS DGSHF+TGSLD
Sbjct  181  LKESDKESGHKKTVTSLVKSADGSHFLTGSLD  212


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   V     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDSVVRIWDSETGKLLKESDKESGHKKTVTSLVKSADGSHFLTGSLDKSAKLWDA  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T + + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  221  RTLSLVKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>gb|KCW69349.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=254

 Score =   389 bits (1000),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSAD T KLW V+ GTQLFTFNFDSP RSVDF++GDKLAV+TTDPFM LPS
Sbjct  61   SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFSIGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+ESD+E+GHKK +TSL KS+DGSHF+TGS D
Sbjct  181  LRESDKETGHKKAVTSLMKSVDGSHFVTGSQD  212



>ref|XP_007157442.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
 gb|AAK49947.1|AF335551_1 TGF-beta receptor-interacting protein 1 [Phaseolus vulgaris]
 gb|ESW29436.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
Length=326

 Score =   392 bits (1007),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM LPS
Sbjct  61   SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA+DP +QTG+SV+ +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIANDPTEQTGDSVVLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +KESD+ESGHKK +TSLAKS DGSHF+TGSLD
Sbjct  181  IKESDKESGHKKTVTSLAKSADGSHFLTGSLD  212


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +L+KG +  +    +      + S  +D    +W ++ G+ +       GH   V     
Sbjct  140  VLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKLIKESDKESGHKKTVTSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ +LWD +T T + T+  + P  +V      D  V     D  AV 
Sbjct  200  SADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_009351622.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pyrus x bretschneideri]
Length=326

 Score =   391 bits (1004),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIASDPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIASDPEDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKE+D E GHKK ITSLAKS+DG+HF+TGSLD
Sbjct  181  LKENDPEVGHKKTITSLAKSVDGTHFLTGSLD  212


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D +  +TGS D++ KLWD +T T + T+  + P  +V      D  V     D   V 
Sbjct  200  SVDGTHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASMVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRSGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_008443373.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis melo]
Length=326

 Score =   390 bits (1003),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLW+V+TG QLF+FNFDSP R+VDF+VGDKLAV+TTDPF+ LPS
Sbjct  61   SRDSMRLITGSADQTAKLWNVQTGQQLFSFNFDSPARAVDFSVGDKLAVITTDPFVELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP +QTGESVL +KG QGRINRAVWGPLNKTIISGGED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPSEQTGESVLLLKGPQGRINRAVWGPLNKTIISGGEDAVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKK ITSL K+ DGSHFITGSLD
Sbjct  181  LKESDKETGHKKTITSLTKASDGSHFITGSLD  212


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +L+KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LLLKGPQGRINRAVWGPLNKTIISGGEDAVVRIWDSETGKLLKESDKETGHKKTITSLTK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVM  410
            + D S  ITGS D++ KLWD +T T + T+  + P  +V  +            D  AV 
Sbjct  200  ASDGSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_006351166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum tuberosum]
Length=326

 Score =   390 bits (1003),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT  LWDV+TGTQL TF FDSP RSVDF+VGDKLAV+TTDPFMGL S
Sbjct  61   SRDSSRLITGSADQTAMLWDVQTGTQLHTFTFDSPARSVDFSVGDKLAVITTDPFMGLTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRI+ DP +Q  ESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWDAETGK+
Sbjct  121  AIHVKRISEDPSEQISESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKKGITSL KS+DGSHFITGSLD
Sbjct  181  LKESDKEIGHKKGITSLQKSVDGSHFITGSLD  212


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  140  LVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKILKESDKEIGHKKGITSLQK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVM  410
            S D S  ITGS D++ KLWD++T T +  +  + P  +V  +            D  AV 
Sbjct  200  SVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I +       E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILT-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_002521889.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF40525.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=326

 Score =   390 bits (1003),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYN+EGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNKEGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLWDVKTGTQL++FNFDSP R+VD +VGDKLAV+TTDPFM LPS
Sbjct  61   SRDSMRLITGSADQTAKLWDVKTGTQLYSFNFDSPARAVDLSVGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP++QTGESVL +KG QGRINRAVWGPLNKTI+S GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPDNQTGESVLVLKGPQGRINRAVWGPLNKTILSAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKK ITSL KS DGSHF+TGSLD
Sbjct  181  LKESDREIGHKKTITSLTKSSDGSHFLTGSLD  212


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LVLKGPQGRINRAVWGPLNKTILSAGEDAVIRIWDSETGKLLKESDREIGHKKTITSLTK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVM  410
            S D S  +TGS D++ KLWD++T T + T+  + P  +V  +            D  AV 
Sbjct  200  SSDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E V  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILQ-------EEVGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>gb|KCW69348.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=280

 Score =   389 bits (998),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSAD T KLW V+ GTQLFTFNFDSP RSVDF++GDKLAV+TTDPFM LPS
Sbjct  61   SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFSIGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+ESD+E+GHKK +TSL KS+DGSHF+TGS D
Sbjct  181  LRESDKETGHKKAVTSLMKSVDGSHFVTGSQD  212



>ref|XP_008220972.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Prunus mume]
Length=326

 Score =   390 bits (1002),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGD+LAV+TTDPFM L S
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDRLAVITTDPFMELSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA+DP DQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIANDPADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKE+D+E GHKK ITSLAKS+DGSHF+TGSLD
Sbjct  181  LKENDKEVGHKKTITSLAKSVDGSHFLTGSLD  212


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKTITSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ KLWD++T T + T+  + P  +V      D  V     D  AV 
Sbjct  200  SVDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    ++         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKVLQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>emb|CDP20306.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   390 bits (1002),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PT WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTGWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSS L+TGSADQT KLW+VKTGTQL+TFNFDSP RSVDF VGDKLAV+TTDPFMGLPS
Sbjct  61   SRDSSLLLTGSADQTAKLWNVKTGTQLYTFNFDSPTRSVDFGVGDKLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AI VKRIA DP DQ+GES+L +KG QGRINRAVWGPLNKTIISGGEDSV+RIWD+ETGKL
Sbjct  121  AIQVKRIARDPADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKKGITSL+KS D +HFI+GSLD
Sbjct  181  LKESDKEAGHKKGITSLSKSNDATHFISGSLD  212


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDSETGKLLKESDKEAGHKKGITSLSK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D++  I+GS D++ KLWD++T T L T+  + P  +V      D  V     D  AV 
Sbjct  200  SNDATHFISGSLDKSAKLWDMRTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    ++         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKVLQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_004136687.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 ref|XP_004159618.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 gb|KGN59537.1| hypothetical protein Csa_3G824820 [Cucumis sativus]
Length=326

 Score =   390 bits (1001),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLW+V+TG QLF+FNFDSP R+VDF+VGDKLAV+TTDPFM LPS
Sbjct  61   SRDSMRLITGSADQTAKLWNVQTGQQLFSFNFDSPARAVDFSVGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP +QTGESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPSEQTGESVLLLKGPQGRINRAVWGPLNKTIISAGEDAVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKK +TSL KS DGSHFITGSLD
Sbjct  181  LKESDKEIGHKKTVTSLTKSSDGSHFITGSLD  212


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +L+KG +  +    +      + S  +D    +W ++ G+ L       GH   V     
Sbjct  140  LLLKGPQGRINRAVWGPLNKTIISAGEDAVVRIWDSETGKLLKESDKEIGHKKTVTSLTK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVM  410
            S D S  ITGS D++ KLWD +T T + T+  + P  +V  +            D  AV 
Sbjct  200  SSDGSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>gb|EYU22708.1| hypothetical protein MIMGU_mgv1a009949mg [Erythranthe guttata]
Length=326

 Score =   389 bits (1000),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPT+WFADNGERLGTYRGHNGAVW CDI
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTLWFADNGERLGTYRGHNGAVWSCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+ LITGSADQT K+WDVKTGT LFTFNFDSP RSVDFAVGDKL V+TTDPFMGL S
Sbjct  61   SRDSTTLITGSADQTAKIWDVKTGTPLFTFNFDSPARSVDFAVGDKLVVITTDPFMGLSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+K +A+DP+DQTGESVL +KG QGRINRAVWGPLNKTIIS GEDSV+RIWD+ETGKL
Sbjct  121  AIHIKHVAADPDDQTGESVLVLKGPQGRINRAVWGPLNKTIISAGEDSVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKK ITSL+K+ DGSHF+TGSLD
Sbjct  181  LKESDKEDGHKKPITSLSKATDGSHFLTGSLD  212


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LVLKGPQGRINRAVWGPLNKTIISAGEDSVIRIWDSETGKLLKESDKEDGHKKPITSLSK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            + D S  +TGS D++ KLWD +T T + T+  + P  +V      D  V     D  +V 
Sbjct  200  ATDGSHFLTGSLDKSAKLWDSRTLTLMKTYVTERPVNAVAMSPLLDHVVLGGGQDASSVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I +       E +  +KGH G IN   + P  ++  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILT-------EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>gb|AES67165.2| eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=326

 Score =   389 bits (1000),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQT ES+L +KG QGRINRA+WGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIAKDPSDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKK ITSLAKS DGSHF TGSLD
Sbjct  181  LKESDKELGHKKTITSLAKSADGSHFCTGSLD  212


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S   TGS D++ K+WD 
Sbjct  161  IISAGEDAVIRIWDSETGKLLKESDKELGHKKTITSLAKSADGSHFCTGSLDKSAKIWDS  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T + + T+  + P  +V  +            D  AV TTD   G   A    +I    
Sbjct  221  RTLSLVKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_007222666.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
 gb|EMJ23865.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
Length=326

 Score =   388 bits (997),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VD +VGD+LAV+TTDPFM L S
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDLSVGDRLAVITTDPFMELSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA+DP DQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIANDPADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKE+D+E GHKK ITSLAKS+DGSHF+TGSLD
Sbjct  181  LKENDKEVGHKKTITSLAKSVDGSHFLTGSLD  212


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKTITSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ KLWD++T T + T+  + P  +V      D  V     D  AV 
Sbjct  200  SVDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    ++         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKVLQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_010937470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   388 bits (997),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQTVKLWDV+TG QL++FNFDSP R+VDF+VGDK AV+TTDPFMGLPS
Sbjct  61   SRDSTRLITGSADQTVKLWDVQTGVQLYSFNFDSPARAVDFSVGDKFAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I VKRI  DP  QTGESVLT+KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETG+L
Sbjct  121  TIQVKRIVRDPSQQTGESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GH+K +TSL KS DGSHF+TGSLD
Sbjct  181  LKESDKETGHQKTVTSLLKSADGSHFLTGSLD  212


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   V     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDAVIRIWDSETGQLLKESDKETGHQKTVTSLLKSADGSHFLTGSLDKSAKLWDS  220

Query  324  KTGTQLFTFNFDSPGRS------VDFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +      +D  V     D   V TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNACAISPLLDHVVLGGGQDASHVTTTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_008350825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=328

 Score =   388 bits (997),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIAGDPEDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKE+D E GHKK ITSLAKS DGSHF+TGSLD
Sbjct  181  LKENDPEVGHKKTITSLAKSXDGSHFLTGSLD  212


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ KLWD +T T + T+  + P  +V      D  V     D   V 
Sbjct  200  SXDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASTVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTII--SGGEDS  584
            TTD   G   A    +I         E +  +KGH G IN   + P  K +   SGGED 
Sbjct  260  TTDHRSGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKKVYFSSGGEDG  312

Query  585  VLRI  596
             +R+
Sbjct  313  YVRL  316



>ref|XP_008389128.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   388 bits (996),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TG QLFTFNFDSP R+VDF+VGDKLAV+TTDPFM + S
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFSVGDKLAVITTDPFMDVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DPEDQ GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIAGDPEDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKE+D E GHKK ITSLAKS DGSHF+TGSLD
Sbjct  181  LKENDPEVGHKKTITSLAKSXDGSHFLTGSLD  212


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L       GH   +     
Sbjct  140  LILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKTITSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ KLWD +T T + T+  + P  +V      D  V     D   V 
Sbjct  200  SXDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQDASTVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRSGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_010062244.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Eucalyptus grandis]
 gb|KCW69347.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=326

 Score =   388 bits (996),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSAD T KLW V+ GTQLFTFNFDSP RSVDF++GDKLAV+TTDPFM LPS
Sbjct  61   SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFSIGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+ESD+E+GHKK +TSL KS+DGSHF+TGS D
Sbjct  181  LRESDKETGHKKAVTSLMKSVDGSHFVTGSQD  212


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            ++++GH+  +    +      + S  +D    +W ++ G+ L       GH  AV     
Sbjct  140  LVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKLLRESDKETGHKKAVTSLMK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ KLWD++T T + T+  + P  +V      D  V     D  AV 
Sbjct  200  SVDGSHFVTGSQDKSAKLWDIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
             TD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  MTDHRAGKFEAKFFDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_009389562.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389563.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
Length=326

 Score =   387 bits (995),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQ+VKLW+V+TG QL++FNFDSP RSVDF+VGDKLAV+TTDPFMGLPS
Sbjct  61   SRDSMRLITGSADQSVKLWNVQTGAQLYSFNFDSPARSVDFSVGDKLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I VKRIA DP +Q+ ESVLT+KG QGRINRA+WGPLNKTIIS GED+V+R+WD ETG+L
Sbjct  121  TIQVKRIARDPNEQSSESVLTIKGPQGRINRAIWGPLNKTIISAGEDAVVRVWDTETGQL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GH+K +TSL+KS DGSHF+TGSLD
Sbjct  181  LKESDKETGHQKTVTSLSKSADGSHFLTGSLD  212


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    VW  + G+ L       GH   V     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDAVVRVWDTETGQLLKESDKETGHQKTVTSLSKSADGSHFLTGSLDKSAKLWDA  220

Query  324  KTGTQLFTFNFDSPGRS------VDFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +      +D  V     + + V TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNACAISPLLDHVVIGGGQEAVHVTTTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_010275012.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Nelumbo nucifera]
Length=247

 Score =   384 bits (987),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TGTQL+TFNFDSP RSVDF++GDKLAV+TTDPFM L S
Sbjct  61   SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFDSPTRSVDFSIGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ+GESVLT++G QGRINRA+WGPLN+TIIS GED+V+R+WD ETGKL
Sbjct  121  AIHVKRIARDPSDQSGESVLTIRGPQGRINRAIWGPLNRTIISAGEDAVIRVWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            + ESD+ESGH+K +TSLAKS D S+F+TGSLD
Sbjct  181  INESDKESGHQKTVTSLAKSADWSNFLTGSLD  212



>gb|EYU22777.1| hypothetical protein MIMGU_mgv1a009964mg [Erythranthe guttata]
Length=326

 Score =   386 bits (992),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CDI
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWSCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSS LITGSADQT K+WDVKTGT LFTFNFDSP RSVDFAVGDKL V+TTDPFMGL S
Sbjct  61   SRDSSTLITGSADQTAKIWDVKTGTPLFTFNFDSPARSVDFAVGDKLVVITTDPFMGLSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+K +A+DP+DQTGES+L +KG QGRINRAVWGPLNKTIIS GEDS++R+WD+ETGKL
Sbjct  121  AIHIKPVAADPDDQTGESILVLKGPQGRINRAVWGPLNKTIISAGEDSIIRVWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKK ITSL+K+ D SHF+TGSLD
Sbjct  181  LKESDKEDGHKKPITSLSKATDVSHFLTGSLD  212


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    VW ++ G+ L       GH   +     
Sbjct  140  LVLKGPQGRINRAVWGPLNKTIISAGEDSIIRVWDSETGKLLKESDKEDGHKKPITSLSK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            + D S  +TGS D++ KLWD +T T + T+  + P  +V      D  V     D  +V 
Sbjct  200  ATDVSHFLTGSLDKSAKLWDSRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASSVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I +       E +  +KGH G IN   + P  ++  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILT-------EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>ref|XP_004250371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum lycopersicum]
Length=326

 Score =   386 bits (991),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT  LWDV+TG QL TF FDSP RSVDF+VGDKLAV+TTDPFMGL S
Sbjct  61   SRDSSRLITGSADQTAMLWDVQTGAQLHTFTFDSPARSVDFSVGDKLAVITTDPFMGLTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+K I+ DP +Q  ESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWDAETGK+
Sbjct  121  AIHIKNISKDPSEQMSESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GHKKGITSL KS+DGSHFITGSLD
Sbjct  181  LKESDKEIGHKKGITSLQKSVDGSHFITGSLD  212


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  140  LVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKVLKESDKEIGHKKGITSLQK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVM  410
            S D S  ITGS D++ KLWD+++ T +  +  + P  +V  +            D  AV 
Sbjct  200  SVDGSHFITGSLDKSAKLWDIRSLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I +       E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFYDKILT-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>gb|KDO58632.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=305

 Score =   384 bits (987),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121  AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKK ITSLAK+ DGSHF+TGSLD
Sbjct  181  LKESDKETGHKKTITSLAKAADGSHFLTGSLD  212



>ref|XP_010926275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
 ref|XP_010926276.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   385 bits (989),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LITGSADQ+VKLW V+TG QL++FNFDSP ++VDF++GDKLA++TTDPFMGLPS
Sbjct  61   SRDSGLLITGSADQSVKLWSVQTGAQLYSFNFDSPAKAVDFSIGDKLAIITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I VKRIA DP +QT ESVLT+KG QGRINRAVWGPLNKTIISGGED+V+RIWDAETG+L
Sbjct  121  TIQVKRIARDPSEQTSESVLTIKGPQGRINRAVWGPLNKTIISGGEDAVVRIWDAETGQL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GH+K ITSL+KS DGSHF+TGSLD
Sbjct  181  LKESDKETGHQKTITSLSKSADGSHFLTGSLD  212


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH   +     S D S  +TGS D++ KLWD+
Sbjct  161  IISGGEDAVVRIWDAETGQLLKESDKETGHQKTITSLSKSADGSHFLTGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRS------VDFAV--GDKLA--VMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +      +D  V  G + A  V TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNACAISPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVRL  314



>ref|XP_006591952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
 gb|ACU23631.1| unknown [Glycine max]
Length=326

 Score =   385 bits (989),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV++G QL+TFNFDSP RSVDF+VGDKLAV+TTDPFM LPS
Sbjct  61   SRDSARLITGSADQTAKLWDVQSGLQLYTFNFDSPARSVDFSVGDKLAVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA+DP  Q GESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIANDPSQQIGESVLLIKGPQGRINRAIWGPLNTTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+ESD+ESGHKK +TSLAKS D SHF+TGSLD
Sbjct  181  LQESDKESGHKKTVTSLAKSADDSHFLTGSLD  212


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDI  260
            +L+KG +  +    +      + S  +D    +W ++ G+ L       GH   V     
Sbjct  140  LLIKGPQGRINRAIWGPLNTTIISAGEDAVIRIWDSETGKLLQESDKESGHKKTVTSLAK  199

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVM  410
            S D S  +TGS D++ +LWD ++ T + T+  + P  +V  +       +G   D  AV 
Sbjct  200  SADDSHFLTGSLDKSARLWDTRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVT  259

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  260  TTDHRAGKFEAKFFDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  312

Query  591  RI  596
            R+
Sbjct  313  RL  314



>gb|KDO58631.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=313

 Score =   384 bits (986),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121  AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKK ITSLAK+ DGSHF+TGSLD
Sbjct  181  LKESDKETGHKKTITSLAKAADGSHFLTGSLD  212



>ref|XP_006448046.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|ESR61286.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
Length=313

 Score =   384 bits (986),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121  AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKK ITSLAK+ DGSHF+TGSLD
Sbjct  181  LKESDKETGHKKTITSLAKAADGSHFLTGSLD  212



>ref|XP_010249002.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Nelumbo nucifera]
Length=326

 Score =   383 bits (984),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TGTQL+TFNF SP RSVDF++GDKLAV+TTDPFM L S
Sbjct  61   SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFGSPTRSVDFSIGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQTGESVLT+KG QGRINRA+WGPLN+TIIS GED+V R+WD ETGKL
Sbjct  121  AIHVKRIARDPSDQTGESVLTIKGPQGRINRAIWGPLNRTIISAGEDAVTRVWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            + ESD+ESGH+K +TSLAKS D SHF+TGSLD
Sbjct  181  INESDKESGHQKTVTSLAKSADWSHFLTGSLD  212


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    VW  + G+ +       GH   V     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDAVTRVWDTETGKLINESDKESGHQKTVTSLAKSADWSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V  +       +G   +   V TTD   G   A    +I    
Sbjct  221  RTLTLVKTYVTERPVNAVAMSPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_008808069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Phoenix dactylifera]
Length=326

 Score =   383 bits (984),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTY+GHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYKGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQ+VKLW+V+TG QL++FNFDSP R+VDF+VGDKLAV+TTDPFMGLPS
Sbjct  61   SRDSTRLITGSADQSVKLWNVQTGVQLYSFNFDSPARAVDFSVGDKLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I VKRIA DP  QTGESVLT+KG  GRINRAVWGPLNKTIIS GED+V+RIWD+ETG+L
Sbjct  121  TIQVKRIARDPSQQTGESVLTIKGPHGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GH+K ITSL+KS  GSHF++GSLD
Sbjct  181  LKESDKETGHQKPITSLSKSAKGSHFLSGSLD  212



>ref|XP_007016708.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007016709.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34327.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34328.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=326

 Score =   383 bits (983),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TGTQLFTFNFDSP RSVDFA+GDKLAV+TTDPFM L S
Sbjct  61   SRDSTRLITGSADQTAKLWNVQTGTQLFTFNFDSPARSVDFAIGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRI  D  +QTGESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRITRDATEQTGESVLVIKGPQGRINRAIWGPLNSTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E+D+ESGHKK ITSLAKS DGSHF+TGSLD
Sbjct  181  LREADKESGHKKPITSLAKSADGSHFLTGSLD  212


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWDV
Sbjct  161  IISAGEDAVIRIWDSETGKLLREADKESGHKKPITSLAKSADGSHFLTGSLDKSAKLWDV  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V  +            D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVALSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_006448047.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 ref|XP_006492275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Citrus sinensis]
 gb|ESR61287.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|KDO58630.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=326

 Score =   383 bits (983),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKL
Sbjct  121  AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKK ITSLAK+ DGSHF+TGSLD
Sbjct  181  LKESDKETGHKKTITSLAKAADGSHFLTGSLD  212


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L       GH   +     + D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDAIVRIWDTETGKLLKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLWDA  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T   + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  221  RTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_010275011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nelumbo nucifera]
Length=326

 Score =   382 bits (982),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V+TGTQL+TFNFDSP RSVDF++GDKLAV+TTDPFM L S
Sbjct  61   SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFDSPTRSVDFSIGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ+GESVLT++G QGRINRA+WGPLN+TIIS GED+V+R+WD ETGKL
Sbjct  121  AIHVKRIARDPSDQSGESVLTIRGPQGRINRAIWGPLNRTIISAGEDAVIRVWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            + ESD+ESGH+K +TSLAKS D S+F+TGSLD
Sbjct  181  INESDKESGHQKTVTSLAKSADWSNFLTGSLD  212


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    VW  + G+ +       GH   V     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDAVIRVWDTETGKLINESDKESGHQKTVTSLAKSADWSNFLTGSLDKSAKLWDA  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV--GDKLA--VMTTDPFMGLPSAIHVKRIASDP  473
            +T T +  +  + P  +V      D  V  G + A  V TTD   G   A    +I    
Sbjct  221  RTLTLIKAYVTERPVNAVAMSPLLDHVVLGGGQEASHVTTTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_010557463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   382 bits (982),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYN++GDLLFSCAKDH PTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNKDGDLLFSCAKDHTPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQTVKLWDV+TG  L+TFNF SP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61   SRDSARLITGSADQTVKLWDVQTGKPLYTFNFGSPARSVDFAVGDKLAVITTDPFMDLSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DPEDQ  ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPEDQVAESVLVLKGVQGRINRAVWGPLNRTIISAGEDAVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  LKESDKEAGHKKTITSLCKAADSSHFLTGSLD  212


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     + DSS  +TGS D++ KLWD 
Sbjct  161  IISAGEDAVVRIWDSETGKLLKESDKEAGHKKTITSLCKAADSSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V      D  V     D  AV TTD   G   A    ++    
Sbjct  221  RTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKLLL--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_002285281.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Vitis vinifera]
 emb|CAN80198.1| hypothetical protein VITISV_030908 [Vitis vinifera]
 emb|CBI26753.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   382 bits (982),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSMRLITGSADQTVKLWNVETGAQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP  QT ES L +KG QGRINRA+WGPLN+TIIS GED+++RIWD+ETGKL
Sbjct  121  AIHVKRIARDPSQQTAESALVIKGPQGRINRAIWGPLNRTIISAGEDAIVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GHKK +TSL+K++DGSHF+TGSLD
Sbjct  181  LKESDKETGHKKTVTSLSKAVDGSHFVTGSLD  212


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   V     + D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDAIVRIWDSETGKLLKESDKETGHKKTVTSLSKAVDGSHFVTGSLDKSAKLWDS  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V      D  V     D   V TTD   G   A    +I    
Sbjct  221  RTLTLIKTYLTERPVNAVTMSPLLDHVVLGGGQDASHVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_003534423.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   380 bits (977),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLWDV++G QL+TFNFDSP RSVDF+VGD+LAV+TTDPFM L S
Sbjct  61   SRDSVRLITGSADQTAKLWDVQSGLQLYTFNFDSPARSVDFSVGDRLAVITTDPFMELSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP +Q+GES+L +KG  GRINRA+WGPLN TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIADDPTEQSGESLLLIKGPLGRINRAIWGPLNSTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGHKK +TSLAKS DGSHF+TGSLD
Sbjct  181  LKESDKESGHKKTVTSLAKSADGSHFLTGSLD  212


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   V     S D S  +TGS D++ +LWD 
Sbjct  161  IISAGEDAVIRIWDSETGKLLKESDKESGHKKTVTSLAKSADGSHFLTGSLDKSARLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            ++ T + T+  + P  +V  +       +G   D  AV TTD   G   A    +I    
Sbjct  221  RSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>gb|KJB26173.1| hypothetical protein B456_004G228300 [Gossypium raimondii]
Length=250

 Score =   377 bits (968),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V+ GTQL+TFNF SP RSV+FA+GDKLAV+TTDPFM L S
Sbjct  61   SRDSMRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFAIGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA D  +QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIAGDSTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGHKK ITSL K+ DGSHF++GSLD
Sbjct  181  LKESDKESGHKKTITSLTKAADGSHFLSGSLD  212



>gb|KJB56104.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=269

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP +QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E+D+ESGHKK ITSL KS DGSHF+TGSLD
Sbjct  181  LREADKESGHKKTITSLTKSADGSHFLTGSLD  212



>gb|KHG16392.1| Eukaryotic translation initiation factor 3 subunit I -like protein 
[Gossypium arboreum]
Length=326

 Score =   379 bits (974),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQTVKLW+V+ GTQL+TFNF SP RSV+FA+GDKLAV+TTDPFM L S
Sbjct  61   SRDSTRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFAIGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP +QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIAGDPTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGHKK ITSL K+ DGSHF++GSLD
Sbjct  181  LKESDKESGHKKTITSLTKAADGSHFLSGSLD  212


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     + D S  ++GS D++ KLWD 
Sbjct  161  IISAGEDAVIRIWDSETGKLLKESDKESGHKKTITSLTKAADGSHFLSGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T++ + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKTYSTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_008782131.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Phoenix dactylifera]
Length=326

 Score =   379 bits (974),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DS  LITGSADQ+VKLW+V+TG QL+TFNF SP R+VDF+VGDKLAV+TTDPFMGLPS
Sbjct  61   SHDSGLLITGSADQSVKLWNVQTGAQLYTFNFGSPARAVDFSVGDKLAVITTDPFMGLPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I VK+IA DP +QT ESVLT+KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETG+L
Sbjct  121  TIQVKQIARDPSEQTSESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVVRIWDSETGQL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GH+K +TSL+KS DGSHF+TGSLD
Sbjct  181  LKESDKETGHQKTVTSLSKSADGSHFLTGSLD  212


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   V     S D S  +TGS D++ KLWD+
Sbjct  161  IISAGEDAVVRIWDSETGQLLKESDKETGHQKTVTSLSKSADGSHFLTGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRS------VDFAV--GDKLA--VMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +      +D  V  G + A  V TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNACAISPLLDHVVMGGGQEASHVTTTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_003596914.1| Eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=321

 Score =   379 bits (972),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  96   MKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSS  275
            MKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+SRDS 
Sbjct  1    MKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDVSRDSG  60

Query  276  RLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHVK  455
            RLITGSADQT KLW+V+TG QLFTFNFDSP RSVDF+VGDKLAV+TTDPFM L SAIHVK
Sbjct  61   RLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFSVGDKLAVITTDPFMELSSAIHVK  120

Query  456  RIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESD  635
            RIA DP DQT ES+L +KG QGRINRA+WGPLNKTIIS GED+V+RIWD+ETGKLLKESD
Sbjct  121  RIAKDPSDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRIWDSETGKLLKESD  180

Query  636  QESGHKKGITSLAKSIDGSHFITGSLD  716
            +E GHKK ITSLAKS DGSHF TGSLD
Sbjct  181  KELGHKKTITSLAKSADGSHFCTGSLD  207


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S   TGS D++ K+WD 
Sbjct  156  IISAGEDAVIRIWDSETGKLLKESDKELGHKKTITSLAKSADGSHFCTGSLDKSAKIWDS  215

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T + + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  216  RTLSLVKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  273

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  274  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  309



>gb|EPS73291.1| hypothetical protein M569_01462 [Genlisea aurea]
Length=326

 Score =   378 bits (971),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPT WFADNGERLGTYRGHNGAVW CDI
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTAWFADNGERLGTYRGHNGAVWSCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLW+VKTGT L+TFNFDSP RSVDFA+GD LAV+TTDPFM L S
Sbjct  61   SRDSGRLITGSADQTAKLWNVKTGTPLYTFNFDSPARSVDFAIGDNLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+KRI+ DP DQTGESVL +KG QGRINRAVWGPLN+TI+S GED+V+R WDAETGKL
Sbjct  121  AIHIKRISGDPADQTGESVLVLKGPQGRINRAVWGPLNRTIVSAGEDAVIRRWDAETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E+D+E  HKK ITSL+KS DGSHF+TGSLD
Sbjct  181  LQETDKEESHKKPITSLSKSTDGSHFLTGSLD  212


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D     W A+ G+ L        H   +     S D S  +TGS D++ KLWD 
Sbjct  161  IVSAGEDAVIRRWDAETGKLLQETDKEESHKKPITSLSKSTDGSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T   + T+  + P  +V      D  V     D  AV TTD   G   A    +I +  
Sbjct  221  RTLKLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>gb|KJB56102.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=318

 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP +QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E+D+ESGHKK ITSL KS DGSHF+TGSLD
Sbjct  181  LREADKESGHKKTITSLTKSADGSHFLTGSLD  212



>ref|XP_010521568.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   378 bits (971),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYN++GDLLFSCAKDH PTVW+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNKDGDLLFSCAKDHTPTVWYADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSARLITGSADQTVKLWEVQTGKQLYTFNFGSPARSVDFSVGDKLAVITTDPFMDLSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVK IA DPEDQ  +SVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWDAETGKL
Sbjct  121  AIHVKHIARDPEDQVADSVLVLKGVQGRINRAVWGPLNRTIISAGEDAVIRIWDAETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L ESD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  LNESDKEVGHKKAITSLCKAADSSHFLTGSLD  212


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH  A+     + DSS  +TGS D++ KLWD 
Sbjct  161  IISAGEDAVIRIWDAETGKLLNESDKEVGHKKAITSLCKAADSSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKTYGTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILL--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>gb|EPS65969.1| hypothetical protein M569_08807 [Genlisea aurea]
Length=326

 Score =   377 bits (969),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW CDI
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWSCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQT KLWDVKTG  L+TF FDSP RSVDFAVGDK  V+TTD FM L S
Sbjct  61   SRDSKRLITGSADQTAKLWDVKTGKPLYTFEFDSPARSVDFAVGDKFVVITTDTFMELSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+KRIASDP++QTGES+LT+KG QGRINRA+WGPLN+TI+S GED+V+RIWD ETGKL
Sbjct  121  AIHIKRIASDPDEQTGESLLTLKGPQGRINRAIWGPLNRTIVSAGEDAVIRIWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+SD+E  HKK ITSL+KS DGSHF+TGSLD
Sbjct  181  LKQSDKEESHKKPITSLSKSTDGSHFLTGSLD  212


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L        H   +     S D S  +TGS D++ KLWD 
Sbjct  161  IVSAGEDAVIRIWDTETGKLLKQSDKEESHKKPITSLSKSTDGSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T   + T+  + P  +V      D  V     D  AV TTD   G   A    +I +  
Sbjct  221  RTIKLIKTYVTERPVNAVAISPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILT--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>gb|KJB56100.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=326

 Score =   376 bits (965),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP RSVDF+VGDKLAV+TTDPFM L S
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFSVGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP +QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E+D+ESGHKK ITSL KS DGSHF+TGSLD
Sbjct  181  LREADKESGHKKTITSLTKSADGSHFLTGSLD  212


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_010111947.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
 gb|EXC32128.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
Length=429

 Score =   380 bits (975),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/240 (78%), Positives = 207/240 (86%), Gaps = 8/240 (3%)
 Frame = +3

Query  21   LSHRIKLFGNQKNLQSRNKK--------MRPILMKGHERPLTFLKYNREGDLLFSCAKDH  176
            L H+ ++F N+  L+ + KK        MRPILMKGHERPLTFLKYNREGDLLFSCAKDH
Sbjct  76   LWHKERIFLNRPPLEKKKKKKKKKKRKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDH  135

Query  177  NPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNF  356
             PTVWFADNGERLGTYRGHNGAVW CD+SRDS RLITGSADQ+ KLWDV+TG QL TFNF
Sbjct  136  TPTVWFADNGERLGTYRGHNGAVWSCDVSRDSIRLITGSADQSAKLWDVRTGHQLHTFNF  195

Query  357  DSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRA  536
            DSP RSVDF+VGDKLAV+TTDPFMG  SAIHVKRIA DP+DQT ESVL +KG QGRINRA
Sbjct  196  DSPARSVDFSVGDKLAVITTDPFMGHTSAIHVKRIADDPDDQTSESVLVIKGPQGRINRA  255

Query  537  VWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            VWGPLN+TIISGGED+++RIWD+ETGKLL ESD+E  HKK ITSLAKS+DGSHF+TGS D
Sbjct  256  VWGPLNQTIISGGEDTIIRIWDSETGKLLNESDKEVSHKKNITSLAKSVDGSHFLTGSHD  315


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDI  260
            +++KG +  +    +      + S  +D    +W ++ G+ L        H   +     
Sbjct  243  LVIKGPQGRINRAVWGPLNQTIISGGEDTIIRIWDSETGKLLNESDKEVSHKKNITSLAK  302

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ KLWD +T T + T+  + P  +V      D  V     D  +V 
Sbjct  303  SVDGSHFLTGSHDKSAKLWDTRTLTLIKTYTTERPVNAVAMSPLLDHVVLGGGQDASSVT  362

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  363  TTDHRAGKFEAKFFDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  415

Query  591  RI  596
            R+
Sbjct  416  RL  417



>gb|ABK94219.1| unknown [Populus trichocarpa]
Length=326

 Score =   376 bits (965),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LIT SADQ+VKLW+V+TG QLFTFNF+SP RSVDF+VGDKLAV+TTDPFMG+ S
Sbjct  61   SRDSMLLITASADQSVKLWNVQTGAQLFTFNFNSPARSVDFSVGDKLAVITTDPFMGVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AI+VK IA DP  Q+GESVLT+ G  GRINRAVWG LNKTIIS GEDSV+RIWD+ETGKL
Sbjct  121  AINVKSIAEDPSQQSGESVLTITGPTGRINRAVWGSLNKTIISAGEDSVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD E GHKK ITSL KS DGSHF+TGSLD
Sbjct  181  LKESDPEVGHKKPITSLTKSADGSHFLTGSLD  212


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDSVVRIWDSETGKLLKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V  +            D  +V TTD   G   A    ++    
Sbjct  221  RTLTLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>gb|KJB26172.1| hypothetical protein B456_004G228300 [Gossypium raimondii]
Length=326

 Score =   375 bits (962),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V+ GTQL+TFNF SP RSV+FA+GDKLAV+TTDPFM L S
Sbjct  61   SRDSMRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFAIGDKLAVITTDPFMELTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA D  +QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  121  AIHVKRIAGDSTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGHKK ITSL K+ DGSHF++GSLD
Sbjct  181  LKESDKESGHKKTITSLTKAADGSHFLSGSLD  212


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     + D S  ++GS D++ KLWD 
Sbjct  161  IISAGEDAVIRIWDSETGKLLKESDKESGHKKTITSLTKAADGSHFLSGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T++ + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  221  RTLTLIKTYSTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_002311556.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEE88923.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=326

 Score =   374 bits (960),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS +LIT SADQ+VKLW+V+TG QL+TF+F+SP RSVDF+VGDKLAV+TTDPFMG+ S
Sbjct  61   SRDSMQLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFSVGDKLAVITTDPFMGVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AI+VKRIA DP  Q+GESVLT+ G  GRINRAVWGPLN+TIIS GED V+RIWD+ETGKL
Sbjct  121  AINVKRIADDPSQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKES+ E GHKK I+SL KS DGSHF+TGSLD
Sbjct  181  LKESEPEVGHKKPISSLTKSADGSHFLTGSLD  212


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDCVVRIWDSETGKLLKESEPEVGHKKPISSLTKSADGSHFLTGSLDKSAKLWDS  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T +  +  + P  +V  +            D  +V TTD   G   A    +I    
Sbjct  221  RTLTLIKNYTTERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_011021700.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   374 bits (959),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LIT SADQ+VKLW+V+TG QL+TF+F+SP RSVDF+VGDK AV+TTDPFMG+ S
Sbjct  61   SRDSMLLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFSVGDKFAVITTDPFMGVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AI+VK IA DP  Q+GES+LT+ G  GRINRAVWGPLNKTIIS GEDSV+RIWD+ETGKL
Sbjct  121  AINVKNIADDPSQQSGESMLTITGPTGRINRAVWGPLNKTIISAGEDSVIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD E GHKK ITSL KS DGSHF+TGSLD
Sbjct  181  LKESDPEVGHKKPITSLTKSADGSHFLTGSLD  212


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDSVIRIWDSETGKLLKESDPEVGHKKPITSLTKSADGSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +  T + T+  + P  +V  +            D  +V TTD   G   A    ++    
Sbjct  221  RNLTLIKTYATERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKVLQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGESFSSGGEDGYVRL  314



>ref|XP_011024978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   371 bits (953),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS +LIT SADQ+VKLW+V+TG QL+TF+F+SP RSVDF+VGDKLAV+TTDPFM + S
Sbjct  61   SRDSMQLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFSVGDKLAVITTDPFMEVTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AI+VKRIA DP  Q+GESVLT+ G  GRINRAVWGPLN+TIIS GED V+RIWD+ETGKL
Sbjct  121  AINVKRIADDPSQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKES+ E GHKK I+SL KS DGSHF+TGSLD
Sbjct  181  LKESEPEVGHKKPISSLTKSADGSHFLTGSLD  212


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IISAGEDCVVRIWDSETGKLLKESEPEVGHKKPISSLTKSADGSHFLTGSLDKSAKLWDS  220

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T +  +  + P  +V      D  V     D  +V TTD   G   A    +I    
Sbjct  221  RTLTLIKNYTTERPVNAVAMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  314



>ref|XP_009151956.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151957.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
Length=328

 Score =   369 bits (948),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 193/214 (90%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVKTGTQLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKLWDVKTGTQLFSFKFSSPARSVDFSVGDKLAVITTDPFMARTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DP+DQ GESVL ++  +G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121  AIHVKRIADDPQDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKE+D+E GHK+ ITSL KS D SHF+TGSLD
Sbjct  181  KLLKETDKEVGHKQTITSLCKSADDSHFLTGSLD  214


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH   +     S D S  +TGS D+T KLWD+
Sbjct  163  IVSGGEDAVLRIWDAETGKLLKETDKEVGHKQTITSLCKSADDSHFLTGSLDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+    P  +V  +       +G   D  AV TTD   G   A    +I    
Sbjct  223  RTLTLIKTYTSGVPVNAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  316



>gb|KFK37423.1| hypothetical protein AALP_AA4G255300 [Arabis alpina]
Length=328

 Score =   367 bits (943),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 192/214 (90%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWCCDI
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWCCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQTVKLWDVK+G   FTF F SP RSVDFAVGDKLAV+T+DPFM   S
Sbjct  61   SRDSSRLITGSADQTVKLWDVKSGKPYFTFKFGSPARSVDFAVGDKLAVITSDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ  +SVL ++  +G  RINRAVWGPLN+TI+SGGED+V+RIWDAETG
Sbjct  121  AIHVKRIAEDPEDQVADSVLVLQSPEGRMRINRAVWGPLNQTIVSGGEDAVIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKES++E GHKK ITSL+KS D SHFITGSLD
Sbjct  181  KLLKESNEEDGHKKPITSLSKSADDSHFITGSLD  214


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D+T KLWD+
Sbjct  163  IVSGGEDAVIRIWDAETGKLLKESNEEDGHKKPITSLSKSADDSHFITGSLDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V  +       +G   D  AV TTD   G   A    +I    
Sbjct  223  RTLTLIKTYTSNVPVNAVSISPLLDHVVIGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  316



>emb|CDY13713.1| BnaA06g32100D [Brassica napus]
Length=344

 Score =   367 bits (943),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 193/214 (90%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVKTGTQLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKLWDVKTGTQLFSFKFSSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DP+DQ GESVL ++  +G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121  AIHVKRIADDPQDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKE+D+E GHK+ ITSL KS D SHF+TGSLD
Sbjct  181  KLLKETDKEVGHKQTITSLCKSADDSHFLTGSLD  214



>ref|XP_006294579.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
 gb|EOA27477.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
Length=328

 Score =   367 bits (941),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDV++G QLFTF F SP RSVDFAVGD LAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGQQLFTFKFGSPARSVDFAVGDHLAVITTDPFMERNS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ  ESVL +   +G  RINRAVWGPLN+TI+SGGED+V+RIWD ETG
Sbjct  121  AIHVKRIAEDPEDQVDESVLVLPSAEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDTETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LLKESD+E GHKK ITSL+K+ D SHFITGSLD
Sbjct  181  QLLKESDEEVGHKKAITSLSKAADDSHFITGSLD  214



>ref|XP_004297796.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   363 bits (932),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH P VWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPNVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDV++G Q+FTFNFDSP RSV+F+VGD+LAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGHQVFTFNFDSPTRSVEFSVGDRLAVITTDPFMEQTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMK-GHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAET  611
            AIHVKRIA+DP DQT ES+LT+K   QGR  INRAVWGPLN+TIIS GED+++RIWD+ET
Sbjct  121  AIHVKRIAADPADQTAESILTLKITPQGRMKINRAVWGPLNRTIISAGEDAIIRIWDSET  180

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            GKLL+E+ +E GH K ITSL KS DGSHF+TGSLD
Sbjct  181  GKLLQENQKEDGHTKTITSLVKSPDGSHFLTGSLD  215


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L   +   GH   +     S D S  +TGS D++ KLWD 
Sbjct  164  IISAGEDAIIRIWDSETGKLLQENQKEDGHTKTITSLVKSPDGSHFLTGSLDKSAKLWDT  223

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  +SP  +V  +            D + V TTD   G   A    +I    
Sbjct  224  RTLTLIKTYRTESPVNAVAMSPLLNHVVLGGGQDAINVTTTDHRAGKFEAKFYDKILQ--  281

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  282  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYIRL  317



>ref|XP_010425732.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camelina sativa]
Length=356

 Score =   363 bits (933),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 192/217 (88%), Gaps = 2/217 (1%)
 Frame = +3

Query  72   NKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWC  251
            + KMRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWC
Sbjct  26   DTKMRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWC  85

Query  252  CDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMG  431
            CD+SRDSSRLITGSADQT KLWDV++G +LFTF F SP RSVDFAVGD LAV+TTDPFM 
Sbjct  86   CDVSRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFAVGDHLAVITTDPFME  145

Query  432  LPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDA  605
              SAIHVKRIA DP+DQ  +SVL ++  +G  RINRAVWGPLN+TI+SGGED+V+RIWD+
Sbjct  146  RTSAIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDS  205

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ETGKLLKESD E GHKK ITSL K+ D SHFITGSLD
Sbjct  206  ETGKLLKESDGEVGHKKPITSLCKAADDSHFITGSLD  242


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYRG---HNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L    G   H   +     + D S  ITGS D+T KLWD+
Sbjct  191  IVSGGEDAVIRIWDSETGKLLKESDGEVGHKKPITSLCKAADDSHFITGSLDKTAKLWDM  250

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T++   P  +V  +            D  AV TTD   G   A    +I    
Sbjct  251  RTLTLIKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  308

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  309  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  344



>emb|CDY71621.1| BnaAnng38210D [Brassica napus]
Length=344

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 192/214 (90%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHIPTLWYADNGERHGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVKT TQLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKLWDVKTETQLFSFKFSSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DP+DQ G+SVL ++  +G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121  AIHVKRIAEDPQDQDGDSVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKE+D+E GHK+ ITSL KS D SHF+TGSLD
Sbjct  181  KLLKETDKEVGHKQTITSLCKSADDSHFLTGSLD  214



>gb|ABK26793.1| unknown [Picea sitchensis]
Length=326

 Score =   362 bits (929),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+  NGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYGHNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLIT SADQTVKLW+V+TGTQLF+FNF+SP R+VD A GDKL V+TTDPFM LPS
Sbjct  61   SRDSTRLITSSADQTVKLWNVETGTQLFSFNFESPARAVDLAEGDKLVVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+KRI  D   Q+ +S+LT+ G +GRINRAVWGPLN+TIISGGED+V+RIWD+ETGKL
Sbjct  121  AIHIKRIEKDLSKQSADSILTITGIKGRINRAVWGPLNRTIISGGEDAVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+ES++E+GH+K ITSL KS DGSHF+TGSLD
Sbjct  181  LRESEKETGHQKPITSLFKSADGSHFLTGSLD  212


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD+
Sbjct  161  IISGGEDAVVRIWDSETGKLLRESEKETGHQKPITSLFKSADGSHFLTGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V  +       +G   +   V TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVAISPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILE--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVRL  314



>gb|ABR18068.1| unknown [Picea sitchensis]
Length=326

 Score =   362 bits (928),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+  NGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYGHNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLIT SADQTVKLW+V+TGTQLF+FNF+SP R+VD A GDKL V+TTDPFM LPS
Sbjct  61   SRDSTRLITSSADQTVKLWNVETGTQLFSFNFESPARAVDLAEGDKLVVITTDPFMELPS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+KRI  D   Q+ +S+LT+ G +GRINRAVWGPLN+TIISGGED+V+RIWD+ETGKL
Sbjct  121  AIHIKRIEKDLSKQSADSILTITGIKGRINRAVWGPLNRTIISGGEDAVVRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+ES++E+GH+K ITSL KS DGSHF+TGSLD
Sbjct  181  LRESEKETGHQKPITSLFKSADGSHFLTGSLD  212


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD+
Sbjct  161  IISGGEDAVVRIWDSETGKLLRESEKETGHQKPITSLFKSADGSHFLTGSLDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V  +       +G   +   V TTD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVAISPLLDHVVIGGGQEASHVTTTDRRAGKFEAKFFHKILE--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVRL  314



>ref|NP_973697.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 gb|AEC10669.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
Length=254

 Score =   359 bits (921),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121  AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLD  214



>ref|XP_010514644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Camelina sativa]
 ref|XP_010514645.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Camelina sativa]
Length=328

 Score =   362 bits (928),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 191/214 (89%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDV++G +LFTF F SP RSVDF+VGD LAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFSVGDHLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DP+DQ  +SVL ++  +G  RINRAVWGPLN+TI+SGGED+V+RIWD+ETG
Sbjct  121  AIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDSETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKESD E GHKK ITSLAK+ D SHFITGSLD
Sbjct  181  KLLKESDGEVGHKKPITSLAKAADDSHFITGSLD  214


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYRG---HNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L    G   H   +     + D S  ITGS D+T KLWD+
Sbjct  163  IVSGGEDAVIRIWDSETGKLLKESDGEVGHKKPITSLAKAADDSHFITGSLDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T L T++   P  +V  +            D  AV TTD   G   A    +I    
Sbjct  223  RTLTLLKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  316



>ref|XP_010502959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=328

 Score =   362 bits (928),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 191/214 (89%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDV++G +LFTF F SP RSVDF+VGD LAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFSVGDHLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DP+DQ  +SVL ++  +G  RINRAVWGPLN+TI+SGGED+V+RIWD+ETG
Sbjct  121  AIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDSETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKESD E GHKK ITSLAK+ D SHFITGSLD
Sbjct  181  KLLKESDGEVGHKKPITSLAKAADDSHFITGSLD  214


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYRG---HNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L    G   H   +     + D S  ITGS D+T KLWD+
Sbjct  163  IVSGGEDAVIRIWDSETGKLLKESDGEVGHKKPITSLAKAADDSHFITGSLDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T++   P  +V  +            D  AV TTD   G   A    +I    
Sbjct  223  RTLTLIKTYSTVVPVNAVTMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  316



>ref|XP_009129412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brassica rapa]
Length=328

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GT+RGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTFRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQ+ KLWDVKTG QLF+F F SP RSVDFA+GDKLAV+TTDPFM   S
Sbjct  61   SRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFALGDKLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ  ESVL ++   G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121  AIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKESD E GHK  ITSL KS D SHFITGSLD
Sbjct  181  KLLKESDSEVGHKNTITSLTKSADDSHFITGSLD  214


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L    +  GH   +     S D S  ITGS D+T KLWD+
Sbjct  163  IVSGGEDAVLRIWDAETGKLLKESDSEVGHKNTITSLTKSADDSHFITGSLDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T L T+    P  +V  +            D  AV TTD   G   A    +I    
Sbjct  223  RTLTLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  316



>emb|CDY34145.1| BnaA02g28950D [Brassica napus]
Length=330

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GT+RGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTFRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQ+ KLWDVKTG QLF+F F SP RSVDFA+GDKLAV+TTDPFM   S
Sbjct  61   SRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFALGDKLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ  ESVL ++   G  RINRAVWGPLN+TI+SGGED+VLRIWDAETG
Sbjct  121  AIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKESD E GHK  ITSL KS D SHFITGSLD
Sbjct  181  KLLKESDSEVGHKNTITSLTKSADDSHFITGSLD  214


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 71/163 (44%), Gaps = 22/163 (13%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVK--LW  317
            + S  +D    +W A+ G+ L    +  GH   +     S D S  ITGS D+T K  LW
Sbjct  163  IVSGGEDAVLRIWDAETGKLLKESDSEVGHKNTITSLTKSADDSHFITGSLDKTAKACLW  222

Query  318  DVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIAS  467
            D++T T L T+    P  +V  +            D  AV TTD   G   A    +I  
Sbjct  223  DMRTLTLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  282

Query  468  DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                   E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  283  -------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  318



>ref|NP_182152.2| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEC10672.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 191/220 (87%), Gaps = 2/220 (1%)
 Frame = +3

Query  63   QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  242
            Q+   +MRPILMKGHERPLTFL+YNR GDLLFSCAKDH PTVWFADNGERLGTYRGH+GA
Sbjct  22   QTLETRMRPILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLGTYRGHSGA  81

Query  243  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  422
            VWCCDISRDSSRLITGSADQT KLWDVK+G +LFTF F +P RSVDF+VGD LAV+TTD 
Sbjct  82   VWCCDISRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFSVGDHLAVITTDH  141

Query  423  FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRI  596
            F+G  SAIHVKRIA DPEDQ G+SVL ++   G  +INRAVWGPLN+TI+SGGED+ +RI
Sbjct  142  FVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRI  201

Query  597  WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            WDAETGKLLK+SD+E GHK+ ITSL K+ D SHF+TGS D
Sbjct  202  WDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHD  241


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH  A+     + D S  +TGS D+T KLWD+
Sbjct  190  IVSGGEDAAIRIWDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDM  249

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+    P  +V  +            D  AV TTD   G   A     I    
Sbjct  250  RTLTLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQ--  307

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  308  -----EEIGGVKGHFGPINALAFSPDGKSFSSGGEDGYVRL  343



>ref|NP_182151.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 ref|NP_850450.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 sp|Q38884.2|EIF3I_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TGF-beta receptor-interacting 
protein 1; Short=TRIP-1; AltName: Full=eIF-3-beta; 
AltName: Full=eIF3 p36 [Arabidopsis thaliana]
 gb|AAC62878.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 dbj|BAE98705.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AEC10670.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 gb|AEC10671.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
Length=328

 Score =   358 bits (918),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121  AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLD  214



>gb|AAK43862.1|AF370485_1 eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AAL47346.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   357 bits (917),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121  AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLD  214



>dbj|BAH19940.1| AT2G46280 [Arabidopsis thaliana]
Length=328

 Score =   357 bits (916),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121  AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLD  214



>ref|XP_006395438.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32724.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=289

 Score =   355 bits (911),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGER GTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT K+W+VKTG QLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKIWEVKTGRQLFSFKFGSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ  +SVL ++   G  RINRAVWGPLN+TI+SGGED+V+R+WD ETG
Sbjct  121  AIHVKRIAEDPEDQIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDAVIRVWDTETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KL+KES++E GHKK ITSL K+ D SHFITGSLD
Sbjct  181  KLIKESNEEEGHKKTITSLCKAADDSHFITGSLD  214



>gb|AAC62877.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR GDLLFSCAKDH PTVWFADNGERLGTYRGH+GAVWCCDI
Sbjct  1    MRPILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLGTYRGHSGAVWCCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F +P RSVDF+VGD LAV+TTD F+G  S
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFSVGDHLAVITTDHFVGTSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ G+SVL ++   G  +INRAVWGPLN+TI+SGGED+ +RIWDAETG
Sbjct  121  AIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD+E GHK+ ITSL K+ D SHF+TGS D
Sbjct  181  KLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHD  214


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH  A+     + D S  +TGS D+T KLWD+
Sbjct  163  IVSGGEDAAIRIWDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+    P  +V  +            D  AV TTD   G   A     I    
Sbjct  223  RTLTLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFSPDGKSFSSGGEDGYVRL  316



>dbj|BAC43524.1| putative eukaryotic translation initiation factor 3 delta subunit 
[Arabidopsis thaliana]
Length=355

 Score =   356 bits (914),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 190/220 (86%), Gaps = 2/220 (1%)
 Frame = +3

Query  63   QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  242
            Q+   +MRPILMKGHERPLTFL+YNR GDLLFSCAKDH PTVWFADNGERLGTYRGH+GA
Sbjct  22   QTLETRMRPILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLGTYRGHSGA  81

Query  243  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  422
            VWCCDISRDSSRLITGSADQT KLWDVK+G +LFTF F +P RSVDF+V D LAV+TTD 
Sbjct  82   VWCCDISRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFSVDDHLAVITTDH  141

Query  423  FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRI  596
            F+G  SAIHVKRIA DPEDQ G+SVL ++   G  +INRAVWGPLN+TI+SGGED+ +RI
Sbjct  142  FVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRI  201

Query  597  WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            WDAETGKLLK+SD+E GHK+ ITSL K+ D SHF+TGS D
Sbjct  202  WDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHD  241


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH  A+     + D S  +TGS D+T KLWD+
Sbjct  190  IVSGGEDAAIRIWDAETGKLLKQSDEEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDM  249

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+    P  +V  +            D  AV TTD   G   A     I    
Sbjct  250  RTLTLIKTYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILQ--  307

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  308  -----EEIGGVKGHFGPINALAFSPDGKSFSSGGEDGYVRL  343



>gb|AIZ68198.1| eukaryotic translation initiation factor 3 subunit I-like isoform 
X1 [Ornithogalum saundersiae]
Length=328

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNREGDLLFSCAKDHNPTVWFADNGERLG Y+GHNGA+W CD+
Sbjct  1    MRPILMKGHERPLTFLRYNREGDLLFSCAKDHNPTVWFADNGERLGVYKGHNGAIWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQTVKLW+V+TG QL++F+FDSP RSV F+VGDKLAV+TTDPFMG P 
Sbjct  61   SRDSTRLITGSADQTVKLWNVQTGAQLYSFDFDSPARSVQFSVGDKLAVITTDPFMGHPP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGH--QGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             I VKRI+ DP +QT +SVLT+KG   QGRI  A+WGPLNKTIISGGED +LR WD ETG
Sbjct  121  TIQVKRISRDPSEQTSDSVLTIKGPQLQGRITGAMWGPLNKTIISGGEDGILRTWDTETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             LL ESD+E+GH+K ITSL+KS DGSHF+T SLD
Sbjct  181  SLLMESDKETGHQKRITSLSKSADGSHFLTSSLD  214



>emb|CDY03970.1| BnaC02g36850D [Brassica napus]
Length=680

 Score =   366 bits (939),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = +3

Query  75   KKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCC  254
            +KMRPILMKGHERPLTFL+YNR+GD+LFSCAKDH PT+W+ADNGER GT+RGHNGAVWCC
Sbjct  349  EKMRPILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGERHGTFRGHNGAVWCC  408

Query  255  DISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGL  434
            D+SRDS RLITGSADQ+ KLWDVKTG QLF+F F SP RSVDFA+GDKLAV+TTDPFM  
Sbjct  409  DVSRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFALGDKLAVITTDPFMER  468

Query  435  PSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAE  608
             SAIHVKRIA DPEDQ  ESVL ++   G  RINRAVWGPLN+TI+SGGED+VLRIWDAE
Sbjct  469  TSAIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAE  528

Query  609  TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            TGKLLKESD E GHK  ITSL KS D SHFITGSLD
Sbjct  529  TGKLLKESDAEVGHKNTITSLTKSADDSHFITGSLD  564


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 70/163 (43%), Gaps = 22/163 (13%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVK--LW  317
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D+T K  LW
Sbjct  513  IVSGGEDAVLRIWDAETGKLLKESDAEVGHKNTITSLTKSADDSHFITGSLDKTAKACLW  572

Query  318  DVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIAS  467
            D++T T L T+    P  +V  +            D  AV TTD   G   A    +I  
Sbjct  573  DMRTLTLLKTYVSGVPVNAVSMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  632

Query  468  DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                   E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  633  -------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  668



>ref|XP_006395439.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32725.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=328

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W+ADNGER GTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERHGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT K+W+VKTG QLF+F F SP RSVDF+VGDKLAV+TTDPFM   S
Sbjct  61   SRDSSRLITGSADQTAKIWEVKTGRQLFSFKFGSPARSVDFSVGDKLAVITTDPFMERTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ  +SVL ++   G  RINRAVWGPLN+TI+SGGED+V+R+WD ETG
Sbjct  121  AIHVKRIAEDPEDQIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDAVIRVWDTETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KL+KES++E GHKK ITSL K+ D SHFITGSLD
Sbjct  181  KLIKESNEEEGHKKTITSLCKAADDSHFITGSLD  214


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 70/163 (43%), Gaps = 20/163 (12%)
 Frame = +3

Query  147  DLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLW  317
            + + S  +D    VW  + G+ +       GH   +     + D S  ITGS D+T KLW
Sbjct  161  ETIVSGGEDAVIRVWDTETGKLIKESNEEEGHKKTITSLCKAADDSHFITGSLDKTAKLW  220

Query  318  DVKTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIAS  467
            D++T T + T+    P  +V  +            D  AV TTD   G   A    +I  
Sbjct  221  DMRTLTLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ  280

Query  468  DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                   E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  281  -------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  316



>ref|XP_001757566.1| predicted protein [Physcomitrella patens]
 gb|EDQ77623.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHERPLTFLKYNR+GDLLFSCAKDH PTVW+A NGERLGTY+GHNGAVWCCD+
Sbjct  1    MRPILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERLGTYKGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RL+T SADQTVKLWD +TG QL +FNFD+P R+V FA GDK+ V+TTDPFM   S
Sbjct  61   SRDSTRLVTSSADQTVKLWDCETGVQLHSFNFDAPARAVSFAEGDKMVVITTDPFMEQQS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRI SD   Q+ E VLT+ G QGRINRA+WGPLNKTIIS GED+ +RIWDAETGKL
Sbjct  121  AIHVKRIESDRSLQSSEDVLTITGPQGRINRAMWGPLNKTIISAGEDATIRIWDAETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD E+GH+K IT++AKS DGSHFITGS D
Sbjct  181  LKESDPETGHQKVITAMAKSADGSHFITGSHD  212


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++ KLWD+
Sbjct  161  IISAGEDATIRIWDAETGKLLKESDPETGHQKVITAMAKSADGSHFITGSHDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T   L T+  + P  +   +       +G   +   V  T    G   A    +I    
Sbjct  221  RTLQMLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFE--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN  V+ P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALVFNPDGRSFSSGGEDGYVRV  314



>ref|XP_002315834.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEF02005.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=328

 Score =   350 bits (897),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LIT SADQ+VKLW+V+TG QLFTFNF+SP RSVDF+VGDKLAV+TTDPFMG+ S
Sbjct  61   SRDSMLLITASADQSVKLWNVQTGAQLFTFNFNSPARSVDFSVGDKLAVITTDPFMGVTS  120

Query  441  AIHVKRIASDPEDQTGESVL--TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AI+VK IA DP  Q+GESVL  T+ G  GRINRAVWG LNKTIIS GEDS+    +  TG
Sbjct  121  AINVKSIAEDPSQQSGESVLTITITGPTGRINRAVWGSLNKTIISAGEDSMGFRGNWLTG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLKESD E GHKK ITSL KS DGSHF+TGSLD
Sbjct  181  KLLKESDPEVGHKKPITSLTKSADGSHFLTGSLD  214


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 59/133 (44%), Gaps = 17/133 (13%)
 Frame = +3

Query  228  GHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAV------  389
            GH   +     S D S  +TGS D++ KLWD +T T + T+  + P  +V  +       
Sbjct  191  GHKKPITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYATERPVNAVTMSPLLDHVV  250

Query  390  ----GDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNK  557
                 D  +V TTD   G   A    ++         E +  +KGH G IN   + P  K
Sbjct  251  LGGGQDASSVTTTDHRAGKFEAKFYDKVLQ-------EEIGGVKGHFGPINALAFNPDGK  303

Query  558  TIISGGEDSVLRI  596
            +  SGGED  +R+
Sbjct  304  SFSSGGEDGYVRL  316



>gb|AAG53616.1|AF285835_1 eukaryotic initiation factor 3I1 subunit [Arabidopsis thaliana]
Length=328

 Score =   349 bits (896),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+  LLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNRQPHLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+ AV+TTD F+   +
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRFAVITTDHFVDRTA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPE+Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETG
Sbjct  121  AIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLD  214



>gb|AAC49079.1| TGF-beta receptor interacting protein 1 homolog [Arabidopsis 
thaliana]
Length=328

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNREGDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F++P RSVDFAVGD+LAV+TTD F+   +
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVK    DPE+Q  ESVL +    G  RINRAVWGPLN+TI+S GED V+RIWDAETG
Sbjct  121  AIHVKAYCEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSCGEDKVIRIWDAETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  181  KLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLD  214


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + SC +D    +W A+ G+ L       GH   +     + D S  +TGS D+T KLWD+
Sbjct  163  IVSCGEDKVIRIWDAETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T L T+    P  +V  +            D  AV TTD   G   A    +I    
Sbjct  223  RTLTLLKTYTTVVPVNAVSLSPLLNHVVLGGGEDASAVTTTDHRAGKFEAKFCDKILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGE   +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEGGYVRL  316



>ref|XP_002882057.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58316.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 188/220 (85%), Gaps = 2/220 (1%)
 Frame = +3

Query  63   QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  242
            Q+   +M PILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W A NGERLGTYRGHNGA
Sbjct  24   QTLETRMTPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWLAHNGERLGTYRGHNGA  83

Query  243  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  422
            V CCD+SRDSSRLITGSADQT KLWDVK+G QLFTFNF S  RSVDF+VGD LAV+TTD 
Sbjct  84   VSCCDVSRDSSRLITGSADQTAKLWDVKSGKQLFTFNFGSSARSVDFSVGDHLAVITTDH  143

Query  423  FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRI  596
            FMG+ SAIHVKRIA DP+DQ G+SVL ++   G  +INRAVWGPLN+TI+SGGED+V+RI
Sbjct  144  FMGVSSAIHVKRIAEDPQDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRI  203

Query  597  WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            WD ETGKLLK+SD E GHK+ ITSL K+ D SHF+TGS D
Sbjct  204  WDTETGKLLKQSDVEVGHKEAITSLCKAADDSHFLTGSHD  243



>ref|XP_010506629.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=361

 Score =   348 bits (892),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 185/220 (84%), Gaps = 2/220 (1%)
 Frame = +3

Query  63   QSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGA  242
            Q+    +RPIL+KGHERPLT L+YNR+GDLLFSCAKDH PT+WF DNGERLGTYRGHNGA
Sbjct  28   QTLESWIRPILLKGHERPLTCLRYNRDGDLLFSCAKDHTPTLWFVDNGERLGTYRGHNGA  87

Query  243  VWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDP  422
            VWCCD+SRDSSRLITGSADQT KLWDV++G QLFTF F SP R VDF+VGD LAV+TTDP
Sbjct  88   VWCCDVSRDSSRLITGSADQTAKLWDVQSGEQLFTFKFGSPARFVDFSVGDHLAVITTDP  147

Query  423  FMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRI  596
            FM   SAIHVKRIA DP+DQ G+SVL +    G  RINRAVWG LNKTI+S GED+V+RI
Sbjct  148  FMERTSAIHVKRIAEDPQDQVGDSVLVINNPDGKKRINRAVWGLLNKTIVSAGEDAVIRI  207

Query  597  WDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            WD ETG LLKESD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  208  WDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLD  247


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 68/161 (42%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G  L       GH  A+     + D S  +TGS D+T KLWD+
Sbjct  196  IVSAGEDAVIRIWDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLDKTAKLWDM  255

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + ++    P  +V  +            D  AV TTD   G   A     I    
Sbjct  256  RTLTLIKSYTTVVPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGKFEAKFYDTILE--  313

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  314  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  349



>ref|XP_002862549.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH38807.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=328

 Score =   347 bits (889),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M PILMKGHERPLTFL+YNR+GDLLFSCAKDH PT+W A NGERLGTYRGHNGAV CCD+
Sbjct  1    MTPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWLAHNGERLGTYRGHNGAVSCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G QLFTFNF S  RSVDF+VGD LAV+TTD FMG+ S
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKQLFTFNFGSSARSVDFSVGDHLAVITTDHFMGVSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DP+DQ G+SVL ++   G  +INRAVWGPLN+TI+SGGED+V+RIWD ETG
Sbjct  121  AIHVKRIAEDPQDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRIWDTETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLLK+SD E GHK+ ITSL K+ D SHF+TGS D
Sbjct  181  KLLKQSDVEVGHKEAITSLCKAADDSHFLTGSHD  214


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L       GH  A+     + D S  +TGS D+T KLWD+
Sbjct  163  IVSGGEDTVIRIWDTETGKLLKQSDVEVGHKEAITSLCKAADDSHFLTGSHDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            ++ T + ++    P  +V  +            D  AV TTD   G   A     I    
Sbjct  223  RSLTLIKSYTTVVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDTILE--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  316



>ref|XP_010508042.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=360

 Score =   348 bits (892),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 195/236 (83%), Gaps = 8/236 (3%)
 Frame = +3

Query  33   IKLFGNQKN-LQSRNKK-----MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWF  194
            ++L G Q N +QS + +     +RPIL+KGHERPLT L+YNR+GDLLFSCAKDHNPT+WF
Sbjct  11   LRLDGRQFNDIQSSSHQTLESWIRPILLKGHERPLTCLRYNRDGDLLFSCAKDHNPTLWF  70

Query  195  ADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRS  374
            ADNGERLGTYRGHNGAVWCCD+SRDSSRLITGSADQT KLWDV++G QLFTF F S  RS
Sbjct  71   ADNGERLGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVQSGEQLFTFKFGSTARS  130

Query  375  VDFAVGDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGP  548
            V+F+VGD LAV+TTDPF+   SAIHVKRI  DP+DQ  +SVL +    G  RINRAVWGP
Sbjct  131  VEFSVGDHLAVITTDPFIERTSAIHVKRIVEDPQDQVDDSVLVINNPDGKKRINRAVWGP  190

Query  549  LNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LNKTI+S GED+V+RIWD ETG LLKESD+E GHKK ITSL K+ D SHF+TGSLD
Sbjct  191  LNKTIVSAGEDAVIRIWDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLD  246


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 67/161 (42%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G  L       GH  A+     + D S  +TGS D T KLWD+
Sbjct  195  IVSAGEDAVIRIWDTETGTLLKESDEEVGHKKAITSLCKAADDSHFLTGSLDNTAKLWDM  254

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + ++    P  +V  +            D  AV TTD   G   A     I    
Sbjct  255  RTLTLIKSYTTVVPVNAVAMSPLLNHVMLGGGQDASAVTTTDHRAGNFEAKFYDTILQ--  312

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  313  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  348



>gb|EEC83341.1| hypothetical protein OsI_28738 [Oryza sativa Indica Group]
Length=251

 Score =   343 bits (879),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMENVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ 
Sbjct  121  TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQC  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GH+K ITSL+KS D SHF+TGSLD
Sbjct  181  LKESDKEQGHQKTITSLSKSADWSHFLTGSLD  212



>ref|NP_001147501.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 gb|ACG27749.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 tpg|DAA59664.1| TPA: eukaryotic translation initiation factor 3 subunit 2 [Zea 
mays]
Length=326

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSARLITGSADQTAKLWDVSTGKELFSFRFDAPARSVEFAIGDALAVVTTDNFMDHVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             + VKRIA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+L
Sbjct  121  TVQVKRIAEDIDDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATVRIWDSETGQL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGH+K I+SL+KS+D SHFITGSLD
Sbjct  181  LKESDKESGHQKTISSLSKSLDWSHFITGSLD  212


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W ++ G+ L       GH   +     S D S  ITGS D++ KLWD 
Sbjct  161  IITAGEDATVRIWDSETGQLLKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFAVG----------DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +            D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_002882056.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58315.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   345 bits (884),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YN++GDLLFSCAKDH PT+WFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLRYNKDGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDVK+G +LFTF F SP RSVDFA+GD LAV+TTD F+   +
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGSPTRSVDFALGDHLAVITTDHFVDRMA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            AIHVKRIA DPEDQ  +SVL ++   G  RINRAVWGPLN+TI+S GED+V+RIWD ETG
Sbjct  121  AIHVKRIAEDPEDQVSDSVLVLQCPDGKKRINRAVWGPLNQTIVSAGEDTVIRIWDTETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            KLL E+++E GHKK ITSL K+ D SHF+TGS D
Sbjct  181  KLLNETNEEVGHKKAITSLCKAADDSHFLTGSHD  214


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L       GH  A+     + D S  +TGS D+T KLWD+
Sbjct  163  IVSAGEDTVIRIWDTETGKLLNETNEEVGHKKAITSLCKAADDSHFLTGSHDKTAKLWDM  222

Query  324  KTGTQLFTFNFDSPGRSVDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+    P  +V  +            D  AV TTD   G   A    +I    
Sbjct  223  RTLTLIKTYTTGVPVNAVAMSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQ--  280

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  281  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  316



>ref|XP_008670966.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 ref|XP_008670967.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 tpg|DAA42586.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42587.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42588.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
Length=326

 Score =   344 bits (882),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSARLITGSADQTAKLWEVSTGKELFSFRFDAPARSVEFAIGDALAVVTTDNFMDHVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             + VKRIA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+L
Sbjct  121  TVQVKRIAEDIDDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDSETGQL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGH+K I+SL+KS+D SHFITGSLD
Sbjct  181  LKESDKESGHQKTISSLSKSLDWSHFITGSLD  212


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W ++ G+ L       GH   +     S D S  ITGS D++ KLWD 
Sbjct  161  IITAGEDATIRIWDSETGQLLKESDKESGHQKTISSLSKSLDWSHFITGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFAVG----------DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +            D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_004955547.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Setaria italica]
Length=326

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSARLITGSADQTAKLWDVSTGRELFSFRFDAPARSVEFAIGDALAVITTDNFMDHVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             + VK IA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETGKL
Sbjct  121  TVQVKHIAEDLDDQTDESALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGH+K I+SL+KS D SHFITGSLD
Sbjct  181  LKESDKESGHQKTISSLSKSADWSHFITGSLD  212


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W  + G+ L       GH   +     S D S  ITGS D++ KLWD 
Sbjct  161  IITAGEDATIRIWDTETGKLLKESDKESGHQKTISSLSKSADWSHFITGSLDKSAKLWDS  220

Query  324  KTGTQLFTFNFDSPGRSVDFAVG----------DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +            D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_002461510.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
 gb|EER98031.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
Length=326

 Score =   342 bits (877),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLW+V TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSARLITGSADQTAKLWEVSTGKELFSFRFDAPARSVEFAIGDALAVVTTDNFMDHVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             + VK IA D +DQT +S L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETGKL
Sbjct  121  TVQVKHIAEDIDDQTEDSALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+ESGH+K ITSL+KS+D SHF+TGSLD
Sbjct  181  LKESDKESGHQKTITSLSKSLDWSHFVTGSLD  212


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IITAGEDATIRIWDSETGKLLKESDKESGHQKTITSLSKSLDWSHFVTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFAVG----------DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +            D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQDAMNVTMTDRRAGKFEAKFYHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>gb|AFM95335.1| eukaryotic translation initiation factor 3 subunit i [Triticum 
aestivum]
Length=326

 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SR S+RLITGSADQT KLWDVKTG +LFTF FD+P RSVD A+GD LAV+TTD FMG   
Sbjct  61   SRHSARLITGSADQTAKLWDVKTGKELFTFRFDAPARSVDLAIGDHLAVITTDSFMGNMP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA D +DQT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  121  TAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GH+K I+SL+KS+D SHF+TGSLD
Sbjct  181  LKESDKEVGHQKAISSLSKSLDWSHFLTGSLD  212


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W ++ G+ L       GH  A+     S D S  +TGS D++ KLWD 
Sbjct  161  IITAGEDATIRIWDSETGKLLKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDA  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +       +G   D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILE--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>dbj|BAJ85385.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SR S+RLITGSADQT KLWDVKTG +LFTF FD+P RSVD A+GD LAV+TTD FMG   
Sbjct  61   SRHSTRLITGSADQTAKLWDVKTGKELFTFRFDAPARSVDLAIGDHLAVITTDSFMGNMP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA D +DQT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  121  TAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GH+K I+SL+KS+D SHF+TGSLD
Sbjct  181  LKESDKEVGHQKAISSLSKSLDWSHFLTGSLD  212


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W ++ G+ L       GH  A+     S D S  +TGS D++ KLWD 
Sbjct  161  IITAGEDATIRIWDSETGKLLKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDA  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +       +G   D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILE--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|NP_001061508.1| Os08g0308100 [Oryza sativa Japonica Group]
 gb|AAQ56413.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Japonica Group]
 gb|AAQ56424.1| TGF-beta receptor-interacting protein-like protein [Oryza sativa 
Japonica Group]
 dbj|BAC92643.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAC92579.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF23422.1| Os08g0308100 [Oryza sativa Japonica Group]
 dbj|BAI39771.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
 dbj|BAI39984.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
Length=326

 Score =   341 bits (875),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMENVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ 
Sbjct  121  TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQC  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GH+K ITSL+KS D SHF+TGSLD
Sbjct  181  LKESDKEQGHQKTITSLSKSADWSHFLTGSLD  212


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W  + G+ L      +GH   +     S D S  +TGS D++ KLWD 
Sbjct  161  IITAGEDATIRIWDTETGQCLKESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLWDT  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +       +G   D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_010678072.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVW+ADNGERLGTYRGHNGAVW CDI
Sbjct  1    MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWYADNGERLGTYRGHNGAVWSCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DSSRLITGSADQTVKLWDVK G QL+TFNFD+P RSV+F+VGDKLAV+TTDPFM   S
Sbjct  61   SWDSSRLITGSADQTVKLWDVKKGEQLYTFNFDAPARSVNFSVGDKLAVITTDPFMEKTS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK-  617
            AIHVKRIA D ++QT ES L M+G  GRINRAVWG LNK IIS GED+++R+WD  TG+ 
Sbjct  121  AIHVKRIAEDIDEQTNESALVMRGPSGRINRAVWGLLNKNIISCGEDAIIRVWDPVTGQE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ++   D E+GH   ITSL  S D SHF+TGSLD
Sbjct  181  IMSTKDHENGHNNAITSLCFSADKSHFLTGSLD  213


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 71/162 (44%), Gaps = 21/162 (13%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR----GHNGAVWCCDISRDSSRLITGSADQTVKLWD  320
            + SC +D    VW    G+ + + +    GHN A+     S D S  +TGS D++ KLWD
Sbjct  161  IISCGEDAIIRVWDPVTGQEIMSTKDHENGHNNAITSLCFSADKSHFLTGSLDKSAKLWD  220

Query  321  VKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASD  470
             ++ T + T+    P  +V      D  V     D   V T+D   G   A    +I   
Sbjct  221  TRSLTLIKTYITGRPVNAVTMSPLLDHVVLGGGQDASTVTTSDHRAGKFEAKFFDKILE-  279

Query  471  PEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                  E +  +KGH G IN   + P  K+  SGGED   R+
Sbjct  280  ------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYARL  315



>ref|XP_003577379.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brachypodium distachyon]
Length=326

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH P VW+ADNGERLGTY+GHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHAPNVWYADNGERLGTYKGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SR S+RL+TGSADQT KLWDVKTG +LFTF FD+P RSVDFA+GD+LAV+TTD FMG   
Sbjct  61   SRHSTRLLTGSADQTAKLWDVKTGKELFTFRFDAPARSVDFAIGDRLAVITTDSFMGNQP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA D EDQT +S L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  121  TAQVKRIAEDIEDQTEDSALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L ESD+E GH+K I+SL+KS+D SHF+TGSLD
Sbjct  181  LNESDKEVGHQKAISSLSKSLDWSHFLTGSLD  212


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTYR---GHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W ++ G+ L       GH  A+     S D S  +TGS D++ KLWD 
Sbjct  161  IITAGEDATIRIWDSETGKLLNESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDA  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +       +G   D + V  TD   G   A    +I    
Sbjct  221  RTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_001763986.1| predicted protein [Physcomitrella patens]
 gb|EDQ71125.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHERPLTFLKYNR+GDLLFSCAKDH PTVW+A NGERLGTY+GHNGAVWCCD+
Sbjct  1    MRPILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERLGTYKGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RL+T SADQTVKLW+ +TG  L TFNFD+P R+V F+ GDK+ V++TDPFM   S
Sbjct  61   SRDSTRLVTSSADQTVKLWECETGVLLHTFNFDAPARAVSFSEGDKMVVISTDPFMEKQS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRI SD   Q+ E VLT+ G QGRINR +WGPLNKTIIS GED+ +RIWDAETGK 
Sbjct  121  AIHVKRIESDRFLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRIWDAETGKC  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD E+GH+K IT+++KS DGSHFITGS D
Sbjct  181  LKESDPETGHQKVITAMSKSADGSHFITGSHD  212


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 70/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W A+ G+ L       GH   +     S D S  ITGS D++ KLWD+
Sbjct  161  IISAGEDATIRIWDAETGKCLKESDPETGHQKVITAMSKSADGSHFITGSHDKSAKLWDI  220

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T L T+  + P  +   +       +G   +   V  T   +G   A    +I    
Sbjct  221  RTLTVLKTYTTERPVNAAAISPLLDHVVIGGGQEASQVTMTSTRVGKFEAKFFHKIFE--  278

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  279  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRV  314



>ref|NP_001055036.1| Os05g0256000 [Oryza sativa Japonica Group]
 gb|AAV31388.1| putative TGF-beta receptor interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF16950.1| Os05g0256000 [Oryza sativa Japonica Group]
 dbj|BAG97027.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78857.1| hypothetical protein OsI_19205 [Oryza sativa Indica Group]
 gb|EEE63021.1| hypothetical protein OsJ_17829 [Oryza sativa Japonica Group]
Length=326

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTY GHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYSGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FMG   
Sbjct  61   SRDSTRLITGSADQTAKLWDVQTGAELFTFRFDAPARSVEFAIGDGLAVITTDNFMGNVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG  
Sbjct  121  TAQVKRIADDPDDQSEESLLVISGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGTC  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L ESD+E GH+K ITSL+KS D SHF+TGSLD
Sbjct  181  LNESDKEQGHQKTITSLSKSADWSHFLTGSLD  212


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 85/202 (42%), Gaps = 23/202 (11%)
 Frame = +3

Query  30   RIKLFGNQKNLQSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGE  209
            ++K   +  + QS    +    +KG      +   NR    + +  +D    +W  + G 
Sbjct  123  QVKRIADDPDDQSEESLLVISGIKGRINRAVWGPLNRT---IITAGEDATIRIWDTETGT  179

Query  210  RLGTY---RGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVD  380
             L      +GH   +     S D S  +TGS D++ KLWD +T T + T+  + P  +VD
Sbjct  180  CLNESDKEQGHQKTITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVD  239

Query  381  FA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRIN  530
             +       +G   D + V  TD   G   A    +I         E +  +KGH G IN
Sbjct  240  ISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ-------EEIGGVKGHFGPIN  292

Query  531  RAVWGPLNKTIISGGEDSVLRI  596
               + P  ++  SGGED  +R+
Sbjct  293  ALAFNPDGRSFSSGGEDGYVRL  314



>ref|XP_007215753.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
 gb|EMJ16952.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
Length=295

 Score =   337 bits (865),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 181/212 (85%), Gaps = 6/212 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL Y+REGDLL SC KDH P     DN ERLGTYRGHNGAVWC D 
Sbjct  1    MRPILMKGHERPLTFLTYDREGDLLLSCGKDHTP-----DNVERLGTYRGHNGAVWCGDF  55

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            +RDS+RLITGSADQT KLW+V+TG QLFTFNFDSP RSVD +VGD+LAV+TTDPFM L S
Sbjct  56   TRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDLSVGDRLAVITTDPFMELSS  115

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP    GES L +KG QGR  RAVWGPLN+TIIS GED+V+RIWD+ETGKL
Sbjct  116  AIHVKRIAKDPA-IVGESALILKGPQGRRQRAVWGPLNRTIISAGEDAVIRIWDSETGKL  174

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKE+D+E GHKK ITSLAKS+DGSHF+TGSLD
Sbjct  175  LKENDKEVGHKKTITSLAKSVDGSHFLTGSLD  206



>gb|EAZ42270.1| hypothetical protein OsJ_26838 [Oryza sativa Japonica Group]
Length=380

 Score =   340 bits (872),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH P VWFADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMENVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ 
Sbjct  121  TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQC  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GH+K ITSL+KS D SHF+TGSLD
Sbjct  181  LKESDKEQGHQKTITSLSKSADWSHFLTGSLD  212



>ref|XP_001758941.1| predicted protein [Physcomitrella patens]
 gb|EDQ76447.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHERPLTFLKYNR+GDLLFSCAKDH PTVW+A NGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RL+T SADQTVKLWD +TG  L TF FD+P R+V F+ GDK+ V++TDPFM   S
Sbjct  61   SRDSTRLVTSSADQTVKLWDCETGVLLDTFYFDAPARAVSFSEGDKMVVISTDPFMEKQS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVK I SD   Q+ E VLT+ G QGRINR +WGPLNKTIIS GED+ +RIWDAETGK 
Sbjct  121  AIHVKMINSDRSLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRIWDAETGKC  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L ESD E+GH+K ITS+AKS DGSHFITGS D
Sbjct  181  LIESDPETGHQKVITSMAKSADGSHFITGSQD  212


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/201 (25%), Positives = 85/201 (42%), Gaps = 23/201 (11%)
 Frame = +3

Query  33   IKLFGNQKNLQSRNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGER  212
            +K+  + ++LQS    +    + G +  +  + +      + S  +D    +W A+ G+ 
Sbjct  124  VKMINSDRSLQSSEDVL---TITGPQGRINRVMWGPLNKTIISAGEDATIRIWDAETGKC  180

Query  213  L---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDF  383
            L       GH   +     S D S  ITGS D++ KLWD++T T L T+  + P  +   
Sbjct  181  LIESDPETGHQKVITSMAKSADGSHFITGSQDKSAKLWDIRTLTVLKTYTTERPVNAAAI  240

Query  384  A-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINR  533
            +       +G   +   V  T    G   A    +I         E +  +KGH G IN 
Sbjct  241  SPLLDHVVIGGGQEASQVTMTSTRAGKFEAKFFHKIFE-------EEIGGVKGHFGPINA  293

Query  534  AVWGPLNKTIISGGEDSVLRI  596
              + P  ++  SGGED  +R+
Sbjct  294  LAFNPDGRSFSSGGEDGYVRV  314



>ref|XP_002988251.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
 ref|XP_002991383.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ07495.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ10670.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
Length=323

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 180/212 (85%), Gaps = 2/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDHNPTVW+  NGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYGHNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SR S+RLITGSADQ+VKLWDV+TGTQL TFNF SP R+VDFA GDKLAV++TDPFM   S
Sbjct  61   SRHSTRLITGSADQSVKLWDVETGTQLHTFNFVSPARAVDFAEGDKLAVISTDPFMESVS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+K + S    Q   S+ T  G  GRINR VWGPLNKTIIS GED+V+RIWD ETG++
Sbjct  121  AIHIKSVESSGLQQG--SIKTFTGPTGRINRVVWGPLNKTIISAGEDTVIRIWDVETGEV  178

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +K++D+E+GH + ITSL+ S DGSHFITGS D
Sbjct  179  IKKTDKENGHSRAITSLSLSADGSHFITGSQD  210


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 74/161 (46%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGE---RLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + GE   +     GH+ A+    +S D S  ITGS D+T KLWD 
Sbjct  159  IISAGEDTVIRIWDVETGEVIKKTDKENGHSRAITSLSLSADGSHFITGSQDKTAKLWDT  218

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T L T++ + P  +V  +       VG   +   V T+D   G   A    +I  D 
Sbjct  219  RTLTLLKTYSTERPVNAVAISPLMNHVVVGGGQEASQVTTSDRRAGKFEAKFFHKIFCD-  277

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                   +  ++GH G IN   + P  ++  SGGED  +R+
Sbjct  278  ------EIGGVRGHFGPINALAFNPDGRSFSSGGEDGYVRL  312



>ref|XP_006471278.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Citrus sinensis]
Length=186

 Score =   325 bits (832),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLT+LKYN++GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L S
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIHVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD E   +
Sbjct  121  AIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTEVRVI  180

Query  621  L  623
            L
Sbjct  181  L  181



>ref|XP_006663589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oryza brachyantha]
Length=310

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 168/212 (79%), Gaps = 16/212 (8%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSC                LGT RGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSC----------------LGTCRGHNGAVWSCDV  44

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV+TG +LFTF FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  45   SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFAIGDGLAVITTDNFMDNAP  104

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA DP+DQ+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +R+WD ETGK 
Sbjct  105  TAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATVRLWDTETGKC  164

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E GH+K I+SL+KS D SHF+TGSLD
Sbjct  165  LKESDKEQGHQKTISSLSKSADWSHFLTGSLD  196


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W  + G+ L      +GH   +     S D S  +TGS D++ KLWD 
Sbjct  145  IITAGEDATVRLWDTETGKCLKESDKEQGHQKTISSLSKSADWSHFLTGSLDKSAKLWDT  204

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +       +G   D + V  TD   G   A    +I    
Sbjct  205  RTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ--  262

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  ++  SGGED  +R+
Sbjct  263  -----EEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRL  298



>ref|XP_004977275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Setaria italica]
Length=367

 Score =   286 bits (733),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFL+YNR+GDLLFSCAKDH PTVW+ADNG+RLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS+RLITGSADQT KLWDV TG +LF+F FD+P RSV+FA+GD LAV+TTD FM    
Sbjct  61   SRDSARLITGSADQTAKLWDVSTGRELFSFRFDAPARSVEFAIGDALAVITTDNFMDHVP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAE  608
             + VK IA D +DQT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD E
Sbjct  121  TVQVKHIAEDLDDQTDESALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTE  176



>ref|XP_001418365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96658.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=323

 Score =   280 bits (717),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 158/213 (74%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHERPLTF+KYNREGDLLF+CAKDH+PT+W+ DNGER+GTY GHNGAVW CD+
Sbjct  1    MRPILLKGHERPLTFIKYNREGDLLFTCAKDHHPTLWYGDNGERVGTYVGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DSS L+TGSAD T KLWD KTG   FTF FD P R+V    G     +TTDPFMG+PS
Sbjct  61   SDDSSTLVTGSADTTAKLWDTKTGECYFTFEFDQPVRAVALNAGGTQCAITTDPFMGVPS  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
            AIH+  +   D   Q GE V  ++G QGR+ R +WGPLNKT+++GGED ++R WD ETG 
Sbjct  121  AIHIVNVNLGDRAAQRGEVVKRIEGPQGRVTRVMWGPLNKTVVTGGEDGIIRSWDVETGD  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LK S +   H K I  L  S DGSHFI+ SLD
Sbjct  181  VLKMSQE---HSKQIQHLVMSDDGSHFISASLD  210



>ref|XP_003079673.1| TGF-beta receptor-interacting protein 1 (ISS) [Ostreococcus tauri]
 emb|CAL53318.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=323

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 160/213 (75%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHERPLTF++YNREGDLLF+CAKDH+PT+W+ D GER+GTY GHNGAVW CD+
Sbjct  1    MRPILLKGHERPLTFIRYNREGDLLFTCAKDHHPTLWYGDTGERVGTYVGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DSS L+TGSAD T KLWD KTG   FTF FD P R+V  A G K A +TTDPFMG+PS
Sbjct  61   SDDSSTLLTGSADTTAKLWDAKTGECYFTFTFDQPVRAVALAHGGKRAAITTDPFMGVPS  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
            AIH+  I   D   QT   +  + G QGR+ R +WGPLN+T+I+GGED ++R WDAE G+
Sbjct  121  AIHIVEIDLEDRSRQTARVIRRIDGPQGRVTRVLWGPLNRTVITGGEDGIIRSWDAENGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LK S +   H K I  L+ S DGSHFI+ SLD
Sbjct  181  VLKISQE---HSKQIQHLSMSEDGSHFISASLD  210


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 19/147 (13%)
 Frame = +3

Query  189  WFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPG  368
            W A+NGE L   + H+  +    +S D S  I+ S D+T K++D +T   + T++ D P 
Sbjct  174  WDAENGEVLKISQEHSKQIQHLSMSEDGSHFISASLDKTAKVFDSETLECMKTYSADRPV  233

Query  369  RSV------DFAV----GDKLAVMTTDPFMG-LPSAIHVKRIASDPEDQTGESVLTMKGH  515
             +       D  V     D ++V TT    G   S I+ K           E +  ++GH
Sbjct  234  NAAILSPIRDHIVLGGGQDAMSVTTTSSKAGKFDSKIYHKIFE--------EEIGGIRGH  285

Query  516  QGRINRAVWGPLNKTIISGGEDSVLRI  596
             G IN   + P  ++  SGGED  +RI
Sbjct  286  FGPINALAFNPDGRSFTSGGEDGYVRI  312



>ref|XP_003059370.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56502.1| predicted protein [Micromonas pusilla CCMP1545]
Length=334

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 166/224 (74%), Gaps = 15/224 (7%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHERPLTF+KYNR+GDLLF+CAKDH+PT+W+AD+GER+GTY GHNGAVW CD+
Sbjct  1    MRPILLKGHERPLTFIKYNRDGDLLFTCAKDHHPTLWYADDGERVGTYVGHNGAVWTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTF-----------NFDSPGRSVDFAVGDKLAV  407
            + DS  L+TGSAD T K+WDV+TGT  FT            +FD P R+V  A GD+   
Sbjct  61   THDSRTLVTGSADTTCKMWDVETGTCYFTHQARSIHWFPYDHFDQPARAVALAQGDEKMC  120

Query  408  MTTDPFMGLPSAIHVKRIASDPEDQTGESVLTM-KGHQGRINRAVWGPLNKTIISGGEDS  584
            ++TDPFMG+P+ +H+  +A++ E+QT E V +   G +GRINRA+WGPLN+TI++GGED 
Sbjct  121  ISTDPFMGVPARVHIVNVAANREEQTNEIVASFGDGVEGRINRALWGPLNETILTGGEDG  180

Query  585  VLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            V+R WD ETGK+  E+     HKK I  L  S D +HF++ SLD
Sbjct  181  VIRAWDVETGKIKLEA---RDHKKQIQHLCLSEDKTHFVSASLD  221



>ref|XP_002500789.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62047.1| predicted protein [Micromonas sp. RCC299]
Length=317

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 166/212 (78%), Gaps = 8/212 (4%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHER      YN+EGDLLF+CAKDH+PT+W++D+GER+GTY GHNGAVW CD+
Sbjct  1    MRPILLKGHERC-----YNKEGDLLFTCAKDHHPTLWYSDDGERVGTYIGHNGAVWTCDV  55

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + DS  L+TGSAD T K+WD +TGT  FT  F+ P R+V  + GD+  V+++DPFMG+P+
Sbjct  56   TEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMVISSDPFMGVPA  115

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            A+H+  +A++ E+QT E  ++M G +GRINRA+WGPLN+TI++GGED V+R+WD ETGK+
Sbjct  116  ALHIVDVAANREEQTNEIKISMSGPEGRINRALWGPLNRTILTGGEDGVIRLWDVETGKI  175

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            + E++    HKK I  L+ S+D +HFI+ SLD
Sbjct  176  VHEAND---HKKQIQHLSLSVDKTHFISASLD  204



>gb|EMS51995.1| Eukaryotic translation initiation factor 3 subunit I [Triticum 
urartu]
Length=341

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 151/212 (71%), Gaps = 34/212 (16%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+LMKGHERPLTFLKYNR+GDLLFSCAKDH PTV                        
Sbjct  1    MRPVLMKGHERPLTFLKYNRDGDLLFSCAKDHTPTV------------------------  36

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
                       ADQT KLWDV+TG +LFTF FD+P RSVDFA+GD LAV+TTD FMG   
Sbjct  37   ----------CADQTAKLWDVQTGRELFTFRFDAPARSVDFAIGDHLAVITTDSFMGKMP  86

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
               VKRIA D +DQT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKL
Sbjct  87   TAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKL  146

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LKESD+E+GH+K I+SL+KS+D SHF+TGSLD
Sbjct  147  LKESDKEAGHQKAISSLSKSLDWSHFLTGSLD  178


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + +  +D    +W ++ G+ L       GH  A+     S D S  +TGS D++ KLWD 
Sbjct  127  IITAGEDATIRIWDSETGKLLKESDKEAGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDA  186

Query  324  KTGTQLFTFNFDSPGRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +VD +       +G   D + V  TD   G   A    +I    
Sbjct  187  RTLTLIKTYVTERPVNAVDMSPTLDNVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILQ--  244

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  245  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  280



>ref|XP_008386512.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=146

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGE LGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHKPTVWFADNGEHLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDSSRLITGSADQT KLWDV+TG  LFTFNFDSP R+VD +VGD+LAV+TTDPFMG+ S
Sbjct  61   SRDSSRLITGSADQTAKLWDVQTGRLLFTFNFDSPARAVDLSVGDRLAVITTDPFMGVTS  120

Query  441  AIHVKRIASDPEDQTGESVL  500
            AIHVKRI  DPED+    +L
Sbjct  121  AIHVKRIDRDPEDRNNNLLL  140



>gb|KJB56101.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=272

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 146/212 (69%), Gaps = 54/212 (25%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP R+V                     
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARAV---------------------  99

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
                                      G +NR        TI+S GED+V+RIWD+ETGKL
Sbjct  100  -------------------------WGPLNR--------TIVSAGEDAVIRIWDSETGKL  126

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E+D+ESGHKK ITSL KS DGSHF+TGSLD
Sbjct  127  LREADKESGHKKTITSLTKSADGSHFLTGSLD  158


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  107  IVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDT  166

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  167  RTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  224

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  225  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  260



>ref|XP_007512918.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16476.1| predicted protein [Bathycoccus prasinos]
Length=327

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 155/216 (72%), Gaps = 6/216 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGHERPLTF+KYN +GDL+ +CAKDH+PT+W+AD G R+GTY GHNGAVW  DI
Sbjct  1    MRPILLKGHERPLTFIKYNADGDLIVTCAKDHHPTLWYADTGNRVGTYIGHNGAVWTADI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            +RDS  L TGSAD + KLWDV +G    TF FD P R+V FA+GD+  ++TTDPFMG+ +
Sbjct  61   TRDSKTLATGSADTSCKLWDVGSGVCFQTFQFDQPVRAVSFAIGDEKMLITTDPFMGVNA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGH---QGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
            AIH+  I  + E+QT + + T+ G     GR+NR  WG LN+T ++ GED VLR+WD ET
Sbjct  121  AIHIVEITKNREEQTSKILKTISGDGIVNGRLNRVAWGALNETFLTAGEDGVLRVWDVET  180

Query  612  GKLLKESDQESGHK-KGITSLAKSIDGSHFITGSLD  716
            GK+L E+     HK K I  L  S D +H IT SLD
Sbjct  181  GKVLHEA--RDAHKGKPIQHLELSADKTHAITASLD  214



>gb|KDO58633.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=268

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  267  DSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAI  446
            +S  LITGSADQT KLW+V+TG QLFTFNFDSP RSVDFAVGDKLAV+TTDPFM L SAI
Sbjct  5    NSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFAVGDKLAVITTDPFMELNSAI  64

Query  447  HVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLK  626
            HVKRIA DP DQ GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKLLK
Sbjct  65   HVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLK  124

Query  627  ESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ESD+E+GHKK ITSLAK+ DGSHF+TGSLD
Sbjct  125  ESDKETGHKKTITSLAKAADGSHFLTGSLD  154


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 69/161 (43%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W  + G+ L       GH   +     + D S  +TGS D++ KLWD 
Sbjct  103  IISAGEDAIVRIWDTETGKLLKESDKETGHKKTITSLAKAADGSHFLTGSLDKSAKLWDA  162

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T   + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  163  RTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  220

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  221  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  256



>ref|XP_005647023.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22479.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=324

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 155/212 (73%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP L+KGHERPLT LKYNREGDLLFSCAKDH+PT+WF+++G R+GTY GHNGAV  CD+
Sbjct  1    MRPYLLKGHERPLTQLKYNREGDLLFSCAKDHHPTLWFSEDGARIGTYVGHNGAVNTCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DS+RL+TGS+D T KLW+V+TG  +FTF + +P R+V F++ ++LA ++TDPFM    
Sbjct  61   SMDSTRLLTGSSDSTAKLWEVETGRNVFTFKYQAPCRAVSFSIDEQLAALSTDPFMTTTP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AI++ RI+ DP +Q+ + V  ++G   RINR  +  LN  +IS GED  +R WD ETGK+
Sbjct  121  AINIVRISEDPSEQSDQPVQRLEGFSKRINRVTFTDLNTVLISAGEDGFVRRWDVETGKV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             +E+     H+K I  +    DG+H +T S+D
Sbjct  181  KEEAKL---HEKEIRDMQLYKDGTHMVTASVD  209



>gb|ETO77218.1| hypothetical protein F444_07544 [Phytophthora parasitica P1976]
Length=327

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 148/214 (69%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1    MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S  S RL+T +AD TVKLWDV+TG +LF+F    P RSV+F+ GDK  V   D F   P+
Sbjct  61   SYHSERLLTAAADATVKLWDVQTGEELFSFPHTGPARSVNFSTGDKYFVSVADKFSDRPA  120

Query  441  AIHVKRIASDPEDQTGESVLTM--KGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            A++V  +A D  +Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D  TG
Sbjct  121  AVYVYELADDVANQSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPTTG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LL+  D  +G    IT++A +   +  IT S D
Sbjct  181  QLLESHDIHTGE---ITNVAFNKTKTLAITSSKD  211



>ref|XP_008904158.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETI48440.1| hypothetical protein F443_07533 [Phytophthora parasitica P1569]
 gb|ETK88380.1| hypothetical protein L915_07354 [Phytophthora parasitica]
 gb|ETL41778.1| hypothetical protein L916_07299 [Phytophthora parasitica]
 gb|ETL94935.1| hypothetical protein L917_07189 [Phytophthora parasitica]
 gb|ETM48172.1| hypothetical protein L914_07247 [Phytophthora parasitica]
 gb|ETN10397.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETP18232.1| hypothetical protein F441_07512 [Phytophthora parasitica CJ01A1]
 gb|ETP46176.1| hypothetical protein F442_07542 [Phytophthora parasitica P10297]
Length=327

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 148/214 (69%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1    MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S  S RL+T +AD TVKLWDV+TG +LF+F    P RSV+F+ GDK  V   D F   P+
Sbjct  61   SYHSERLLTAAADATVKLWDVQTGEELFSFPHTGPARSVNFSTGDKYFVSVADKFSDRPA  120

Query  441  AIHVKRIASDPEDQTGESVLTM--KGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            A++V  +A D  +Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D  TG
Sbjct  121  AVYVYELADDVANQSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPTTG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LL+  D  +G    IT++A +   +  IT S D
Sbjct  181  QLLESHDIHTGE---ITNVAFNKTKTLAITSSKD  211



>ref|XP_009538303.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
 gb|EGZ06406.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
Length=327

 Score =   231 bits (589),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 148/214 (69%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1    MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S  S RL+T +AD +VKLWDV+TG +LF+F    P RSV+FA GDK  V   D F   P+
Sbjct  61   SYHSERLLTAAADASVKLWDVQTGEELFSFQHTGPARSVNFATGDKKFVSVADKFSDRPA  120

Query  441  AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            A+ V  +A+D   Q+ E VLT+   GH+GRI  A W PLN+ I++ G D  ++++D +TG
Sbjct  121  AVFVYELAADLAQQSAEPVLTIANHGHEGRITGAYWTPLNEAIMTTGGDGCIKLFDPQTG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LL+  D  +G    IT++A +   +  IT S D
Sbjct  181  ELLESHDIHTGE---ITNVAFNKTKTLAITSSKD  211



>ref|XP_002899797.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
 gb|EEY60851.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
Length=327

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 148/214 (69%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGH R LT +KYNREGDLLFSCAKDH P +W++D GER+GTY GH+GAVW CD+
Sbjct  1    MRPILLKGHSRSLTMIKYNREGDLLFSCAKDHTPNLWYSDTGERIGTYVGHSGAVWACDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S  S RL+T +AD TVKLWDV++G +LF+F    P RSV+F+ GDK  V   D F   P+
Sbjct  61   SYHSERLLTAAADATVKLWDVQSGEELFSFPHTGPARSVNFSTGDKYFVSVADKFSDRPA  120

Query  441  AIHVKRIASDPEDQTGESVLTM--KGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
            A++V  +A D  +Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D +TG
Sbjct  121  AVYVYELADDVANQSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPKTG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LL+     +G    IT++A +   +  IT S D
Sbjct  181  QLLESYVIHTGE---ITNVAFNKSKTLAITSSKD  211



>ref|XP_011401093.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
 gb|KFM28081.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
Length=324

 Score =   223 bits (569),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 141/212 (67%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP +++GH RPL  +KYNREGDLL +C KD    +W+ ++G+R GT+ GH GAVW  DI
Sbjct  1    MRPFILQGHSRPLNQVKYNREGDLLVTCGKDKTVNLWWTEDGQRAGTFNGHTGAVWTSDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DS+RLITG AD  V LWD+ TG +   F F  P R+V F+VG+  A +++DPFM   S
Sbjct  61   SYDSTRLITGGADSAVILWDMNTGEEQHHFRFQEPCRAVKFSVGEAFAAVSSDPFMQAVS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            A+ +  IA+DP +Q  E+V T++G +GRI R  W   N+T+I+  ED  +R WD ETGK 
Sbjct  121  AVRILPIAADPAEQGEEAVQTLRGPRGRIARVEWTDQNRTLITASEDGFVRRWDVETGKE  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L     E  H+K I  L  S+DG+HFIT S+D
Sbjct  181  LA---AEHVHEKNIQDLQMSVDGTHFITASVD  209



>ref|XP_001693266.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP03292.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=324

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 139/212 (66%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP L+KGHERPLT +KYNREGDLL SCAK+  P +W A++G R+GTY GHNGA+W CDI
Sbjct  1    MRPYLLKGHERPLTQVKYNREGDLLVSCAKNLQPCLWSAEDGRRIGTYEGHNGAIWTCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + DS RLITGSADQTV++WD+ TG +LF      P R+V  + G++    T+D F+  P 
Sbjct  61   TWDSDRLITGSADQTVRIWDLPTGKELFQIRHREPCRAVKLSAGERFLAATSDAFIESPP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            AIH+ + A + EDQT  + +     +GR+ R  W   N+ +I+  +  +LR WD ETG L
Sbjct  121  AIHIYKFAENIEDQTATAAIEWTVPKGRVTRVFWTDCNRKLITSHDGGILRRWDVETGAL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E   +  H+  I  +  S D +H IT SLD
Sbjct  181  LQE---QQVHEDAIQDMQMSPDETHVITASLD  209



>ref|XP_002957235.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
 gb|EFJ41733.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
Length=324

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 135/212 (64%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP L+KGHERPLT +KYNREGDLL SCAKDH P +W +++G R+GTY GHNGA+W CDI
Sbjct  1    MRPYLLKGHERPLTQVKYNREGDLLVSCAKDHQPCLWSSEDGRRIGTYEGHNGAIWTCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + +S RLITGS DQT+++WD+ TG +LF      P R+V  + G++    TTD F+  P 
Sbjct  61   TWESDRLITGSGDQTIRIWDLPTGKELFQIRHGEPCRAVKLSAGERFLAATTDAFIESPP  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             IH+   A + EDQ    V      +GRI R  W   N+ +I+  +  +LR WD ETG++
Sbjct  121  GIHIYNFAENVEDQRSTPVNAWTVPKGRITRIFWTDCNRKVITSHDYGILRRWDVETGQM  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L+E      H+  I  +  S D +H IT SLD
Sbjct  181  LQEVQV---HEDAIQDMQMSPDETHVITASLD  209



>gb|KIZ03352.1| Eukaryotic translation initiation factor 3 subunit I [Monoraphidium 
neglectum]
Length=329

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 140/217 (65%), Gaps = 8/217 (4%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP L+KGHERPLT +KYNREGDL+ SCAK+  P +W AD+G R+GTY GHNGAVW C+I
Sbjct  1    MRPYLLKGHERPLTQVKYNREGDLMISCAKNLYPCLWMADDGTRIGTYEGHNGAVWTCEI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DS RLIT SADQTV++WD+ TG +L     + P R+   ++G+KL   TTD FMG+P 
Sbjct  61   SMDSQRLITSSADQTVRIWDLPTGKELHQIKMNEPCRACALSIGEKLLAFTTDSFMGIPP  120

Query  441  AIHVKRIASDPEDQTGESV-----LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  605
             IH+  +    E  +G+       LT    +GRI R  W   NK +++  +   +R WDA
Sbjct  121  QIHIVDVDLQAEPGSGQIAGDKPRLTFDAPKGRITRIGWVEQNKVLLTSHDGGFVRRWDA  180

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ETG+LL+E+     H+  I  +  S DGS+ +T SLD
Sbjct  181  ETGELLEEAQV---HEDAIQDMQFSQDGSYVVTASLD  214



>ref|XP_009821601.1| hypothetical protein H257_00561 [Aphanomyces astaci]
 gb|ETV89201.1| hypothetical protein H257_00561 [Aphanomyces astaci]
Length=325

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 144/214 (67%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL+KGH R +T +K+NREGDLL +CAKDH P++W++ NGER+GT+ GH GAVW CDI
Sbjct  1    MQPILLKGHSRSITMIKHNREGDLLVTCAKDHVPSLWYSHNGERIGTFHGHTGAVWACDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S +S  L+T +AD +VKLWD++TG ++F+F      RSV+F++GDK  V   D F   P+
Sbjct  61   SYNSEYLLTAAADASVKLWDLQTGKEIFSFTHTGSARSVNFSLGDKSFVSVADQFGDHPA  120

Query  441  AIHVKRIASDPEDQTGES--VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             + V  +A + E Q+ +    +T  GHQGR+  A W  LN+ II+ GED  +++++ ETG
Sbjct  121  TVFVYDLAQNGEKQSSQPRLAITKHGHQGRVTGAYWTALNEAIITTGEDGYVKLFNPETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L+ E+   +G    IT+LA + D +  IT S D
Sbjct  181  ALISETKVHNG---VITNLAFNKDKTLGITSSKD  211



>ref|XP_005535289.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79003.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
Length=327

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 137/214 (64%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+L+KGHERPLT LK+N EGDLLF+ AKD  PTVW+A  GERLGTY GH GAVW CD+
Sbjct  1    MRPLLLKGHERPLTQLKFNPEGDLLFTTAKDTRPTVWWASTGERLGTYDGHTGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              DS+RL+TGSAD T +LWDV+TG +LF ++  S  RSV  A G +L  +     +G  S
Sbjct  61   FWDSTRLLTGSADNTARLWDVQTGRELFRWSLRSSVRSVGVAPGCRLMHLANSKLLGQES  120

Query  441  AIHVKRIASDP--EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             IH+ R+ SD   ++Q  E  L ++GH   I   VW    + ++S  ED  +R WD ETG
Sbjct  121  CIHLFRLKSDGNWQEQETEPFLVLRGHTATITGVVWYNTAEYMLSVSEDGTVRKWDVETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
               KE D+   HKK IT +  S D   F+TGS D
Sbjct  181  ---KEVDRAKRHKKAITDIKFSKDHQMFLTGSAD  211


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 89/199 (45%), Gaps = 18/199 (9%)
 Frame = +3

Query  33   IKLFGNQKNLQSRNKKMRPIL-MKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGE  209
            I LF  + +   + ++  P L ++GH   +T + +    + + S ++D     W  + G+
Sbjct  122  IHLFRLKSDGNWQEQETEPFLVLRGHTATITGVVWYNTAEYMLSVSEDGTVRKWDVETGK  181

Query  210  RLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFA-  386
             +   + H  A+     S+D    +TGSAD T  LWD     ++ +F  D P  +VD + 
Sbjct  182  EVDRAKRHKKAITDIKFSKDHQMFLTGSADGTAVLWDTHAMQEIRSFVLDRPLNAVDLSP  241

Query  387  ------VG---DKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAV  539
                  VG   +   V TT    G  +A  +  I        GE + ++KGH G IN   
Sbjct  242  LMPHAVVGGGQEASQVTTTAGKAGKFAATFLHLIY-------GEEIFSVKGHFGPINCLS  294

Query  540  WGPLNKTIISGGEDSVLRI  596
            + P  +   SGGED  +R+
Sbjct  295  FTPDGRGFASGGEDGYVRL  313



>ref|XP_005761487.1| hypothetical protein EMIHUDRAFT_438175 [Emiliania huxleyi CCMP1516]
 gb|EOD09058.1| hypothetical protein EMIHUDRAFT_438175 [Emiliania huxleyi CCMP1516]
Length=344

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 143/214 (67%), Gaps = 3/214 (1%)
 Frame = +3

Query  78   KMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCD  257
            K+RPI++KGHER LT +KYNR+GDL+FSC+KDH P+VW+++NGER+GTY GH G VWC D
Sbjct  3    KIRPIMIKGHERALTMIKYNRDGDLIFSCSKDHVPSVWYSENGERIGTYHGHCGTVWCLD  62

Query  258  ISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLP  437
            ++ DS++L++GSAD   KLW+V++G  L T+   +P R V FA+GDK  +   D  MG  
Sbjct  63   VNWDSTKLLSGSADNCCKLWEVQSGECLHTWKHTAPVRCVGFAMGDKRFLTVLDNIMGNV  122

Query  438  SAIHVKRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
              I+V  +  ++  +     +LT+ GH G+I RA+WGPLN+ I S  +DS LR+WD ++G
Sbjct  123  PTIYVWELELNNLANHPDCPLLTILGHTGKIGRALWGPLNEAIYSVSDDSTLRMWDPDSG  182

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +  ++   E  H K IT L  S D +   T   D
Sbjct  183  E--EKHVMEGVHTKKITDLQLSYDKTLLCTSCTD  214


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 79/181 (44%), Gaps = 20/181 (11%)
 Frame = +3

Query  147  DLLFSCAKDHNPTVWFADNGERLGTYRG-HNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + ++S + D    +W  D+GE      G H   +    +S D + L T   DQ V+L++ 
Sbjct  163  EAIYSVSDDSTLRMWDPDSGEEKHVMEGVHTKKITDLQLSYDKTLLCTSCTDQFVRLFET  222

Query  324  KTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFM---GLPSAIHVKRIASDP-------  473
            KT   L+ FN + P  S        ++ +   P++   G   A+ V   A+         
Sbjct  223  KTLRLLYAFNSERPLNSA------AISPLPHCPYLIAGGGQDAMSVTTTAAQQGKFETLF  276

Query  474  -EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI--WDAETGKLLKESDQES  644
             +   GE +  + GH G +N   + P  ++  SGGED  +RI   D E  +  ++   ES
Sbjct  277  FDHAFGEELGCIGGHFGPVNTLAFAPHGRSYASGGEDGYIRIHHLDQEYFEAYEKKVTES  336

Query  645  G  647
            G
Sbjct  337  G  337



>ref|XP_008613397.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|EQC33274.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|KDO31229.1| hypothetical protein SPRG_03847 [Saprolegnia parasitica CBS 223.65]
Length=325

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 140/214 (65%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M PIL+KGH R +T +K+NREGDLL + AKDH P++W++  GER+GT+ GH GAVW CDI
Sbjct  1    MHPILLKGHSRSITMIKHNREGDLLVTVAKDHVPSLWYSSTGERIGTFHGHQGAVWACDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S  S  L+T +AD TVKLWD+KTG +LF+F      RSV+FA GDK  +   D F   P+
Sbjct  61   SYHSEFLLTAAADATVKLWDLKTGKELFSFTHTGSARSVNFAHGDKQFISVADQFAENPA  120

Query  441  AIHVKRIASDPEDQTGES--VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             + V  +A + E Q+ +    +T  GH+GR+  A W PLN+ I++ GED ++++++ ETG
Sbjct  121  TVFVYDLAQNGEKQSSQPKLAITKHGHKGRVTGAYWMPLNEGILTTGEDGMVKLFNPETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L+ E    +G    ITSL+ + D +  IT S D
Sbjct  181  ALISEHKVHNG---SITSLSFNKDKTLAITSSKD  211



>gb|EMT33770.1| hypothetical protein F775_29343 [Aegilops tauschii]
Length=406

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 116/177 (66%), Gaps = 34/177 (19%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTV                        
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTV------------------------  36

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
                       ADQT KLWDVKTG +L TF FD+P RSVD A+GD LAV+TTD FMG   
Sbjct  37   ----------CADQTAKLWDVKTGQELVTFRFDAPARSVDLAIGDHLAVITTDSFMGNMP  86

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
               VKRIA D ++QT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ET
Sbjct  87   TAQVKRIAEDLQEQTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSET  143


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  609  TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            TGKLLKESD+E GH+K I+SL+KS+D SHF+TGSLD
Sbjct  276  TGKLLKESDKEVGHQKAISSLSKSLDWSHFLTGSLD  311



>emb|CCA18540.1| eukaryotic translation initiation factor 3 subunit p [Albugo 
laibachii Nc14]
Length=331

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 129/197 (65%), Gaps = 2/197 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+KGH R +T +KYNREGDLL SC+KD+ P +W++  GER+GTY GH G++W CDI
Sbjct  1    MRPILLKGHSRSITMVKYNREGDLLVSCSKDNAPNLWYSQTGERIGTYEGHTGSLWACDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S  S+ L+T SAD TVKLWDV TG  LFTF    P RSV F++GD+  V   D F+  P+
Sbjct  61   SYHSTYLLTASADSTVKLWDVSTGKCLFTFRHTGPVRSVQFSLGDRYFVSVCDKFVDHPA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGH--QGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             I V  + +D      + VL +  H   GRI  A W PLNK+I++ G D  L+++D ++G
Sbjct  121  TISVYALPNDINQLVDQPVLKITNHGFNGRITGAYWMPLNKSILASGGDGGLKVFDPKSG  180

Query  615  KLLKESDQESGHKKGIT  665
            K+LKE    SG    I+
Sbjct  181  KVLKECKIHSGDVTNIS  197



>ref|XP_005707349.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
 gb|EME30829.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
Length=324

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 130/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+++KGHERPLT LKYN EGDLLFS AKD  PTVW+  NGER+GTYRGHNGAVW  D+
Sbjct  1    MRPLILKGHERPLTMLKYNSEGDLLFSTAKDSTPTVWWTSNGERIGTYRGHNGAVWSIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + DS+R++TGSAD + K W  +TG  + T+   SP R V F+  D+   + T   MG  S
Sbjct  61   NNDSTRVVTGSADNSAKFWRAETGECILTWTHKSPVRCVSFSSDDQFVFVATAMLMGQSS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I+   + S+  ++    + T  GH   + R V  P  KT+IS GED  +R WD ETG  
Sbjct  121  EIYQYLVDSESLEEASVPIRTFSGHSATVTRVVCHPTEKTLISTGEDGTVRKWDIETG--  178

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             + ++  + H+K I  L  S  G   IT S D
Sbjct  179  -RNTETVTIHQKPINDLQLSKSGGQLITASSD  209



>ref|XP_008862518.1| hypothetical protein H310_01239 [Aphanomyces invadans]
 gb|ETW08713.1| hypothetical protein H310_01239 [Aphanomyces invadans]
Length=325

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 141/214 (66%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL+KGH R +T +K+NREGDLL +CAKDH P++W++ NGER+GT+ GH GAVW CDI
Sbjct  1    MQPILLKGHSRSITMIKHNREGDLLVTCAKDHVPSLWYSHNGERIGTFHGHTGAVWACDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S +S  L+T +AD +VKLWD++TG +LF+F      RSV+F++GDK  V   D F   P 
Sbjct  61   SYNSEFLLTAAADASVKLWDLQTGKELFSFTHTGSARSVNFSLGDKSFVSVADQFGDHPP  120

Query  441  AIHVKRIASDPEDQTGES--VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             + V  +A + E Q+ +    +T  GHQGR+  A W  LN  II+ GED  +++++ ETG
Sbjct  121  TVFVYDLAQNGEKQSSQPRLAITKHGHQGRVTGAYWTSLNDGIITTGEDGYVKLFNPETG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L+ E+   +G    IT+LA +   +  IT S D
Sbjct  181  ALITEAKVHNG---VITNLAFNKTKTLGITSSKD  211



>gb|KJB56103.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=264

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 144/248 (58%), Gaps = 37/248 (15%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVW CD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWSCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGL--  434
            SRDS RLITGSADQTVKLW+V+TG QL+TFNF SP R++  + G+   +   D   G   
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARTI-VSAGEDAVIRIWDSETGKLL  119

Query  435  ----PSAIHVKRIASDPEDQTGESVLT-----------------MKGH--QGRINRAVWG  545
                  + H K I S  +   G   LT                 +K +  +  +N     
Sbjct  120  READKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMS  179

Query  546  P-LNKTIISGGED-SVLRIWDAETGK---------LLKESDQESGHKKGITSLAKSIDGS  692
            P L+  ++ GG+D S +   D   GK         L +E     GH   I +LA + DG 
Sbjct  180  PLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGK  239

Query  693  HFITGSLD  716
             F +G  D
Sbjct  240  SFSSGGED  247


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 71/161 (44%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D S  +TGS D++ KLWD 
Sbjct  99   IVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKLWDT  158

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T + T+  + P  +V      D  V     D  AV TTD   G   A    +I    
Sbjct  159  RTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFFDKILQ--  216

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+  SGGED  +R+
Sbjct  217  -----EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRL  252



>ref|XP_004341724.1| eTGF-beta receptor-interacting protein, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR19632.1| eTGF-beta receptor-interacting protein, putative [Acanthamoeba 
castellanii str. Neff]
Length=343

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 139/217 (64%), Gaps = 19/217 (9%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            +RPIL+KGHER LTFLKYNR+GDL+FS AKD  P VWF+D GERLGTY+GH G       
Sbjct  12   LRPILLKGHERALTFLKYNRDGDLIFSAAKDPTPCVWFSDTGERLGTYKGHTG-------  64

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              DS  L+T SAD T KLW+V+TG +LF+++  +P R V FA GD+  +  TDPF  L S
Sbjct  65   --DSKLLLTASADTTAKLWNVETGEELFSWSHRAPVRCVAFAKGDRKFLAVTDPFTKLAS  122

Query  441  AIHVKRIASDPEDQTGESVLTMK-----GHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  605
            +I++ ++  DPE    ++ L M+         +I +A+WGPLNK II   ED  + I D 
Sbjct  123  SIYIYKL--DPERPAKQNPLPMREIVAPTPSAKITQALWGPLNKYIIYSSEDCSVYIHDP  180

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            E+G+LL      + H+  + S+A S D ++FIT S D
Sbjct  181  ESGELLHTI---TDHQAQVNSIAFSWDETYFITSSDD  214


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 64/152 (42%), Gaps = 22/152 (14%)
 Frame = +3

Query  174  HNPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFN  353
            H+P     ++GE L T   H   V     S D +  IT S D+T +L+D KT   L TF 
Sbjct  178  HDP-----ESGELLHTITDHQAQVNSIAFSWDETYFITSSDDRTARLYDSKTFKLLKTFE  232

Query  354  FDSPGRSVDFAV---------GDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVL-T  503
               P  S   +          G K   +TT       SA+      +   D   E  L +
Sbjct  233  SAKPVNSAAISPILDHVLLGGGQKAHGVTT-------SAVESGGFEARIYDMIFEEELGS  285

Query  504  MKGHQGRINRAVWGPLNKTIISGGEDSVLRIW  599
            +KGH G IN   + P  K+  SG ED  +RI+
Sbjct  286  IKGHFGPINTISYAPDGKSYTSGSEDGYMRIY  317



>gb|AAM94012.1| TGF-beta receptor-interacting protein 1 [Griffithsia japonica]
Length=275

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+L+KGHERPLT +K+NR+GDLLF+ A D  PT+W A +GERLGTY GHNGAV   DI
Sbjct  1    MRPLLLKGHERPLTRVKFNRDGDLLFTAAMDKAPTLWRASSGERLGTYHGHNGAVQDLDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S ++ R+ITGS D +  LW+ +TG  +F + F SP R+V F+ GD    + T   MG  S
Sbjct  61   SHNTERIITGSGDNSAILWNAETGQPIFKWEFKSPARAVAFSPGDSHVAIATANLMGQQS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++V R     E+Q  E V+ ++GH   I R +W P  + I++   D  LR W+  TG  
Sbjct  121  NVYVYRHDRTTEEQETEPVIVLEGHTATIVRVLWYPTAEYILTAARDLTLRKWEVSTG--  178

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             KE+D    H   I       DG   IT S D
Sbjct  179  -KEADLVEAHTSAIQDCQWGPDGMTMITSSKD  209



>gb|EPY53170.1| translation initiation factor eIF3i [Schizosaccharomyces cryophilus 
OY26]
Length=328

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 134/213 (63%), Gaps = 2/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPI+++GHERPLT +KYN +GDLLFSCAKD    VWF+ NGERLGTY GH GA+W CDI
Sbjct  1    MRPIILQGHERPLTQIKYNHDGDLLFSCAKDKVINVWFSHNGERLGTYEGHTGAIWTCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S++S+ +++G+AD T++LWDVKTG QLF + F +  + V+F   D   +  T+  MG   
Sbjct  61   SKNSALMVSGAADNTMRLWDVKTGKQLFKWEFPTAVKRVEFNEDDSRILAVTEQRMGFSG  120

Query  441  AIHVKRIASDPEDQTGESVL-TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + V R+ S   D   E+ L  +   + +   A W  L+K +I+G +D  +  +DA+TG 
Sbjct  121  TVTVVRVPSFENDVAAETPLYVITTRESKATVAGWSYLSKYLITGHDDGSVSRYDAKTGD  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L ES Q       IT L  S+D ++F+T   D
Sbjct  181  YL-ESKQVHNPGASITDLQFSVDRTYFVTACKD  212



>ref|XP_004364074.2| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=325

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 130/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPI+++GHER LT +KYN+EGDLLFS +KD    VWF+ NGERLGTY GHNG VWC D+
Sbjct  1    MRPIILQGHERSLTQIKYNKEGDLLFSVSKDKLANVWFSHNGERLGTYDGHNGTVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               S  ++TGSADQ+ +LW+ +TG QL  F   +  R+  F+   K    TTD  MG P 
Sbjct  61   DYASKYVLTGSADQSARLWECRTGKQLVKFATPTSVRTCGFSYSGKTIFYTTDNVMGHPC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I    +  +    T    +       +I  AV+GPL+KT+I+G +D  + +WD ETGK+
Sbjct  121  RIFFHDLKDELAQSTEPKKIIDLPAGNKITAAVFGPLDKTLITGHDDGTINVWDVETGKI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +K S +   H+K I S+  + D + F++ S D
Sbjct  181  IKSSQE---HEKYINSIQLNGDQTSFVSASKD  209



>ref|XP_001603140.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Nasonia vitripennis]
 ref|XP_008210952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Nasonia vitripennis]
 ref|XP_008210953.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Nasonia vitripennis]
Length=326

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 135/217 (62%), Gaps = 12/217 (6%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GH+R +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GH+G+VWC D+
Sbjct  1    MKPLMLHGHDRAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHSGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++RLI+GS D T++LWDV+TG QL      SP R   F+    LAV  TD  MG   
Sbjct  61   NWDTTRLISGSGDNTLRLWDVETGKQLSFLEKKSPVRCCSFSFSGNLAVFATDKSMGQNC  120

Query  441  AIHVKRIAS-----DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  605
             + V  + S      PED    +VL       RI+  +WG L++T+I+G E+  L IWD+
Sbjct  121  EMFVMDVRSPEPVFSPEDNVCRNVL----EGSRISSLLWGALDETLITGHENGELNIWDS  176

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             TG   K+S    GH+  I  +  + DG+ F+T S D
Sbjct  177  RTG---KKSYDAQGHQGQINDMQFNKDGTMFVTASKD  210



>gb|ELU14583.1| hypothetical protein CAPTEDRAFT_180537 [Capitella teleta]
Length=325

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 132/212 (62%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GH+R LT +KYNREGDLLFSCAKD +P VW++ NGERLGT+ GH GAVWC D+
Sbjct  1    MKPLMLHGHDRALTQIKYNREGDLLFSCAKDSHPNVWYSINGERLGTFEGHGGAVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+S+++TGSAD T +LWD  TG QL  F+  S  R+  F+   +L + TTD  MG   
Sbjct  61   DWDTSKVMTGSADNTCRLWDCSTGVQLEQFDTRSAVRTCGFSYSGQLLMYTTDSTMGQKC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             + +       + +  E ++ +     ++  AVWGPL++T+ISG E+  +  WD + G++
Sbjct  121  EMRIYDSRDSAQIKNNEPMMVLPMPASKVTSAVWGPLDQTVISGHENGNIIQWDMKEGEM  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            + +      H K I  +  S D + FIT S D
Sbjct  181  VHKV---LDHSKQINDIQFSKDMTMFITASKD  209



>gb|ACD65081.1| eukaryotic translation initiation factor [Forcipomyia taiwana]
Length=325

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 8/215 (4%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++M+GHER +T +KYNREGDLLFSCAKDH P VWF+ NGERLGT+ GH GAVWC D+
Sbjct  1    MKPLMMQGHERAITQIKYNREGDLLFSCAKDHKPNVWFSLNGERLGTFNGHAGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +++LITGS D +V+LWDV+TGT +      S  R+V F+     A  +TD  MG   
Sbjct  61   DWTTTKLITGSGDMSVRLWDVETGTSVACIPCKSSARTVGFSFSGNQAAYSTDRAMGHIC  120

Query  441  AIHVKRIASDPEDQT---GESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
             + V  I S   D +   G+++L +   Q +I   +WG L++TII+G E+  + +WD   
Sbjct  121  ELFV--IDSREPDSSLNDGDAILKIPISQSKITAMIWGTLDETIITGHENGQITLWDLRI  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            G   +E +  + H   I  L  S DG+ F++ S D
Sbjct  179  G---REINSVNDHMGAINDLQLSKDGTMFVSSSRD  210



>ref|XP_001868509.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
 ref|XP_001868761.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
 sp|B0XFT7.1|EIF3I_CULQU RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Culex quinquefasciatus]
 gb|EDS27016.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
 gb|EDS27653.1| eukaryotic translation initiation factor 3 subunit 2 [Culex quinquefasciatus]
Length=328

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 135/216 (63%), Gaps = 7/216 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GHER +T +KYNREGDL+FS AKDH P+VWF+ NGERLGTY GH GAVWC D+
Sbjct  1    MKPLMLQGHERAITQIKYNREGDLIFSTAKDHKPSVWFSLNGERLGTYNGHQGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               ++RLITG+ D + KLWDV+TG+ L T   +S  R+ +F+     A  +TD  MG  S
Sbjct  61   DWTTTRLITGAGDMSTKLWDVETGSVLGTIPCNSAARTANFSFSGNQASYSTDKAMGHNS  120

Query  441  A---IHVKRIASDPEDQTGESVLTM-KGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAE  608
                I V+ + S    Q+    LTM +  Q +I   +WG L++T+I+G E+  +RIWD  
Sbjct  121  ELFIIDVRNVDSSISSQSPVLKLTMNQSIQTKITSMLWGALDETVITGHENGSIRIWDLR  180

Query  609  TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            T K L   +  +G    I  +  S DG+  ++ S D
Sbjct  181  TAKELNSVNDHTG---VINDMQLSADGTMLVSASKD  213



>ref|XP_001656392.1| AAEL013144-PA [Aedes aegypti]
 sp|Q16K15.1|EIF3I_AEDAE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Aedes aegypti]
 gb|EAT34637.1| AAEL013144-PA [Aedes aegypti]
Length=326

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 133/215 (62%), Gaps = 7/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GHER +T +KYNREGDL+FS AKDH P+VWF+ NGERLGT+ GH GAVWC D+
Sbjct  1    MKPLMLQGHERAITQIKYNREGDLIFSTAKDHKPSVWFSLNGERLGTFNGHQGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               ++RLITGS D + KLWDV+TG+ L T   +S  R+V+F+     A  +TD  MG   
Sbjct  61   DWTTTRLITGSGDMSTKLWDVETGSVLGTIPCNSAARTVNFSYSGNQASYSTDKAMGHNC  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
                I V+ + S   +Q+    LTM   Q +I   +WG L++T+I+G E+  +RIWD   
Sbjct  121  ELFIIDVRNVDSSISNQSPVLKLTMN-QQSKITSMLWGALDETVITGHENGSIRIWDLRA  179

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             K L   +    H   I  +  S DG+  ++ S D
Sbjct  180  AKELNSVND---HTLNINDMQLSSDGTMLVSASKD  211



>gb|KJE92223.1| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=329

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 129/211 (61%), Gaps = 3/211 (1%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            RPI+++GHER LT +KYN+EGDLLFS +KD    VWF+ NGERLGTY GHNG VWC D+ 
Sbjct  6    RPIILQGHERSLTQIKYNKEGDLLFSVSKDKLANVWFSHNGERLGTYDGHNGTVWCIDVD  65

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
              S  ++TGSADQ+ +LW+ +TG QL  F   +  R+  F+   K    TTD  MG P  
Sbjct  66   YASKYVLTGSADQSARLWECRTGKQLVKFATPTSVRTCGFSYSGKTIFYTTDNVMGHPCR  125

Query  444  IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  623
            I    +  +    T    +       +I  AV+GPL+KT+I+G +D  + +WD ETGK++
Sbjct  126  IFFHDLKDELAQSTEPKKIIDLPAGNKITAAVFGPLDKTLITGHDDGTINVWDVETGKII  185

Query  624  KESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            K S +   H+K I S+  + D + F++ S D
Sbjct  186  KSSQE---HEKYINSIQLNGDQTSFVSASKD  213



>gb|EPX75306.1| translation initiation factor eIF3i [Schizosaccharomyces octosporus 
yFS286]
Length=328

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPI+++GHERPLT +KYN +GDLLFSCAKD    VWF+ NGERLGTY GH GA+W CDI
Sbjct  1    MRPIILQGHERPLTQIKYNHDGDLLFSCAKDKVINVWFSHNGERLGTYEGHTGAIWTCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S++SS + +G+AD T++LWDVK+G +LF + F +  + V+F   D      T+  MG   
Sbjct  61   SKNSSLMASGAADNTMRLWDVKSGKELFKWEFPTAVKRVEFNEDDSRIFAVTEQRMGFSG  120

Query  441  AIHVKRIASDPEDQTGESVL-TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + V R+ S   D   E+ L  +   + +   A W  L+K +I+G +D  +  +DA TG+
Sbjct  121  TVTVFRVPSSANDVAAETPLYVITTRESKATVAGWSYLSKYLITGHDDGSVSRYDANTGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L ES Q       IT L  S D ++F+T   D
Sbjct  181  FL-ESKQIHNVGASITDLQFSPDRTYFVTACKD  212



>ref|XP_002021487.1| GL26537 [Drosophila persimilis]
 ref|XP_001355946.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
 sp|B4GSH1.1|EIF3I_DROPE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
persimilis]
 sp|Q29L19.2|EIF3I_DROPS RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
pseudoobscura pseudoobscura]
 gb|EDW25330.1| GL26537 [Drosophila persimilis]
 gb|EAL33005.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
Length=326

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 130/215 (60%), Gaps = 7/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              +S +LITG+ D T KLWDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWESRKLITGAGDMTTKLWDVEYGTIIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQNC  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
                I V+   S   DQT    L +   + +I    WGPL++TII+G ++  + IWD   
Sbjct  121  ELFIIDVRNADSTLADQT--PTLRIPMTESKITSMQWGPLDETIITGHDNGNIAIWDVRK  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            G+  K  D  S H  GI  +  S DG+ F+T S D
Sbjct  179  GQ--KVVDSGSDHAAGINDMQLSKDGTMFVTASRD  211



>emb|CDP11954.1| unnamed protein product [Coffea canephora]
Length=109

 Score =   175 bits (444),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPILMKGHERPLTFLKYNR+GDLLFSCAKDH PTVWFADNGERLGTYRGHNGAVWCCD+
Sbjct  1    MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLGTYRGHNGAVWCCDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLF  344
            SRDSS L+TGSADQT KLW+VKTGT  F
Sbjct  61   SRDSSLLLTGSADQTAKLWNVKTGTWGF  88



>ref|XP_008549768.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 136/213 (64%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG++WC D+
Sbjct  1    MKPLMLHGHERAITMIKYNREGDLIFSASKDKKPNVWYSLNGERLGTFNGHNGSIWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D+SR ++GS D ++++WD +TG ++   + +S  RS  F+     AV +TD  +G   
Sbjct  61   NWDTSRFLSGSGDNSLRIWDCQTGKEIGRLDTNSSVRSCAFSFSANTAVFSTDKALGHQC  120

Query  441  AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +    + +P     ++++ +  +  RI+  +WG L++TII+G ED  + IWD  TGK
Sbjct  121  EMFIIDTRNVEPTLSLEDAIIRIPINGPRISAILWGALDETIITGHEDGEINIWDVRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L   + + GHK  I  +  S DG+ FIT S D
Sbjct  181  KL---NSQKGHKSQINDMQASKDGTMFITASKD  210


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 64/153 (42%), Gaps = 17/153 (11%)
 Frame = +3

Query  168  KDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFT  347
            +D    +W    G++L + +GH   +     S+D +  IT S D T KL+D ++   L T
Sbjct  167  EDGEINIWDVRTGKKLNSQKGHKSQINDMQASKDGTMFITASKDHTAKLFDSESLMHLKT  226

Query  348  FNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESV  497
            +  + P  S       D  V     D + V TT    G   A     +         E  
Sbjct  227  YKTERPVNSATISPIYDHVVLGGGQDAMDVTTTSTRQGKFDARFYHLVFE-------EEF  279

Query  498  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
              +KGH G IN   + P  ++  SGGED  +RI
Sbjct  280  ARLKGHFGPINSLAFHPNGRSFSSGGEDGYVRI  312



>ref|XP_005718524.1| Translation initiation factor eIF3, subunit I [Chondrus crispus]
 emb|CDF38619.1| Translation initiation factor eIF3, subunit I [Chondrus crispus]
Length=327

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 129/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+L+KGHERPLT  K+NREGDLLF+ A D +P+VW + NGER+GTY+GHNGAV    +
Sbjct  1    MRPLLLKGHERPLTRAKFNREGDLLFTTAMDKSPSVWRSSNGERIGTYKGHNGAVRDISV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++R+ITGSAD +  LW+ +TG +L  ++F SP RSV F+ GD    + T   MG  S
Sbjct  61   TWDTTRVITGSADNSAILWNAETGEKLHQWHFKSPVRSVAFSPGDAYIAIATAKLMGQAS  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             + +        +QT E V  ++GH+G I R +W    + +++  ED  +R WD E G  
Sbjct  121  NVFIFAHNKSSNEQTEEPVKVLEGHEGTITRVLWHASAEILLTASEDKTIRKWDVEAG--  178

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             +E    + HK  I     S D +  IT S D
Sbjct  179  -EEIQCVTAHKNDIKDCQFSADYAMVITASKD  209


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 83/200 (42%), Gaps = 20/200 (10%)
 Frame = +3

Query  39   LFGNQKNLQSRNKKMRPI-LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL  215
            +F    N  S  +   P+ +++GHE  +T + ++   ++L + ++D     W  + GE +
Sbjct  122  VFIFAHNKSSNEQTEEPVKVLEGHEGTITRVLWHASAEILLTASEDKTIRKWDVEAGEEI  181

Query  216  GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGD  395
                 H   +  C  S D + +IT S D T KLW     + L T+  D P  S       
Sbjct  182  QCVTAHKNDIKDCQFSADYAMVITASKDHTAKLWSFHDFSLLRTYTVDHPVNSA------  235

Query  396  KLAVMTTDPFMGLPSAIHVKRIASDPEDQ-----------TGESVLTMKGHQGRINRAVW  542
              AV      + L       ++ +  + Q             E +  +KGH G IN   +
Sbjct  236  --AVSPIFSHILLGGGQEASQVTTTGDRQGKFEGKIFHLVYEEELGRVKGHFGPINTVAF  293

Query  543  GPLNKTIISGGEDSVLRIWD  602
             P  K  +SGGED  +R+ D
Sbjct  294  SPDGKQYVSGGEDGFVRLHD  313



>ref|XP_002078185.1| GD22675 [Drosophila simulans]
 sp|B4Q354.1|EIF3I_DROSI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
simulans]
 gb|EDX03770.1| GD22675 [Drosophila simulans]
Length=326

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 131/215 (61%), Gaps = 7/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWESRKLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSC  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
                I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   
Sbjct  121  ELFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRK  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            G+  K  D  + H  GI  +  S DG+ F+T S D
Sbjct  179  GQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASRD  211



>ref|NP_523478.1| Trip1 [Drosophila melanogaster]
 ref|XP_002037884.1| GM18055 [Drosophila sechellia]
 sp|O02195.1|EIF3I_DROME RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog; AltName: 
Full=eIF-3-beta [Drosophila melanogaster]
 sp|B4I195.1|EIF3I_DROSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
sechellia]
 gb|AAB53431.1| TRIP-1 homolog [Drosophila melanogaster]
 gb|AAF52183.1| Trip1 [Drosophila melanogaster]
 gb|AAM49896.1| LD24026p [Drosophila melanogaster]
 gb|EDW54302.1| GM18055 [Drosophila sechellia]
 gb|ACL84827.1| Trip1-PA, partial [synthetic construct]
 gb|ACL89803.1| Trip1-PA [synthetic construct]
Length=326

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 131/215 (61%), Gaps = 7/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWESRKLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSC  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
                I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   
Sbjct  121  ELFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRK  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            G+  K  D  + H  GI  +  S DG+ F+T S D
Sbjct  179  GQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKD  211



>ref|XP_001968738.1| GG24335 [Drosophila erecta]
 sp|B3N4C7.1|EIF3I_DROER RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
erecta]
 gb|EDV57797.1| GG24335 [Drosophila erecta]
Length=326

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 131/215 (61%), Gaps = 7/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWESRKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSC  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
                I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   
Sbjct  121  ELFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRK  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            G+  K  D  + H  GI  +  S DG+ F+T S D
Sbjct  179  GQ--KVVDSGTDHSAGINDMQLSKDGTMFVTASKD  211



>ref|XP_011254946.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camponotus floridanus]
Length=326

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (63%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER  T +KYNREGDLLFS +KD  P VW+A NGERLGT+ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERATTKIKYNREGDLLFSASKDKQPNVWYALNGERLGTFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTTRLLSGSGDNTLRVWDCQTGKEIGQLSTNSSVRACGFSYSANLAVFSTDKALGHQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121  EMFIMDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  181  KLSSV---KGHKSQINDMQCNKDGTMFVTASKD  210



>ref|XP_011055583.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Acromyrmex echinatior]
Length=326

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 135/213 (63%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTTRLLSGSGDNTLRVWDCETGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121  EMFIMDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  181  KLSSV---KGHKSQINDMQCNKDGTMFVTASKD  210



>ref|XP_011160448.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Solenopsis invicta]
Length=326

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 135/213 (63%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTTRLLSGSGDNTLRVWDCQTGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  + +     + E  ++     G RI+  +WG L++TII+G ED  L++WD  TGK
Sbjct  121  EMFIMDVRNVDSTLSQEDAISRILVNGPRISAILWGALDETIITGHEDGELKLWDVRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  181  KLSSV---KGHKSQINDMQFNKDGTMFVTASKD  210



>dbj|BAA13849.1| unnamed protein product [Schizosaccharomyces pombe]
Length=335

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 131/215 (61%), Gaps = 2/215 (1%)
 Frame = +3

Query  75   KKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCC  254
            +KMRPI+++GHERPLT +KYN +GDLLFSCAKD    VWF+ NGERLGTY GH GA+W C
Sbjct  6    QKMRPIILQGHERPLTQIKYNHDGDLLFSCAKDKVINVWFSHNGERLGTYEGHTGAIWTC  65

Query  255  DISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGL  434
            DI++ S+ +++G+AD T++LWDVKTG QL+ + F +  + V+F   D   +  T+  MG 
Sbjct  66   DINKSSTLMVSGAADNTMRLWDVKTGKQLYKWEFPTAVKRVEFNEDDTRILAVTEERMGY  125

Query  435  PSAIHVKRIASDPEDQTGESVL-TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
               + V R+     D   E+ L  +   + +   A W  L+K + +G ED  +  +DA T
Sbjct  126  AGTVTVFRVPISESDAAAETPLYVITTRESKATVAGWSYLSKFLFTGHEDGSVSRYDAIT  185

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            G+ + ES Q       IT L    D ++FIT   D
Sbjct  186  GEFV-ESKQVHNSGSTITDLQFYPDRTYFITSCKD  219



>ref|XP_011337589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cerapachys biroi]
 gb|EZA54998.1| Eukaryotic translation initiation factor 3 subunit I [Cerapachys 
biroi]
Length=326

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 134/213 (63%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER  T +KY+REGDLLFS +KD  P VW+A NGERLGT+ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERATTKIKYSREGDLLFSASKDKQPNVWYALNGERLGTFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D+SRL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTSRLLSGSGDNTLRVWDCQTGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  I +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK
Sbjct  121  EMFIMDIRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  181  KLTSV---KGHKSQINDMQFNKDGTMFVTASKD  210



>ref|XP_001965147.1| GF23646 [Drosophila ananassae]
 gb|EDV33281.1| GF23646 [Drosophila ananassae]
Length=332

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 132/219 (60%), Gaps = 7/219 (3%)
 Frame = +3

Query  69   RNKKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVW  248
            R  + RP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVW
Sbjct  3    RCYRSRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVW  62

Query  249  CCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFM  428
            C D+  +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  M
Sbjct  63   CLDVDWESRKLITGAGDMTTKIWDVEYGTIIASIPSKSSVRTSNFSFSGNQAAYSTDKAM  122

Query  429  GLPSA---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIW  599
            G       I V+   S   +QT    L +   + +I   +WGPL++TII+G ++  + IW
Sbjct  123  GQSCELFIIDVRNADSSLAEQT--PTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIW  180

Query  600  DAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            D   G+  K  D  S H  GI  +  S DG+ F+T S D
Sbjct  181  DIRKGQ--KVVDSGSDHTAGINDMQLSKDGTMFVTASKD  217



>ref|XP_008210954.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Nasonia vitripennis]
Length=322

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 12/213 (6%)
 Frame = +3

Query  93   LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  272
            ++ GH+R +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GH+G+VWC D++ D+
Sbjct  1    MLHGHDRAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHSGSVWCIDVNWDT  60

Query  273  SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  452
            +RLI+GS D T++LWDV+TG QL      SP R   F+    LAV  TD  MG    + V
Sbjct  61   TRLISGSGDNTLRLWDVETGKQLSFLEKKSPVRCCSFSFSGNLAVFATDKSMGQNCEMFV  120

Query  453  KRIAS-----DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
              + S      PED    +VL       RI+  +WG L++T+I+G E+  L IWD+ TG 
Sbjct  121  MDVRSPEPVFSPEDNVCRNVL----EGSRISSLLWGALDETLITGHENGELNIWDSRTG-  175

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
              K+S    GH+  I  +  + DG+ F+T S D
Sbjct  176  --KKSYDAQGHQGQINDMQFNKDGTMFVTASKD  206



>ref|XP_002088703.1| Trip1 [Drosophila yakuba]
 gb|EDW88415.1| Trip1 [Drosophila yakuba]
Length=325

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 130/214 (61%), Gaps = 7/214 (3%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            RP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+ 
Sbjct  1    RPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVD  60

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
             +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    
Sbjct  61   WESRKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCE  120

Query  444  ---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
               I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   G
Sbjct  121  LFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKG  178

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +  K  D  + H  GI  +  S DG+ F+T S D
Sbjct  179  Q--KVVDSGTDHSAGINDMQLSKDGTMFVTASKD  210



>ref|NP_594958.1| translation initiation factor eIF3i [Schizosaccharomyces pombe 
972h-]
 sp|P79083.1|EIF3I_SCHPO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 39 kDa subunit homolog; Short=eIF-3 39 kDa 
subunit homolog; Short=eIF3 p39; AltName: Full=Suppressor of 
uncontrolled mitosis 1 [Schizosaccharomyces pombe 972h-]
 emb|CAA70722.1| SUM1 [Schizosaccharomyces pombe]
 emb|CAB11277.1| translation initiation factor eIF3i [Schizosaccharomyces pombe]
Length=328

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPI+++GHERPLT +KYN +GDLLFSCAKD    VWF+ NGERLGTY GH GA+W CDI
Sbjct  1    MRPIILQGHERPLTQIKYNHDGDLLFSCAKDKVINVWFSHNGERLGTYEGHTGAIWTCDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            ++ S+ +++G+AD T++LWDVKTG QL+ + F +  + V+F   D   +  T+  MG   
Sbjct  61   NKSSTLMVSGAADNTMRLWDVKTGKQLYKWEFPTAVKRVEFNEDDTRILAVTEERMGYAG  120

Query  441  AIHVKRIASDPEDQTGESVL-TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + V R+     D   E+ L  +   + +   A W  L+K + +G ED  +  +DA TG+
Sbjct  121  TVTVFRVPISESDAAAETPLYVITTRESKATVAGWSYLSKFLFTGHEDGSVSRYDAITGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             + ES Q       IT L    D ++FIT   D
Sbjct  181  FV-ESKQVHNSGSTITDLQFYPDRTYFITSCKD  212



>gb|EFZ22632.1| hypothetical protein SINV_00160 [Solenopsis invicta]
Length=326

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 134/212 (63%), Gaps = 4/212 (2%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            +P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D++
Sbjct  2    KPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDVN  61

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
             D++RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G    
Sbjct  62   WDTTRLLSGSGDNTLRVWDCQTGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQCE  121

Query  444  IHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            + +  + +     + E  ++     G RI+  +WG L++TII+G ED  L++WD  TGK 
Sbjct  122  MFIMDVRNVDSTLSQEDAISRILVNGPRISAILWGALDETIITGHEDGELKLWDVRTGKK  181

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L       GHK  I  +  + DG+ F+T S D
Sbjct  182  LSSV---KGHKSQINDMQFNKDGTMFVTASKD  210



>ref|XP_011314062.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Fopius arisanus]
Length=326

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 136/213 (64%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDL+FS +KD NP VW++ NGERLGT+ GHNG++WC D+
Sbjct  1    MKPLMLHGHERAITKIKYNREGDLIFSASKDKNPNVWWSLNGERLGTFNGHNGSIWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D+SR ++GS D T+++WD +TG ++     +S  R+ +F+     AV +TD  +G   
Sbjct  61   NWDTSRFMSGSGDNTLRIWDCQTGKEIGQLPTNSSVRTCNFSYSANTAVYSTDKALGHQC  120

Query  441  AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +    + DP     +++  +  +  RI+  +WG L++TII+G ED  + IWD  TGK
Sbjct  121  EMFIIDTRTVDPILSQEDAIRRIPINGPRISAILWGALDETIITGHEDGEINIWDVRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +L  +    GH+  I  +  + DG+ F+T S D
Sbjct  181  ILTSA---KGHRSQINDMQFNKDGTMFVTASKD  210


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 65/160 (41%), Gaps = 17/160 (11%)
 Frame = +3

Query  147  DLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVK  326
            + + +  +D    +W    G+ L + +GH   +     ++D +  +T S D T KL+D +
Sbjct  160  ETIITGHEDGEINIWDVRTGKILTSAKGHRSQINDMQFNKDGTMFVTASKDHTAKLFDSE  219

Query  327  TGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDPE  476
                L T+  + P  S       D  V     D + V TT    G   A     +     
Sbjct  220  QLVHLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDARFFHMVFE---  276

Query  477  DQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                E    +KGH G IN   + P  K+  SGGED  +RI
Sbjct  277  ----EEFARLKGHFGPINSLAFHPNGKSFSSGGEDGYVRI  312



>gb|KFH67131.1| translation initiation factor eIF-3 subunit 2 [Mortierella verticillata 
NRRL 6337]
Length=327

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 131/213 (62%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER LT +KYNREGDLLFS +KDH    WF+ NGERLGTY GH GAVW  D+
Sbjct  1    MRPILLQGHERSLTQIKYNREGDLLFSVSKDHVVNAWFSHNGERLGTYEGHIGAVWTVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            +  ++ L++GSAD T KLWDV  G  L ++ F++  R V F+  DK  ++ T+P MG P+
Sbjct  61   NSTTTLLVSGSADNTAKLWDVSNGKCLKSWEFNTAVRRVQFSEDDKKILLITEPRMGFPA  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  I +   +      L +   QG +I  A WG L+K I++G E+  + + D +TG+
Sbjct  121  TLQIFNIENGLTEPVSSEPLEVIHPQGPKITVAAWGALDKYIVAGRENGSVALIDPQTGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             +  +     H   +T L  S D ++FIT S D
Sbjct  181  CVSTNKI---HDLTLTDLQMSTDRTYFITSSKD  210



>ref|XP_006003298.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Latimeria chalumnae]
Length=299

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 131/212 (62%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDPTVNVWYSVNGERLGTYGGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL  F  +S  R+  F  G  + + +TD  MG   
Sbjct  61   DWDTRHVLTGSADNSCRLWDCETGKQLALFKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +++  +    + +  +  +++   + +I  AVWGPL + IISG E+  +  + A++G+L
Sbjct  121  YVNIFDLRDSNQIENNDPYISIPCSESKITSAVWGPLGEFIISGHENGEVNQYCAKSGEL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+  +   H K +  L  S D +  IT S D
Sbjct  181  LKKVKE---HSKQLNDLQTSRDLNMIITASKD  209



>gb|AAU89474.1| putative translation initiation factor 3 subunit 2 (eif-3 beta), 
partial [Aedes aegypti]
Length=285

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 126/202 (62%), Gaps = 4/202 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GHER +T +KYNREGDL+FS AKDH P+VWF+ NGERLGT+ GH GAVWC D+
Sbjct  1    MKPLMLQGHERVITQIKYNREGDLIFSTAKDHKPSVWFSLNGERLGTFNGHQGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               ++RLITGS D + KLWDV+TG+ L T   +S  R+V+F+     A  +TD  MG   
Sbjct  61   DWTTTRLITGSGDMSTKLWDVETGSVLGTIPCNSAARTVNFSYSGNQASYSTDKAMGHNC  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
                I V+ + S   +Q+    LTM   Q +I   +WG L++T+I+G E+  +RIWD   
Sbjct  121  ELFIIDVRNVDSSISNQSPVLKLTMN-QQSKITSMLWGALDETVITGHENGSIRIWDLRA  179

Query  612  GKLLKESDQESGHKKGITSLAK  677
             K L   +  +   +   S  +
Sbjct  180  AKELNSVNDHTPQYQTTCSCLR  201



>ref|XP_001688930.1| AGAP006607-PB [Anopheles gambiae str. PEST]
 gb|EDO63936.1| AGAP006607-PB [Anopheles gambiae str. PEST]
Length=297

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 133/215 (62%), Gaps = 6/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GH+R +T +KYNREGDL+FS AKD  P+VW++ NGERLGT+ GH GAVWC D+
Sbjct  1    MKPLMLQGHQRAITQIKYNREGDLIFSSAKDSKPSVWYSLNGERLGTFNGHIGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               ++RLITG+ D    LWDV+TGT L     +S  R+ +F+     A  +TD  M  P 
Sbjct  61   DWTTTRLITGAGDMNTFLWDVETGTALGKIPCNSSVRTCNFSFSGNQASYSTDRAMNHPC  120

Query  441  AIHVKRIAS-DPEDQTGESV--LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
             + V  + + D    + + V  LTM   Q +I   +WG L++T+I+G E+  LRIWD   
Sbjct  121  ELFVIDVRNIDASISSADPVLKLTMNEQQSKITSMLWGALDETVITGHENGSLRIWDL--  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             + +KE +  + H   IT +  S DG+ F++ S D
Sbjct  179  -RAVKELNSVNDHTASITDMQMSSDGTMFVSSSKD  212



>ref|XP_011501372.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Ceratosolen solmsi marchali]
Length=326

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 135/217 (62%), Gaps = 12/217 (6%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++R ++GS D T+++WD +TG  +   + +S  R+  F+    LAV  TD  +G   
Sbjct  61   NWDTTRFLSGSGDNTLRIWDCQTGKAISQLSTNSSVRACSFSYSGDLAVYATDKALGHQC  120

Query  441  AIHVKRIAS-----DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  605
             + V  I S       ED    ++++      RI+  +WG L++T+I+G E+  + IWD+
Sbjct  121  EMFVIDIRSPEIILSQEDNICRTLIS----GSRISSLLWGALDETVITGHENGDINIWDS  176

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             TGK L ++    GHK  I  +  + DG+ F+T S D
Sbjct  177  RTGKKLNDA---QGHKGQINDMQFNKDGTMFVTASKD  210


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 64/147 (44%), Gaps = 17/147 (12%)
 Frame = +3

Query  186  VWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSP  365
            +W +  G++L   +GH G +     ++D +  +T S D T KL+D  +   L T+  + P
Sbjct  173  IWDSRTGKKLNDAQGHKGQINDMQFNKDGTMFVTASKDHTAKLFDSDSLMSLKTYKTERP  232

Query  366  GRSVDFA-------VG---DKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGH  515
              S   +       VG   D + V TT    G   A     +         E    +KGH
Sbjct  233  VNSATISPNYDHVVVGGGQDAMDVTTTSTKQGKFDARFFHLVFE-------EEFARLKGH  285

Query  516  QGRINRAVWGPLNKTIISGGEDSVLRI  596
             G IN   + P  +T+ +GGED  +RI
Sbjct  286  FGPINSLAFHPNGRTLCTGGEDGYIRI  312



>emb|CCI46504.1| unnamed protein product [Albugo candida]
Length=317

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 117/182 (64%), Gaps = 2/182 (1%)
 Frame = +3

Query  126  LKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQT  305
            +KYNREGDLL SCAKD++P +W++  GER+GTY GH G++W CDIS  S+ L+T SAD T
Sbjct  2    VKYNREGDLLVSCAKDNSPNLWYSQTGERIGTYEGHTGSLWACDISYHSTYLLTASADST  61

Query  306  VKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHVKRIASDPEDQT  485
            VKLWD+ TG  LFTF    P RSV F++GD+  V   D F+  P+ I V  + +D     
Sbjct  62   VKLWDLPTGKCLFTFKHTGPVRSVQFSLGDRYFVSVCDKFVDHPATISVYALPNDVNQLV  121

Query  486  GESVLTMKGH--QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  659
             + +L +  H   GRI  A W PLN +I++ G D  L+++D ++GK+LKE    SG    
Sbjct  122  DQPILKITNHGFNGRITGAYWMPLNTSILASGGDGGLKLFDPKSGKVLKECKIHSGDITN  181

Query  660  IT  665
            I+
Sbjct  182  IS  183



>ref|XP_005181692.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Musca domestica]
Length=324

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 128/213 (60%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +KYNREGDLLFSC+KD  P VW+++NGERLGTY GH GA+WC D+
Sbjct  1    MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSNNGERLGTYDGHQGAIWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +S+LITGS D T K+WDV+ G  + +    S  R+ +F+     A  TTD  MG  S
Sbjct  61   DWTTSKLITGSGDMTTKIWDVEHGLVIASIPAKSSVRTCNFSYSGNQAAYTTDKAMGQNS  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  +  +D        +L +   Q +I   +WG L++TII+G ++  + IWD   G 
Sbjct  121  ELFIIDVRTADSSLAEQNPILRIPMLQSKITSMLWGSLDETIITGHDNGQISIWDIRKG-  179

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
              +E +  + H   I  +    DG+ F+T S D
Sbjct  180  --REVNSVNDHTGSINDMQMYKDGTMFVTASKD  210



>ref|NP_001279068.1| eukaryotic translation initiation factor 3, subunit I [Callorhinchus 
milii]
 gb|AFK11321.1| eukaryotic translation initiation factor 3 subunit I-like protein 
[Callorhinchus milii]
Length=325

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFSCAKD     W++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSCAKDTIVNGWYSLNGERLGTYNGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+ ++++GSAD + +LWD +TG QL  F   S  R+  F     + + TTD  MG   
Sbjct  61   DWDTKQVLSGSADNSCRLWDCETGKQLALFETSSAVRTCGFDFSGNIVMFTTDKQMGYHC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I    I    +    E  + +   + +I  AVWGPL + +I+G E+  L  + A++G++
Sbjct  121  YISFFDIRDPAQISDNEPYMKVPCSESKITSAVWGPLGEYVIAGHENGELIQYSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L ++ +   H K I  +  S+D + FIT S D
Sbjct  181  LVKAKE---HTKQINDIQTSLDLTMFITASKD  209



>ref|XP_002167671.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Hydra vulgaris]
Length=325

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 125/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+L+ GHER +T +KYNREGDLLFS AKD  PTVWF+ NGERLGTY GH GAV+C D 
Sbjct  1    MKPLLLHGHERSITQIKYNREGDLLFSSAKDKRPTVWFSINGERLGTYDGHGGAVYCLDP  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S DS  LITGS D + ++WD++TG +L  ++  S  R+  F+   K    +TD  MG   
Sbjct  61   SWDSKYLITGSGDNSARIWDIETGKELVIYDTGSAVRACGFSYSGKKVFYSTDKTMGQTC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I +  +       T    L +     ++  AVWGPL++ II+G E+  +  W A+TG L
Sbjct  121  EIKLYDVRDSISQGTPTPYLVIPVPDSKVTSAVWGPLDEFIITGHENGTVSKWCAQTGDL  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +K       H   ++ L KS +   FIT S D
Sbjct  181  IKSM---RAHIDKVSDLQKSSNEMMFITASKD  209



>ref|XP_316636.4| AGAP006607-PA [Anopheles gambiae str. PEST]
 sp|Q7PP77.4|EIF3I_ANOGA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Anopheles gambiae]
 gb|EAA10908.5| AGAP006607-PA [Anopheles gambiae str. PEST]
Length=327

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 133/215 (62%), Gaps = 6/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GH+R +T +KYNREGDL+FS AKD  P+VW++ NGERLGT+ GH GAVWC D+
Sbjct  1    MKPLMLQGHQRAITQIKYNREGDLIFSSAKDSKPSVWYSLNGERLGTFNGHIGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               ++RLITG+ D    LWDV+TGT L     +S  R+ +F+     A  +TD  M  P 
Sbjct  61   DWTTTRLITGAGDMNTFLWDVETGTALGKIPCNSSVRTCNFSFSGNQASYSTDRAMNHPC  120

Query  441  AIHVKRIAS-DPEDQTGESV--LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
             + V  + + D    + + V  LTM   Q +I   +WG L++T+I+G E+  LRIWD   
Sbjct  121  ELFVIDVRNIDASISSADPVLKLTMNEQQSKITSMLWGALDETVITGHENGSLRIWDL--  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             + +KE +  + H   IT +  S DG+ F++ S D
Sbjct  179  -RAVKELNSVNDHTASITDMQMSSDGTMFVSSSKD  212



>ref|XP_011145247.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
 ref|XP_011145248.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
Length=326

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 135/213 (63%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERAITKIKYNREGDLVFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++RL++GS D ++++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTTRLLSGSGDNSLRVWDCQTGKEIGQLDTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  441  AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  I + D      +++  +  +  RI+  +WG L++TII+G ED  + +WD  TGK
Sbjct  121  EMFIMDIRNVDSTLSQDDAISRISVNGPRISAILWGALDETIITGHEDGDITLWDVRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  181  KLSNV---KGHKSQINDMQFNKDGTMFVTASKD  210


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 64/153 (42%), Gaps = 17/153 (11%)
 Frame = +3

Query  168  KDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFT  347
            +D + T+W    G++L   +GH   +     ++D +  +T S D T KL+D  +   L T
Sbjct  167  EDGDITLWDVRTGKKLSNVKGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSDSLMLLKT  226

Query  348  FNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESV  497
            F  + P  S       D  V     D + V TT    G   +     +         E  
Sbjct  227  FKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE-------EEF  279

Query  498  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
              +KGH G IN   + P  ++  +GGED  +RI
Sbjct  280  ARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRI  312



>ref|XP_007249463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Astyanax mexicanus]
Length=325

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 131/212 (62%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER LT +KYNREGDLLFS AKD    VW++ NGERLGTY GH+GAVWC D+
Sbjct  1    MKPILLQGHERSLTQIKYNREGDLLFSVAKDQFANVWYSVNGERLGTYNGHSGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL     +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLAMLETNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  L++   + +I  AVWGPL + +++G E+  +  + A++G++
Sbjct  121  YLNYFDLRDPQQIEDNQPYLSIPCSESKITSAVWGPLGEFVVAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +K+  +   H K I  +  S+D + FIT S D
Sbjct  181  VKKIKE---HTKQINDIQTSVDLTMFITASKD  209



>ref|XP_001989068.1| GH10244 [Drosophila grimshawi]
 sp|B4JB43.1|EIF3I_DROGR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
grimshawi]
 gb|EDW03935.1| GH10244 [Drosophila grimshawi]
Length=326

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 127/213 (60%), Gaps = 3/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKYNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              +S +LITG+ D T KLWDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWESRKLITGAGDMTTKLWDVEYGTVIASIATKSSVRTSNFSFSGNQAAYSTDKAMGQNC  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  +  +D      E  L +   + +I    WGPL++TII+G ++  + IWD   G+
Sbjct  121  ELFIIDVRNADSTLSEQEPTLRIPMVESKITSMQWGPLDETIITGHDNGNIAIWDVRKGQ  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
              K  D    H  GI  +  S DG+ F+T S D
Sbjct  181  --KVVDSGVDHAAGINDMQLSKDGTMFVTASKD  211



>emb|CDR46246.1| RHTO0S12e02014g1_1 [Rhodosporidium toruloides]
Length=345

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+++ GHER LT +K+N EGDLLFSCAKD    VW + NGERLGTY GHNG VW  D+
Sbjct  1    MRPLMLSGHERSLTQIKFNAEGDLLFSCAKDSVVNVWHSHNGERLGTYDGHNGTVWTVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               S+ L++GSAD ++KLW+V+TG  L+T+ F +  + V ++  D   +  T+  MG P 
Sbjct  61   DTTSTLLVSGSADNSMKLWNVRTGECLYTWEFPTAVKRVAWSEDDSKVLAVTEKRMGYPG  120

Query  441  AIHVKRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + V  I   +P +Q+ + +  +K    +   A W  L++ I++  ED  L +WD E G 
Sbjct  121  GVSVFSINREEPSNQSKDPLFVIKPTGSKATVAAWCGLDEYIVTAHEDGTLNLWDTEEG-  179

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LL    +E  H   IT L  S DG++FIT S D
Sbjct  180  LLFFDKEEKAHHGIITDLQMSPDGTYFITSSKD  212



>emb|CCG84178.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=326

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 134/213 (63%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER +T + YN EGDLLFS +KDH   VWF+ NGERLGTY GH GA+W   +
Sbjct  1    MRPILLQGHERSITQIVYNSEGDLLFSTSKDHVINVWFSHNGERLGTYNGHVGAIWTVSV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            +++S+ L +GSAD T+KLW+++TG  L T+ F +  + V F+  D+  +  T+  MG P 
Sbjct  61   NKNSTILASGSADNTIKLWNIETGACLKTWEFPTAVKRVAFSEDDEYLLGVTEKRMGYPG  120

Query  441  AIHVKRIASD-PEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
            ++ V  IA+D   +Q  E  LT+     +   A W  LNK II+G E   +  +DA++G+
Sbjct  121  SVVVFPIANDIGAEQVSEPSLTITTTDSKATVAGWSYLNKYIITGHESGSVSQYDAKSGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L  +     H+  IT L  S+DG++FIT S D
Sbjct  181  RLINARV---HEAPITDLQMSLDGTYFITASKD  210



>ref|XP_006806095.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Neolamprologus brichardi]
Length=325

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 130/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+     +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  FLNFFDLRDPQQIEDNQPYLTVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ +   H K I  +  S+D + FI+ S D
Sbjct  181  LKKAKE---HTKQINDIQTSVDLTMFISASKD  209



>ref|XP_003443814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oreochromis niloticus]
 ref|XP_004563737.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Maylandia zebra]
 ref|XP_005745286.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pundamilia nyererei]
 ref|XP_005950654.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Haplochromis burtoni]
Length=325

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 130/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVTNVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+     +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  FLNFFDLRDPQQIEDNQPYLTVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ +   H K I  +  S+D + FI+ S D
Sbjct  181  LKKAKE---HTKQINDIQTSVDLTMFISASKD  209



>gb|ETN60290.1| eukaryotic translation initiation factor 3 subunit [Anopheles 
darlingi]
Length=327

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 130/215 (60%), Gaps = 6/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GH R +T +KYNREGDL+FS AKD +P+VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPLMLQGHSRAITQIKYNREGDLIFSSAKDSSPSVWYSLNGERLGTYNGHIGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               ++RLITG+ D    LWDV+TG  L T    SP R+ +F+     A  +TD  M   S
Sbjct  61   DWTTTRLITGAGDMKTFLWDVETGKSLGTIPCVSPVRTCNFSYSGNQASYSTDRSMQQQS  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAET  611
                I V+ I S          LTM   Q +I   +WG L++T+I+G E+  +RIWD   
Sbjct  121  ELFIIDVRNIDSSIGSADPVLKLTMGEQQSKITSMLWGALDETVITGHENGSIRIWDL--  178

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             + +KE +  + H   IT +  S DG+ FI+ S D
Sbjct  179  -RAVKELNSVNDHTANITDMQMSHDGTMFISSSKD  212



>ref|XP_005102454.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Aplysia californica]
Length=327

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 129/214 (60%), Gaps = 5/214 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PI++ GHER +T +KYNREGDL+FS AKD  P VW++ NGERLG++ GHNGAVWC D 
Sbjct  1    MKPIMLHGHERSITQIKYNREGDLIFSSAKDPQPNVWYSLNGERLGSFVGHNGAVWCIDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + DS++++TG+AD T K+WD +TG+QL +    +  R+  F+    L + +TD  MG P 
Sbjct  61   TWDSTKVLTGAADNTCKIWDCETGSQLNSLETRTAVRTNGFSYSGNLVMYSTDKTMGFPC  120

Query  441  AIHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             IH+  I    + ++G   LT+       +I  A+WGP    I++G E+  +  +D +TG
Sbjct  121  EIHMFDIRDGSQIESGNPYLTIPIDTSMSKITSAIWGPGEDFILTGHENGEINQFDIKTG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
              +K       H K I  +    D S FIT S D
Sbjct  181  TRIKGCKD---HTKQINDIQPYKDNSMFITASKD  211



>ref|NP_001156064.1| eukaryotic translation initiation factor 3 subunit 2 beta-like 
[Acyrthosiphon pisum]
 dbj|BAH70836.1| ACYPI000798 [Acyrthosiphon pisum]
Length=325

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 127/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GHER +T +KYNREGDLLFS AKD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPLMLQGHERAITQIKYNREGDLLFSSAKDVTPNVWYSLNGERLGTYNGHTGAVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +++ ++G+AD T++LWDV TG ++   + +S  R+  F+    LA  +TD  M    
Sbjct  61   DWKTTKFLSGAADNTLRLWDVATGVEIGNISSNSAVRTCSFSYSADLASYSTDQAMKQDC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I +    +D   ++   +L M     ++   +WG L+ TII+G ED  +  WD  TGK 
Sbjct  121  EIFIVDARNDESFKSSAPILRMTVPDSKVTSLIWGTLDHTIITGHEDGAITQWDLRTGKS  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ++       H+  I  + K+  G+ F+T S D
Sbjct  181  IESVKD---HQGSINDMQKNRQGTMFVTASKD  209



>ref|XP_008553489.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 130/213 (61%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP +++GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG++WC DI
Sbjct  1    MRPNMLQGHERAITAVKYNREGDLIFSASKDKKPNVWWSANGERLGTFNGHNGSIWCIDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +   ++GS D T+++WD +TG ++     +S  R+  F     +AV +TD  +G   
Sbjct  61   DWRTQFFMSGSGDNTLRIWDCQTGKEISQIQTNSSVRTCAFGFSGNMAVYSTDKALGHQC  120

Query  441  AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +    + D     G +++ +  +  RI+  +WG L++TII+G ED  + IWD  TGK
Sbjct  121  EMFIIDTRNVDSMSSEGSAIIRIPINGPRISSILWGALDETIITGHEDGEINIWDVSTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L   + + GHK  I  +  S DG+ FIT S D
Sbjct  181  KL---NSQKGHKSLINDMQPSKDGTMFITASKD  210


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/204 (24%), Positives = 86/204 (42%), Gaps = 19/204 (9%)
 Frame = +3

Query  21   LSHRIKLFG-NQKNLQSRNKKMRPILMKGHERP-LTFLKYNREGDLLFSCAKDHNPTVWF  194
            L H+ ++F  + +N+ S + +   I+      P ++ + +    + + +  +D    +W 
Sbjct  116  LGHQCEMFIIDTRNVDSMSSEGSAIIRIPINGPRISSILWGALDETIITGHEDGEINIWD  175

Query  195  ADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRS  374
               G++L + +GH   +     S+D +  IT S D T KL+D ++   L T+  + P  S
Sbjct  176  VSTGKKLNSQKGHKSLINDMQPSKDGTMFITASKDHTAKLFDSESLMHLKTYQTERPVNS  235

Query  375  VDFAV----------GDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGR  524
               +            D + V TT    G   A     +         E    +KGH G 
Sbjct  236  ATISPIFDHVILGGGQDAMDVTTTSARQGKFDARFYHLVFE-------EEFARLKGHFGP  288

Query  525  INRAVWGPLNKTIISGGEDSVLRI  596
            IN   + P  ++  SGGED  +RI
Sbjct  289  INSLAFHPDGRSFCSGGEDGFIRI  312



>ref|XP_011445956.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Crassostrea gigas]
Length=322

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 129/212 (61%), Gaps = 6/212 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL+ GHER +T +KYNREGDL+FSCAKD  P VW++ NGERLG++RGHNGAVW  D+
Sbjct  1    MKPILLHGHERSITQIKYNREGDLIFSCAKDSQPNVWYSLNGERLGSFRGHNGAVWNIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + +S++++T SAD T KLWD +TG  L + +  +  R+  F+   +  + TTD  MG P 
Sbjct  61   NWESTKVLTASADNTCKLWDCETGKTLASLDTATAVRTCGFSFSGRYIMYTTDKTMGRPC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             IH+  +    + + GE  + +     +I  AVWGP  + II+G E+  +  +D ++G  
Sbjct  121  EIHIFDLN---DIRNGEPTMVIPISSSKITSAVWGPYEEYIITGHENGEICHYDLKSGDK  177

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +    +   H K I  L  S D S  I+ S D
Sbjct  178  INSCKE---HSKQINDLQLSKDMSMLISASKD  206



>ref|XP_002051937.1| GJ17275 [Drosophila virilis]
 gb|EDW64092.1| GJ17275, partial [Drosophila virilis]
Length=325

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            RP++++GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+ 
Sbjct  1    RPLMLQGHERSITQIKYNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVD  60

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
             +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    
Sbjct  61   WESRKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQNCE  120

Query  444  IHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            + +  +  +D      E  L +   + +I   +WGPL++TII+G ++  + IWD   G+ 
Sbjct  121  LFIIDVRNADSSLSEQEPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ-  179

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             K  D  + H  GI  +  S DG+ F+T S D
Sbjct  180  -KVVDSGTDHTAGINDMQLSKDGTMFVTASRD  210



>ref|XP_011180318.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera cucurbitae]
Length=326

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 129/213 (61%), Gaps = 3/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +K+NREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKFNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +S+LI+G+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWTTSKLISGAGDMTTKIWDVEHGTVIASIPAKSSVRTCNFSYSGNQAAYSTDKAMGQNC  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  +  +D        +L +     +I   +WGPL++TII+G ++  + IWD   G 
Sbjct  121  ELFIIDVRTADSSIAEQNPILRLPMVPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
              +E +  + H  GI  +  + DG+ F+T S D
Sbjct  181  --REINSVNDHTAGINDMQMNKDGTMFVTASKD  211



>ref|XP_011198986.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera dorsalis]
Length=326

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 129/213 (61%), Gaps = 3/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +K+NREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKFNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +S+LI+G+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWTTSKLISGAGDMTTKIWDVEHGTVIASIPAKSSVRTCNFSYSGNQAAYSTDKAMGQNC  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  +  +D        +L +     +I   +WGPL++TII+G ++  + IWD   G 
Sbjct  121  ELFIIDVRTADSSIAEQNPILRIPMLPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
              +E +  + H  GI  +  + DG+ F+T S D
Sbjct  181  --REINSVNDHTAGINDMQMNKDGTMFVTASKD  211



>gb|EGI64611.1| Eukaryotic translation initiation factor 3 subunit I [Acromyrmex 
echinatior]
Length=322

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 131/209 (63%), Gaps = 4/209 (2%)
 Frame = +3

Query  93   LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  272
            ++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGT+ GHNG+VWC D++ D+
Sbjct  1    MLHGHERAITKIKYNREGDLLFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDVNWDT  60

Query  273  SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  452
            +RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G    + +
Sbjct  61   TRLLSGSGDNTLRVWDCETGKEIGQLHTNSSVRTCGFSYSANLAVFSTDKALGHQCEMFI  120

Query  453  KRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  629
              + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD  TGK L  
Sbjct  121  MDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRTGKKLSS  180

Query  630  SDQESGHKKGITSLAKSIDGSHFITGSLD  716
                 GHK  I  +  + DG+ F+T S D
Sbjct  181  V---KGHKSQINDMQCNKDGTMFVTASKD  206



>gb|KDE03916.1| eukaryotic translation initiation factor 3 subunit I [Microbotryum 
violaceum p1A1 Lamole]
Length=344

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 128/213 (60%), Gaps = 3/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+ GHER LT +KYN EGDLLFS +KDH   VW + NGERLGTY GHNG VW  D 
Sbjct  1    MRPILLSGHERSLTQVKYNAEGDLLFSASKDHIINVWHSHNGERLGTYEGHNGTVWTIDA  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               S+ LI+GSAD  +KLWDV+TGT L+T+ F +  + V ++  D   +  T+  MG   
Sbjct  61   DSTSTYLISGSADNNLKLWDVRTGTCLYTWEFPTAVKRVMWSEDDSKILAVTEQRMGFKG  120

Query  441  AIHVKRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
            A+ V  I   DP  Q  E +  ++    +   A W  L++ I++G E+  L +WD + G+
Sbjct  121  AVRVFEINRDDPTKQPVEPLFQIESTGSKATVAAWCALDQYIVTGHENGYLNLWDMD-GE  179

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L  E  ++  H   IT L  + DG++FIT S D
Sbjct  180  LFYEK-EDRAHSDLITDLQMAPDGTYFITSSKD  211



>gb|ACQ58286.1| Eukaryotic translation initiation factor 3 subunit I [Anoplopoma 
fimbria]
Length=325

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 129/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MRPILLQGHERSITQIKYNREGDLLFSVAKDTVTNVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL  F  +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCQTGKQLALFETNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  L++     +I  AVWGPL + +I+G E+     + A++G++
Sbjct  121  FLNFFDLRDPQQIEDNQPYLSIPCADHKITSAVWGPLGEFVIAGHENGEFNQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +K++ +   H K I  +  S+D + FI+ S D
Sbjct  181  IKKAKE---HTKQINDIQTSVDLTMFISASKD  209



>ref|XP_006676014.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83190.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
Length=337

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 133/216 (62%), Gaps = 9/216 (4%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GH R LT +KYN +GDLLF+ +KD    VW++ NGERLG++ GH+G++W  D+
Sbjct  1    MRPILLQGHTRSLTKVKYNSDGDLLFTASKDKAANVWYSHNGERLGSFEGHSGSIWDLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFN--FDSPGRSVDFAVGDKLAVMTTDPFMGL  434
            S DS RL+T SAD +  LW+V  G  L+ ++    +  R+V FA GDK A   TD  +G 
Sbjct  61   SFDSKRLLTASADGSCILWNVSNGKILYQWSTVHQNAIRAVAFAEGDKKAFYVTDATLGQ  120

Query  435  PSAIHVKRIASDPEDQTGESV--LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAE  608
               IH+ +I  D   QTGE    + +KG +  +  A+WG LNKTII+G +  ++ +WDAE
Sbjct  121  KCTIHIFKIHEDISKQTGEFTREIIIKGQRATV--ALWGKLNKTIITGHDKGLVSLWDAE  178

Query  609  TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            TG+L+   +    H   I  L    +  +FIT S D
Sbjct  179  TGELI---NSVQAHTGPIQDLQFGPEKEYFITASKD  211



>ref|XP_010902262.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Esox lucius]
Length=325

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFTVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLAMLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  YLNYFDLRDPQQIEDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+  +   H K I  +  S+D +  IT S D
Sbjct  181  LKKVKE---HSKQINDIQTSVDLTMVITASKD  209



>ref|XP_003707661.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Megachile rotundata]
Length=326

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 133/213 (62%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLG++ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERAITKIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++R ++GS D ++++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTTRFLSGSGDNSLRVWDCETGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  I +   + + E  ++     G RI+  +WG L++TII+G ED  + +WD  T K
Sbjct  121  EMFIIDIKNVDAELSQEDAISRIAVSGPRISAILWGALDETIITGHEDGEITLWDVRTRK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  181  KLSSV---KGHKSQINDMQFNKDGTMFVTASKD  210



>gb|KIW74742.1| eukaryotic translation initiation factor 3 subunit I [Fonsecaea 
pedrosoi CBS 271.37]
Length=336

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 126/214 (59%), Gaps = 3/214 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER L  +KYNREGDLLFS AKD     WF  NGERLGTY GH GA+W  DI
Sbjct  1    MRPILLQGHERSLNQIKYNREGDLLFSVAKDKVICAWFTSNGERLGTYNGHQGAIWTIDI  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            S ++  L +G+AD T+KLW+++TG  + T+ F +  + V F+   K  +  T+  MG   
Sbjct  61   SPNTDLLASGAADNTIKLWNIRTGENVKTWEFPTAVKRVAFSEDGKQLLAVTEKRMGYLG  120

Query  441  AIHVK--RIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             I V   R   D  DQT E  L +   + +   A WG L+K IISG ED  +  WDA+TG
Sbjct  121  TIVVYDIRYGDDLTDQTDEYSLRITCEESKATVAGWGYLDKYIISGHEDGSVSQWDAKTG  180

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +LL  S +   +   I  L  S D ++FIT   D
Sbjct  181  ELLM-SQEAHEYDTTINDLQFSPDRTYFITAGKD  213



>gb|KIO29603.1| hypothetical protein M407DRAFT_167483 [Tulasnella calospora MUT 
4182]
Length=334

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 125/213 (59%), Gaps = 3/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER LT +KYNREGDLLF+C+KDH   VW++ NGERLGTY GHNG+VW  D+
Sbjct  1    MRPILLQGHERSLTQIKYNREGDLLFTCSKDHVINVWYSHNGERLGTYEGHNGSVWSVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               S  L++G+AD T++LW V TG  L+T+ FD+  R V F+  DK  +  T+  MG   
Sbjct  61   DSKSEFLVSGAADNTMRLWQVSTGKCLYTWEFDTAVRRVAFSEDDKQVIQITEQRMGFQG  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
            AI +  I   D  +Q+ + +        ++    +     TI++G E   L +WD   G+
Sbjct  121  AIRIFNINQQDQTNQSAQPLYEFNPVGSKVTVIAFAKDPTTIVTGHESGKLSLWDVRKGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             +    +E  H   IT +  S D S+ IT S D
Sbjct  181  EIL--TKERAHNDFITDMQFSPDRSYLITSSKD  211



>gb|EMS23252.1| translation initiation factor eIF-3 subunit 2 [Rhodosporidium 
toruloides NP11]
Length=348

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 128/212 (60%), Gaps = 2/212 (1%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            RP+++ GHER LT +K+N EGDLLFSCAKD    VW + NGERLGTY GHNG VW  D+ 
Sbjct  5    RPLMLSGHERSLTQIKFNAEGDLLFSCAKDSVVNVWHSHNGERLGTYDGHNGTVWTVDVD  64

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
              S+ L++GSAD ++KLW+V+TG  L+T+ F +  + V ++  D   +  T+  MG P  
Sbjct  65   TTSTLLVSGSADNSMKLWNVRTGECLYTWEFPTAVKRVAWSEDDSKVLAVTEKRMGYPGG  124

Query  444  IHVKRIA-SDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            + V  I   +P +Q+ + +  +K    +   A W  L++ I++  ED  L +WD E G L
Sbjct  125  VSVFSINREEPSNQSKDPLFVIKPTGSKATVAAWCGLDEYIVTAHEDGTLNLWDTEEG-L  183

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +E  H   IT L  S DG++FIT S D
Sbjct  184  LFFDKEEKAHHGIITDLQMSPDGTYFITSSKD  215



>ref|XP_392780.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Apis mellifera]
 ref|XP_003693606.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Apis florea]
 ref|XP_006570172.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Apis mellifera]
 ref|XP_006612554.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Apis dorsata]
 ref|XP_006612555.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Apis dorsata]
Length=326

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 133/213 (62%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDLLFS +KD  P VW++ NGERLG++ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++R ++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTTRFLSGSGDNTLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120

Query  441  AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  I + D      +++  +  +  RI+  +WG L++TII+G ED  + +WD  T K
Sbjct  121  EMFIMDIKNVDAVLSQADAISRIAVNGPRISAILWGALDETIITGHEDGEITLWDVRTRK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  181  KLTSV---KGHKSQINDMQFNKDGTMFVTASKD  210



>ref|NP_001280295.1| uncharacterized protein LOC100162604 [Acyrthosiphon pisum]
 dbj|BAH70970.1| ACYPI003750 [Acyrthosiphon pisum]
Length=325

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GHER +T +KYNREGDLLFS AKD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPLMLQGHERAITQIKYNREGDLLFSSAKDVTPNVWYSLNGERLGTYIGHTGAVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +++ ++G+AD T++LWDV TG ++   + +S  R+  F+    LA  +TD  M    
Sbjct  61   DWKTTKFLSGAADNTLRLWDVATGAEIGNISSNSAVRTCSFSYSADLASYSTDQAMKQDC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I +     D   ++   +L M     ++   +WG L+ TII+G ED  +  WD  TGK 
Sbjct  121  EIFIVDARDDESFKSSAPILRMTVPDSKVTSLIWGTLDHTIITGHEDGAITQWDLRTGKS  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ++       H+  I  + K+  G+ F+T S D
Sbjct  181  IETVKD---HQGSINDMQKNRQGTMFVTASKD  209



>gb|ERZ95383.1| hypothetical protein GLOINDRAFT_341253 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX76099.1| Tif34p [Rhizophagus irregularis DAOM 197198w]
Length=327

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 131/213 (62%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GH R LT +KYN EGDLLFS AKD    VW++ NGERLGTY GH GA+W  D+
Sbjct  1    MRPILLQGHTRSLTQIKYNYEGDLLFSVAKDQVVNVWYSHNGERLGTYHGHVGAIWTVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            +  SS L+TGSAD + KLW+V+TG  L T+ F +  + V F+  D +A++ T+  MG P 
Sbjct  61   NSTSSILLTGSADNSAKLWEVRTGKCLHTWEFKTAVKRVAFSEDDSMALVVTENRMGYPG  120

Query  441  AIHVKRIASDPE-DQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + V  + +D + +Q+ E  + +     +   A WG LNK II+G E+  +  +D +TG+
Sbjct  121  TVTVFSVKNDIDAEQSDEPTMIINQEGSKAMVAAWGYLNKYIITGHENGEISQYDWKTGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             +K       H   I+ L  S D ++FIT S D
Sbjct  181  KIKSIHP---HTDVISDLQMSEDRTYFITSSKD  210



>ref|XP_003228758.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Anolis carolinensis]
Length=325

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 127/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61   DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            ++    +    + +  E  + +  ++ +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121  SVSFYDLRDSSQIEDNEPYMKIPCNESKITSAVWGPLGEFIIAGHENGELNQYSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L  + +   H K I  +  S D + FIT S D
Sbjct  181  LMNAKE---HTKQINDIQTSRDMTMFITASKD  209



>sp|B4NW98.2|EIF3I_DROYA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
yakuba]
Length=322

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 7/211 (3%)
 Frame = +3

Query  93   LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  272
            +++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+  +S
Sbjct  1    MLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWES  60

Query  273  SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA---  443
             +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG       
Sbjct  61   RKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFL  120

Query  444  IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  623
            I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  
Sbjct  121  IDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--  176

Query  624  KESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            K  D  + H  GI  +  S DG+ F+T S D
Sbjct  177  KVVDSGTDHSAGINDMQLSKDGTMFVTASKD  207



>sp|B3MVL6.2|EIF3I_DROAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
ananassae]
Length=322

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 127/211 (60%), Gaps = 7/211 (3%)
 Frame = +3

Query  93   LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  272
            +++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+  +S
Sbjct  1    MLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWES  60

Query  273  SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA---  443
             +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG       
Sbjct  61   RKLITGAGDMTTKIWDVEYGTIIASIPSKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFI  120

Query  444  IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  623
            I V+   S   +QT    L +   + +I   +WGPL++TII+G ++  + IWD   G+  
Sbjct  121  IDVRNADSSLAEQT--PTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--  176

Query  624  KESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            K  D  S H  GI  +  S DG+ F+T S D
Sbjct  177  KVVDSGSDHTAGINDMQLSKDGTMFVTASKD  207



>ref|NP_001187527.1| eukaryotic translation initiation factor 3 subunit I [Ictalurus 
punctatus]
 gb|ADO28765.1| eukaryotic translation initiation factor 3 subunit i [Ictalurus 
punctatus]
Length=325

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDQFVNVWYSVNGERLGTYNGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   + +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKHVLTGSADNSCRLWDCETGKQLAVLDTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +S L++   + +I  AVWGPL + +I+G E+  +  + A++G +
Sbjct  121  YLNFFDLRDPQQIEDNQSYLSVPCSESKITSAVWGPLGEFVIAGHENGEINQFSAKSGDI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +   H K I  +  S+D +  IT S D
Sbjct  181  LTTVKE---HTKQINDIQSSVDLTMVITASKD  209



>ref|XP_005102453.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Aplysia californica]
Length=334

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 128/213 (60%), Gaps = 5/213 (2%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            +PI++ GHER +T +KYNREGDL+FS AKD  P VW++ NGERLG++ GHNGAVWC D +
Sbjct  9    KPIMLHGHERSITQIKYNREGDLIFSSAKDPQPNVWYSLNGERLGSFVGHNGAVWCIDCT  68

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
             DS++++TG+AD T K+WD +TG+QL +    +  R+  F+    L + +TD  MG P  
Sbjct  69   WDSTKVLTGAADNTCKIWDCETGSQLNSLETRTAVRTNGFSYSGNLVMYSTDKTMGFPCE  128

Query  444  IHVKRIASDPEDQTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
            IH+  I    + ++G   LT+       +I  A+WGP    I++G E+  +  +D +TG 
Sbjct  129  IHMFDIRDGSQIESGNPYLTIPIDTSMSKITSAIWGPGEDFILTGHENGEINQFDIKTGT  188

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             +K       H K I  +    D S FIT S D
Sbjct  189  RIKGCKD---HTKQINDIQPYKDNSMFITASKD  218



>emb|CDR44437.1| CYFA0S14e02718g1_1 [Cyberlindnera fabianii]
Length=343

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 132/215 (61%), Gaps = 6/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+++KGHER LT +KYNREGDL+F+ +KD   ++W+++NGER+GT+ GH G +W  D+
Sbjct  1    MRPLMLKGHERSLTQVKYNREGDLIFTVSKDKEASLWYSNNGERVGTFVGHGGTIWSIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
             ++S    TGSAD T KLW V  G  LFTF+ D+P R V+F   D   +   D  MG   
Sbjct  61   DKESEFCATGSADFTAKLWRVSNGECLFTFSCDTPIRRVEFDHTDTKLLAVADEVMGYTG  120

Query  441  AIHVKRIA-SDPEDQTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAET  611
            AI+V  I   +P  Q  E VL++   +G  R+  A +   +K II+G  D V+  +DA T
Sbjct  121  AINVYAINRENPTSQNNEPVLSIPTQEGCDRVTVAGFSYCSKYIIAGHRDGVVTKYDAST  180

Query  612  GKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            G+LL ++     H+  IT L  S D ++FIT S D
Sbjct  181  GELLAKTQV---HEGLITDLQFSDDRTYFITSSKD  212


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 82/197 (42%), Gaps = 24/197 (12%)
 Frame = +3

Query  48   NQKNLQSRNKKMRPIL----MKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL  215
            N++N  S+N +  P+L     +G +R +T   ++     + +  +D   T + A  GE L
Sbjct  128  NRENPTSQNNE--PVLSIPTQEGCDR-VTVAGFSYCSKYIIAGHRDGVVTKYDASTGELL  184

Query  216  GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGD  395
               + H G +     S D +  IT S D++ K+ DV    +L  F  D+P  +       
Sbjct  185  AKTQVHEGLITDLQFSDDRTYFITSSKDKSAKILDVDNLNELKKFEADAPMNTAAITPLK  244

Query  396  KLAVM----------TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWG  545
            +  V+          TT    G   A    +I    ED+ G     +KGH G +N     
Sbjct  245  QFVVLGGGQEARDVTTTSASQGKFEARFYHKIF---EDEIGR----VKGHFGPLNYIAVH  297

Query  546  PLNKTIISGGEDSVLRI  596
            P      SGGED  +R+
Sbjct  298  PKGTAYASGGEDGYVRV  314



>gb|EKC38588.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Crassostrea gigas]
Length=322

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 128/211 (61%), Gaps = 6/211 (3%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            +PIL+ GHER +T +KYNREGDL+FSCAKD  P VW++ NGERLG++RGHNGAVW  D++
Sbjct  2    KPILLHGHERSITQIKYNREGDLIFSCAKDSQPNVWYSLNGERLGSFRGHNGAVWNIDVN  61

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
             +S++++T SAD T KLWD +TG  L + +  +  R+  F+   +  + TTD  MG P  
Sbjct  62   WESTKVLTASADNTCKLWDCETGKTLASLDTATAVRTCGFSFSGRYIMYTTDKTMGRPCE  121

Query  444  IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  623
            IH+  +    + + GE  + +     +I  AVWGP  + II+G E+  +  +D ++G  +
Sbjct  122  IHIFDLN---DIRNGEPTMVIPISSSKITSAVWGPYEEYIITGHENGEICHYDLKSGDKI  178

Query  624  KESDQESGHKKGITSLAKSIDGSHFITGSLD  716
                +   H K I  L  S D S  I+ S D
Sbjct  179  NSCKE---HSKQINDLQLSKDMSMLISASKD  206



>ref|XP_008294825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Stegastes partitus]
Length=325

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    +    +  L++     +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  YLNFFDLRDPQQIDDNQPYLSVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+  +   H K I  +  S+D + FIT S D
Sbjct  181  LKKIKE---HTKQINDIQPSVDLTIFITASKD  209



>ref|XP_007563815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Poecilia formosa]
Length=325

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 129/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +     L++   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  FLNFFDLRDPQQMEDNNPYLSVPCSECKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ +   H + I  +  S+D +  IT S D
Sbjct  181  LKKAKE---HTRQINDIQSSVDLTMVITASKD  209



>ref|XP_005812506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Xiphophorus maculatus]
Length=325

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 129/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +     L++   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  FLNFFDLRDPQQMEDNNPYLSVPCSECKITSAVWGPLGEFVIAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ +   H + I  +  S+D +  IT S D
Sbjct  181  LKKAKE---HTRQINDIQSSVDLTMVITASKD  209



>ref|XP_009047818.1| hypothetical protein LOTGIDRAFT_200332 [Lottia gigantea]
 gb|ESP01499.1| hypothetical protein LOTGIDRAFT_200332 [Lottia gigantea]
Length=325

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 134/213 (63%), Gaps = 5/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDL+FS +KD+ P VW++ NGERLG+Y GHNGAVW  D+
Sbjct  1    MKPILLQGHERSITQVKYNREGDLIFSSSKDNIPNVWYSLNGERLGSYNGHNGAVWSLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D+++++TGSAD T KLWD +TG  +++    +  R+  F+   ++  ++TD  MGLP 
Sbjct  61   NWDTTKVLTGSADNTCKLWDCETGKNIYSIETRTGVRTCSFSFSGRILAVSTDKTMGLPC  120

Query  441  AIHVKRIASDPED-QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             +     A DP+  +  +  L++     +I  A+WGP  + +I+G E   +R +D +TG+
Sbjct  121  ELQFYD-ALDPQQLRQSKPFLSIPVEGSKITTALWGPFEEYMITGHETGEMRQYDTKTGE  179

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             + E  +   H K I  L  S D +  ++ S D
Sbjct  180  QVLEIKE---HSKQINDLQGSKDLTMIVSASKD  209



>ref|NP_001133273.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI32945.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68205.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68969.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI70142.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16123.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16168.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
Length=325

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDL+FS AKD    VW++ NGERLGTY GH GA+WC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLIFSVAKDTVANVWYSVNGERLGTYNGHTGALWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLAMLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  FLNYFDLRDPQQIEDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+  +   H K I  +  S+D +  IT S D
Sbjct  181  LKKVKE---HNKQINDIQTSVDLTMVITASKD  209



>ref|XP_008079360.1| WD40 repeat-like protein [Glarea lozoyensis ATCC 20868]
 gb|EHK96151.1| putative Eukaryotic translation initiation factor 3 subunit I 
[Glarea lozoyensis 74030]
 gb|EPE34208.1| WD40 repeat-like protein [Glarea lozoyensis ATCC 20868]
Length=338

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER LT +KYNR+GD++FS AKD +   WFA NGERLGTY GH GA+W  D+
Sbjct  1    MRPILLQGHERALTQIKYNRDGDIIFSTAKDQHICAWFAHNGERLGTYHGHQGALWTVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               S+ + +G+AD TV+LWD+++G  L  + F++  + V+F       +  T+  MG   
Sbjct  61   DPTSTLIASGAADNTVRLWDIRSGKCLKVWEFNTAVKRVEFNEDGSQLLAVTEKRMGFLG  120

Query  441  AIHVKRIASDPE-DQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             I V  I  DPE +Q  E VLT++  + +   A W  +NK II+G ED  +  +DA+TG+
Sbjct  121  TIVVVNINLDPEGEQDDEKVLTIECEESKATVAGWSFMNKYIIAGHEDGTVSQYDAKTGE  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L ++ Q       IT +  S D ++FIT S D
Sbjct  181  QL-DNTQVHEMDAQITDIQWSPDRTYFITASKD  212



>gb|ACO09379.1| Eukaryotic translation initiation factor 3 subunit 2 [Osmerus 
mordax]
Length=325

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL      S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLQTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E   +  + A++G++
Sbjct  121  FLNYFDLRDPQQIEDNQPYLTVPCSESKITSAVWGPLGEYVIAGHESGEINQFSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+  +   H K I  +  S+D +  IT S D
Sbjct  181  LKKVKE---HTKQINDIQTSVDLTMVITASKD  209



>ref|NP_998155.1| eukaryotic translation initiation factor 3 subunit I [Danio rerio]
 sp|Q7ZV55.1|EIF3I_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Danio rerio]
 gb|AAH45995.1| Eukaryotic translation initiation factor 3, subunit 2 beta [Danio 
rerio]
 gb|AAH65874.1| Eif3s2 protein [Danio rerio]
Length=325

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 129/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDPIANVWYSVNGERLGTYNGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL      S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLETSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  +++   + +I  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  FLNYYDLRDPQQIEDNQPYISVPCSESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ +   H K I  +  S+D +  I+ S D
Sbjct  181  LKKAKE---HTKQINDIQSSVDLTMIISASKD  209



>ref|XP_002001737.1| GI15375 [Drosophila mojavensis]
 sp|B4KGX9.1|EIF3I_DROMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
mojavensis]
 gb|EDW11179.1| GI15375 [Drosophila mojavensis]
Length=322

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 125/209 (60%), Gaps = 3/209 (1%)
 Frame = +3

Query  93   LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  272
            +++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+  ++
Sbjct  1    MLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWET  60

Query  273  SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  452
             +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    + +
Sbjct  61   RKLITGAGDMTTKIWDVEYGTVIASIAAKSSVRTCNFSFSGNQAAYSTDKAMGQNCELFI  120

Query  453  KRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  629
              +  +D         L +   + +I   +WGPL++TII+G ++  + IWD   G+  K 
Sbjct  121  IDVRNADSSLSEQAPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KV  178

Query  630  SDQESGHKKGITSLAKSIDGSHFITGSLD  716
             D  S H  GI  +  S DG+ F+T S D
Sbjct  179  VDSGSDHTAGINDMQLSKDGTMFVTASKD  207



>ref|XP_003500685.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cricetulus griseus]
 ref|XP_007637086.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cricetulus griseus]
 gb|EGW00112.1| Eukaryotic translation initiation factor 3 subunit I [Cricetulus 
griseus]
Length=325

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFTVAKDPTVNVWYSVNGERLGTYIGHGGAVWCVDA  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL     +S  R+  F  G  + +++TD  MG   
Sbjct  61   DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMLSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
            ++    +    +  T E  + +  +  +I  AVWGPL + II+G E   L  + A++G++
Sbjct  121  SVSFFDLRDPSQIDTNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +   H + I  +  S D + F+T S D
Sbjct  181  LVSVKE---HSRQINDIQLSRDMTMFVTASKD  209



>gb|EFN80704.1| Eukaryotic translation initiation factor 3 subunit I [Harpegnathos 
saltator]
Length=324

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 135/213 (63%), Gaps = 6/213 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDL+FS +KD  P VW++ NGERLGT+ GHNG+VWC D+
Sbjct  1    MKPLMLHGHERAITKIKYNREGDLVFSASKDKQPNVWYSLNGERLGTFNGHNGSVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++RL++GS D ++++WD +TG ++   + +S  R+  F+    LAV +TD  +G   
Sbjct  61   NWDTTRLLSGSGDNSLRVWDCQTGKEIGQLDTNSSVRTCGFSYSANLAVFSTDKALGHQC  120

Query  441  AIHVKRIAS-DPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  I + D      +++  +  +  RI+  +WG L++TII+G ED  + +WD  TGK
Sbjct  121  EMFIMDIRNVDSTLSQDDAISRISVNGPRISAILWGALDETIITGHEDGDITLWD--TGK  178

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             L       GHK  I  +  + DG+ F+T S D
Sbjct  179  KLSNV---KGHKSQINDMQFNKDGTMFVTASKD  208


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 65/153 (42%), Gaps = 19/153 (12%)
 Frame = +3

Query  168  KDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFT  347
            +D + T+W  D G++L   +GH   +     ++D +  +T S D T KL+D  +   L T
Sbjct  167  EDGDITLW--DTGKKLSNVKGHKSQINDMQFNKDGTMFVTASKDHTAKLFDSDSLMLLKT  224

Query  348  FNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESV  497
            F  + P  S       D  V     D + V TT    G   +     +         E  
Sbjct  225  FKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGKFDSRFFHLVFE-------EEF  277

Query  498  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
              +KGH G IN   + P  ++  +GGED  +RI
Sbjct  278  ARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRI  310



>emb|CDP11515.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  426  MGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  605
            MGLPSAI VKRIA DP DQ+GES+L +KG QGRINRAVWGPLNKTIISGGEDSV+RIWD+
Sbjct  1    MGLPSAIQVKRIARDPADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDS  60

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ETGKLLKESD+E+GHKKGITSL+KS D +HFI+GSLD
Sbjct  61   ETGKLLKESDKEAGHKKGITSLSKSNDATHFISGSLD  97


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (45%), Gaps = 20/161 (12%)
 Frame = +3

Query  153  LFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDV  323
            + S  +D    +W ++ G+ L       GH   +     S D++  I+GS D++ KLWD+
Sbjct  46   IISGGEDSVIRIWDSETGKLLKESDKEAGHKKGITSLSKSNDATHFISGSLDKSAKLWDM  105

Query  324  KTGTQLFTFNFDSPGRSV------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDP  473
            +T T L T+  + P  +V      D  V     D  AV TTD   G   A    ++    
Sbjct  106  RTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFYDKVLQ--  163

Query  474  EDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRI  596
                 E +  +KGH G IN   + P  K+   GGED  +R+
Sbjct  164  -----EEIGGVKGHFGPINALAFNPDGKSFARGGEDGYVRL  199



>ref|XP_004531427.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Ceratitis capitata]
Length=326

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 128/213 (60%), Gaps = 3/213 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +K+NREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKFNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               +S+LI+G+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWTTSKLISGAGDMTTKIWDVEQGTVIASIPAKSSVRTCNFSYSGNQAAYSTDKAMGQNC  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  +  +D        +L +     +I   +WGPL++TII+G ++  + IWD   G 
Sbjct  121  ELFIIDVRTADSSIAEQNPILRIPMVPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
              +E +  + H  GI  +  + DG+ F+T S D
Sbjct  181  --REINSVNDHTAGINDMQMNKDGTMFVTASKD  211



>ref|XP_002115720.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV21572.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=325

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 130/214 (61%), Gaps = 7/214 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+ GHER +T ++YNREGDLLFS  KDH+P+VW++DNGERLGTY GH+G VWC  I
Sbjct  1    MRPILLHGHERAITQIRYNREGDLLFSAGKDHSPSVWYSDNGERLGTYDGHSGVVWC--I  58

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            +RDS++++TGS D +  +WD +TG QL   +  +  RS  F+   +  ++TTD   G  S
Sbjct  59   NRDSTKVVTGSGDNSYIIWDCETGKQLHRIDTRAAVRSCGFSYSGRALLITTDQQRGYES  118

Query  441  AIHVKRIASDPEDQTGESVL--TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
             I +  +    +   GE  L   +     +I  AVWG L++ +I G E+  +  +DA TG
Sbjct  119  EILLFGLDDPTQINDGEPYLRIPISKDNAKITTAVWGKLDRYLIVGHENGEVSQFDATTG  178

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            + L    +   H+K I+ +    D S F+T S D
Sbjct  179  EKLHSVTE---HRKAISDINMYKDQSMFVTASKD  209



>gb|KHN14569.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  426  MGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDA  605
            M LPSAIHVKRIA+DP +QTGESVL +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+
Sbjct  1    MELPSAIHVKRIANDPAEQTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDS  60

Query  606  ETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            ETGKLLKESD+ESGHKK +TSLAKS DGSHF+TGSLD
Sbjct  61   ETGKLLKESDKESGHKKTVTSLAKSADGSHFLTGSLD  97


 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = +3

Query  90   ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTY---RGHNGAVWCCDI  260
            +L+KG +  +    +      + S  +D    +W ++ G+ L       GH   V     
Sbjct  25   LLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKTVTSLAK  84

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSV------DFAV----GDKLAVM  410
            S D S  +TGS D++ +LWD +T T + T+  + P  +V      D  V     D  AV 
Sbjct  85   SADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVT  144

Query  411  TTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVL  590
            TTD   G   A    +I         E +  +KGH G IN   + P  K+  SGGED  +
Sbjct  145  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYV  197

Query  591  RI  596
            R+
Sbjct  198  RL  199



>ref|XP_004074467.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Oryzias latipes]
Length=325

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD     W++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANAWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +     L++  ++ +I  AVWGPL + +I+G E+  +  + A++G+ 
Sbjct  121  YLNFFDLRDPQQIEDNNPYLSVPCNESKITSAVWGPLGEFVIAGHENGEISQFSAKSGEA  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+  +   H K I  +  S+D +  IT S D
Sbjct  181  LKKVKE---HTKQINDIQSSVDLTMVITASKD  209



>gb|AGM32572.1| WD40 domain containing protein, partial [Coptotermes formosanus]
Length=290

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 126/213 (59%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P+++ GHER +T +KYNREGDLLFS AKDH P VW++ NGERLGT+ GH GAVW  D+
Sbjct  1    MKPLMLHGHERSITQIKYNREGDLLFSSAKDHTPNVWYSLNGERLGTFNGHQGAVWAIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + D++R ++G+ADQ + +WD  TG Q+      S  RS +F+    +A  +TD  +G   
Sbjct  61   NWDTTRFMSGAADQWLHIWDCATGCQIGKIENSSSVRSCNFSYSANMAAYSTDAHLGQQC  120

Query  441  AIHVKRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + +  +  +D   +    +L +     ++   +WG L+++II+G E   L  WD   GK
Sbjct  121  EMLIIDVRNADESIEKAHPILRIPITGPKVTSMLWGTLDRSIITGHESGELTQWDLRMGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +L   +  SG    I  +  S DG+ FIT S D
Sbjct  181  ILNSVNDHSG---SINDMQMSKDGTMFITASKD  210



>gb|AAI27353.1| eif3s2 protein [Xenopus (Silurana) tropicalis]
Length=330

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER +T +KYNR+GDLLF+ AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPILLQGHERSITQIKYNRDGDLLFTVAKDPVVNVWYSVNGERLGTYSGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  +++GSAD + +LWD +TG QL     +S  R+  F  G  + + +TD  MG   
Sbjct  61   DWDTRHVLSGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +    +    + +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121  FVSFIDLRDPTQIEDNEPYMKIPCSESKITSAVWGPLGENIIAGHENGELNQYSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +    +   H K I  +  S D + F+T S D
Sbjct  181  VNSIKE---HSKQINDIQTSRDMTMFVTASKD  209



>ref|NP_001015781.1| eukaryotic translation initiation factor 3 subunit I [Xenopus 
(Silurana) tropicalis]
 sp|Q5EBE8.1|EIF3I_XENTR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Xenopus (Silurana) tropicalis]
 gb|AAH89722.1| MGC108352 protein [Xenopus (Silurana) tropicalis]
 emb|CAL49363.1| eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa 
[Xenopus (Silurana) tropicalis]
 gb|AAI57540.1| MGC108352 protein [Xenopus (Silurana) tropicalis]
Length=325

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER +T +KYNR+GDLLF+ AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPILLQGHERSITQIKYNRDGDLLFTVAKDPVVNVWYSVNGERLGTYSGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  +++GSAD + +LWD +TG QL     +S  R+  F  G  + + +TD  MG   
Sbjct  61   DWDTRHVLSGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +    +    + +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121  FVSFIDLRDPTQIEDNEPYMKIPCSESKITSAVWGPLGENIIAGHENGELNQYSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +    +   H K I  +  S D + F+T S D
Sbjct  181  VNSIKE---HSKQINDIQTSRDMTMFVTASKD  209



>gb|ADO28015.1| eukaryotic translation initiation factor 3 subunit i [Ictalurus 
furcatus]
Length=325

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 127/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDQFVNVWYSVNGERLGTYNGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   + +S   +  F     + + +TD  MG   
Sbjct  61   DWDTKHVLTGSADNSCRLWDCETGKQLAVLDTNSAVGTCGFDFSGNITMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +S L++   + +I  AVWGPL + +I+G E+  +  + A++G +
Sbjct  121  YLNFFDLRDPQQIEDNQSYLSVPCSESKITSAVWGPLREFVIAGHENGEINQFSAKSGDI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +   H K I  +  S+D +  IT S D
Sbjct  181  LTTVKE---HTKQINDIQSSVDLTMVITASKD  209



>ref|XP_003387873.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Amphimedon queenslandica]
Length=320

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 128/212 (60%), Gaps = 8/212 (4%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP+++ GHER +T ++YN +GDLLFS AKDH PTVW++DNGERLGTY GHNGAVWC D+
Sbjct  1    MRPLMLHGHERAITQIRYNYDGDLLFSVAKDHKPTVWYSDNGERLGTYNGHNGAVWCIDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
            + DS+ ++TG+AD T KLWD + G  + T+N  S  RS  F+    L + +T+    +  
Sbjct  61   NLDSTLVLTGAADDTAKLWDCEKGVAIQTWNTSSAIRSCGFSHLGNLLMFSTEDRKDVDC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             I V    S+       +V  +K    R++  +WGP ++ II+G  D  +R +D    K 
Sbjct  121  EIFVYDTRSNE-----GAVSRIKVEGERVSSGLWGPFDEFIITGHADGKVRHYDYRNNKC  175

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +K   Q+  H+  +T L  S D +  IT S D
Sbjct  176  IK---QQHMHRGTVTDLQLSQDKTMIITSSKD  204



>gb|EFN69223.1| Eukaryotic translation initiation factor 3 subunit I [Camponotus 
floridanus]
Length=322

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 128/209 (61%), Gaps = 4/209 (2%)
 Frame = +3

Query  93   LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  272
            ++ GHER  T +KYNREGDLLFS +KD  P VW+A NGERLGT+ GHNG+VWC D++ D+
Sbjct  1    MLHGHERATTKIKYNREGDLLFSASKDKQPNVWYALNGERLGTFNGHNGSVWCIDVNWDT  60

Query  273  SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  452
            +RL++GS D T+++WD +TG ++   + +S  R+  F+    LAV +TD  +G    + +
Sbjct  61   TRLLSGSGDNTLRVWDCQTGKEIGQLSTNSSVRACGFSYSANLAVFSTDKALGHQCEMFI  120

Query  453  KRIASDPEDQTGESVLTMKGHQG-RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  629
              + +     + E  ++     G RI+  +WG L++TII+G ED  +++WD    K L  
Sbjct  121  MDVRNVDSTLSQEDAISRISVNGPRISAILWGALDETIITGHEDGEIKLWDVRARKKLSS  180

Query  630  SDQESGHKKGITSLAKSIDGSHFITGSLD  716
                 GHK  I  +  + DG+ F+T S D
Sbjct  181  V---KGHKSQINDMQCNKDGTMFVTASKD  206



>ref|XP_005302240.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chrysemys picta bellii]
Length=325

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 127/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSINGERLGTYTGHTGAVWCVDA  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL     +S  R+  F  G  + + +TD  MG   
Sbjct  61   DWDTRHVLTGSADNSCRLWDCETGKQLALVKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +    +    + ++ E  + +  ++ +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121  FVSFFDLRDPSQIESDEPYMKIPCNESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +   H K I  +  S D + FIT S D
Sbjct  181  LVNVKE---HTKQINDIQTSRDMTMFITASKD  209



>emb|CDQ91911.1| unnamed protein product [Oncorhynchus mykiss]
Length=332

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 127/211 (60%), Gaps = 3/211 (1%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            +PIL++GHER +T +KYNREGDL+FS AKD    VW++ NGERLGTY GH GA+WC D  
Sbjct  9    KPILLQGHERSITQIKYNREGDLIFSVAKDTVANVWYSVNGERLGTYNGHTGALWCVDCD  68

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
             D+  ++TGSAD + +LWD +TG QL   N  S  R+  F     + + +TD  MG    
Sbjct  69   WDTKNVLTGSADNSCRLWDCETGKQLAMLNTSSAVRTCGFDFSGNIIMFSTDKQMGYQCF  128

Query  444  IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  623
            ++   +    + +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++L
Sbjct  129  LNYFDLRDPQQIEDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEVL  188

Query  624  KESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            K+  +   H K I  +  S+D +  IT S D
Sbjct  189  KKVKE---HNKQINDIQTSVDLTMVITASKD  216



>ref|XP_008330275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X3 [Cynoglossus semilaevis]
Length=325

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 130/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NG RLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDPVANVWYSVNGGRLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   + +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLHTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+   + ++  AVWGPL + +I+G E+  +  + A++G++
Sbjct  121  FMNFFDLRDPQQIEDNQPYLTIPCSEHKVTSAVWGPLGEFVIAGHENGEINQFSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ + S H   I  +  S+D + FI+ S D
Sbjct  181  LKKAKEHSRH---INDIQTSVDLTMFISASKD  209



>ref|XP_003969003.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Takifugu rubripes]
Length=325

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 127/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL     +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +   ++   + +I  AVWGPL   +I+G E+  +  + A++G++
Sbjct  121  FLNFFDLRDPQQIEDNQPYQSLPCSEHKITSAVWGPLGDFVIAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK+  +   H + I  +  S+D + FIT S D
Sbjct  181  LKKVKE---HSRQINDIQTSVDLTMFITASKD  209



>ref|XP_008330274.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Cynoglossus semilaevis]
Length=341

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 130/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NG RLGTY GH GAVWC D 
Sbjct  17   MKPILLQGHERSITQIKYNREGDLLFSVAKDPVANVWYSVNGGRLGTYNGHTGAVWCVDC  76

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   + +S  R+  F     + + +TD  MG   
Sbjct  77   DWDTKNVLTGSADNSCRLWDCETGKQLALLHTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  136

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+   + ++  AVWGPL + +I+G E+  +  + A++G++
Sbjct  137  FMNFFDLRDPQQIEDNQPYLTIPCSEHKVTSAVWGPLGEFVIAGHENGEINQFSAKSGEV  196

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ + S H   I  +  S+D + FI+ S D
Sbjct  197  LKKAKEHSRH---INDIQTSVDLTMFISASKD  225



>emb|CAF99511.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=325

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 126/211 (60%), Gaps = 3/211 (1%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            +PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D  
Sbjct  2    KPILLQGHERSITQIKYNREGDLLFSVAKDTVANVWYSVNGERLGTYNGHTGAVWCVDCD  61

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
             D+  ++TGSAD + +LWD +TG QL     +S  R+  F     + + +TD  MG    
Sbjct  62   WDTKNVLTGSADNSCRLWDCETGKQLALLETNSAVRTCGFDFSGNIIMFSTDKQMGYQCY  121

Query  444  IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLL  623
            ++   +    + +  +  L++   + +I  AVWGPL   +I+G E+  +  + A++G +L
Sbjct  122  LNFFDLRDPQQIEDNQPYLSLPCSEHKITSAVWGPLGDFVIAGHENGEINQFSAKSGDIL  181

Query  624  KESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            K+  +   H + I  +  S+D + FIT S D
Sbjct  182  KKVKE---HSRQINDIQTSVDLTMFITASKD  209



>ref|XP_007170666.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Balaenoptera acutorostrata scammoni]
Length=325

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 125/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N +S  R+  F  G  + + +TD  MG   
Sbjct  61   DWDTKHVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +    +    +  + E  + +  +  +I  AVWGPL + II+G E   L  + A++G++
Sbjct  121  FVSFFDLRDPSQIDSNEPYMKIPCNDSKITSAVWGPLGECIIAGHEGGELNQYSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +   H + I  +  S D + F+T S D
Sbjct  181  LVTVKE---HSRQINDIQLSRDMTMFVTASKD  209



>gb|KFB49333.1| AGAP006607-PA-like protein [Anopheles sinensis]
Length=342

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 128/214 (60%), Gaps = 6/214 (3%)
 Frame = +3

Query  84   RPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDIS  263
            +P++++GH+R +T +KYNREGDL+FS AKD  P+VW++ NGERLGT+ GH GAVWC D+ 
Sbjct  17   KPLVLQGHQRSITQIKYNREGDLIFSSAKDSKPSVWYSLNGERLGTFNGHIGAVWCVDVD  76

Query  264  RDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSA  443
              S+RLITG+ D    LWDV+TGT L     +S  R+ +F+     A  +TD  M  P  
Sbjct  77   WTSTRLITGAGDMNTFLWDVETGTSLGKIPCNSSVRTCNFSYSGNQASYSTDRAMSHPCE  136

Query  444  ---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETG  614
               I V+ I S          LTM   Q +I   +WG L++T+I+G E+  LRIWD    
Sbjct  137  LFIIDVRSIDSSISSADPVLKLTMSEQQSKITSMLWGALDETVITGHENGSLRIWDL---  193

Query  615  KLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            + +KE +  + H   IT +  S D + F++ S D
Sbjct  194  RAVKELNSVNDHTASITDMQMSNDATMFVSSSKD  227



>ref|XP_008330273.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Cynoglossus semilaevis]
Length=360

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 130/212 (61%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NG RLGTY GH GAVWC D 
Sbjct  36   MKPILLQGHERSITQIKYNREGDLLFSVAKDPVANVWYSVNGGRLGTYNGHTGAVWCVDC  95

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   + +S  R+  F     + + +TD  MG   
Sbjct  96   DWDTKNVLTGSADNSCRLWDCETGKQLALLHTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  155

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +  +  LT+   + ++  AVWGPL + +I+G E+  +  + A++G++
Sbjct  156  FMNFFDLRDPQQIEDNQPYLTIPCSEHKVTSAVWGPLGEFVIAGHENGEINQFSAKSGEV  215

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ + S H   I  +  S+D + FI+ S D
Sbjct  216  LKKAKEHSRH---INDIQTSVDLTMFISASKD  244



>ref|XP_001903926.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP61703.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP28051.1| Putative Eukaryotic translation initiation factor 3 [Podospora 
anserina S mat+]
Length=342

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 132/215 (61%), Gaps = 6/215 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL+ GHER LT +KYNREGDLLFS AKD +   WFA NGERLGTY+GH GA+W  D+
Sbjct  1    MRPILLSGHERALTQVKYNREGDLLFSTAKDQHICAWFAHNGERLGTYQGHQGAIWTVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               S+ + +GSAD T++LW+VKTG  L T++F +  + V+F       +  T+  MG   
Sbjct  61   DPTSTIIASGSADNTIRLWEVKTGKLLKTWDFPTAVKRVEFNEDGTKLLGVTEKRMGHLG  120

Query  441  AIHVKRIASDPE-DQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             I V  I  DP+ +Q+ E VLT+   + +   A W  L+K II+G ED  +  +D +TG 
Sbjct  121  TIVVLDIKVDPDAEQSDEKVLTIVCEESKATVAGWSYLSKYIIAGHEDGSVSQYDGKTGD  180

Query  618  LLKESDQESGHKKG--ITSLAKSIDGSHFITGSLD  716
            L+   +    H+ G  IT L  + D ++FIT S D
Sbjct  181  LIYNVNV---HELGSPITDLQWNQDRTYFITASKD  212



>dbj|BAD96203.1| eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa 
variant [Homo sapiens]
Length=325

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 123/212 (58%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHERP+T +KYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERPITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL     +S  R+  F  G    + +TD  MG   
Sbjct  61   DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNTIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +    +    +    E  + +  +  +I  AVWGPL + II+G E   L  + A++G++
Sbjct  121  FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +   H + I  +  S D + F+T S D
Sbjct  181  LVNVKE---HSRQINDIQLSRDMTMFVTASKD  209



>gb|AAR10222.1| similar to Drosophila melanogaster Trip1, partial [Drosophila 
yakuba]
Length=177

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRP++++GHER +T +KYNREGDLLFSC+KD  P VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              +S +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG   
Sbjct  61   DWESRKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSC  120

Query  441  A---IHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWD  602
                I V+   S   +Q  E  L +   + +I   +WGPL++TII+G ++  + IWD
Sbjct  121  ELFLIDVRNADSSLSEQ--EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWD  175



>ref|XP_006274867.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Alligator mississippiensis]
Length=325

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 123/212 (58%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T LKYNREGDLLF+ AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQLKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYNGHTGAVWCVDA  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL      S  R+  F  G  + + +TD  MG   
Sbjct  61   DWDTRHVLTGSADNSCRLWDCETGKQLALVKTSSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +    +    + +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G+ 
Sbjct  121  FVSFFDLRDSSQIENDEPYMKIPCSESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQ  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            L    +   H K I  +  S D + FIT S D
Sbjct  181  LTNVKE---HTKQINDIQTSRDMTMFITASKD  209


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 62/144 (43%), Gaps = 17/144 (12%)
 Frame = +3

Query  195  ADNGERLGTYRGHNGAVWCCDISRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRS  374
            A +GE+L   + H   +     SRD +  IT S D T KL+D  T   L TF  + P  S
Sbjct  175  AKSGEQLTNVKEHTKQINDIQTSRDMTMFITASKDNTAKLFDSTTLDHLKTFRTERPVNS  234

Query  375  V------DFAV----GDKLAVMTTDPFMGLPSAIHVKRIASDPEDQTGESVLTMKGHQGR  524
                   D  V     + + V TT   +G       +      E++ G     +KGH G 
Sbjct  235  AALSPIFDHVVLGGGQEAMDVTTTSTRIG---KFEARFFHLGVEEEFGR----IKGHFGP  287

Query  525  INRAVWGPLNKTIISGGEDSVLRI  596
            IN   + P  K+  SGGED  +RI
Sbjct  288  INSVAFHPDGKSYSSGGEDGYVRI  311



>ref|NP_001040433.1| eukaryotic translation initiation factor 3 subunit I [Bombyx 
mori]
 sp|Q1HPW4.1|EIF3I_BOMMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Bombyx mori]
 gb|ABF51377.1| eukaryotic translation initiation factor 3 subunit 2 beta [Bombyx 
mori]
Length=329

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 126/213 (59%), Gaps = 4/213 (2%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+P++++GH+R +T +KYNREGDLLFS AKD  P VW++ NGERLGT+ GH G +WC D+
Sbjct  1    MKPLMLQGHQRAITQIKYNREGDLLFSAAKDSKPNVWWSLNGERLGTFNGHGGVIWCLDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
               S  LITG  D + +LWD++TG  + T   +S  R+ +F+     A  TTD  MG P 
Sbjct  61   DWQSINLITGGGDSSCRLWDLETGKNIATLKSNSSVRTCNFSYSAYQAAYTTDKAMGHPC  120

Query  441  AIHVKRIASDPEDQTGES-VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK  617
             + V    +  E  +G++ +L  +    ++   +WG L++TII+G E   L  WD  TGK
Sbjct  121  EVFVIDTRTIDETVSGQAPILKWEITDSKVTSMIWGSLDETIITGHEAGDLIQWDLRTGK  180

Query  618  LLKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
             +    +   H   IT +  S DG+ F+T S D
Sbjct  181  KIHSVKE---HTHQITDMQLSRDGTMFVTASKD  210



>sp|B4LUA5.2|EIF3I_DROVI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
virilis]
Length=322

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 125/209 (60%), Gaps = 3/209 (1%)
 Frame = +3

Query  93   LMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDISRDS  272
            +++GHER +T +KYNREGDLLFS +KD  P VW++ NGERLGTY GH GAVWC D+  +S
Sbjct  1    MLQGHERSITQIKYNREGDLLFSSSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWES  60

Query  273  SRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPSAIHV  452
             +LITG+ D T K+WDV+ GT + +    S  R+ +F+     A  +TD  MG    + +
Sbjct  61   RKLITGAGDMTTKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQNCELFI  120

Query  453  KRI-ASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKE  629
              +  +D      E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K 
Sbjct  121  IDVRNADSSLSEQEPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KV  178

Query  630  SDQESGHKKGITSLAKSIDGSHFITGSLD  716
             D  + H  GI  +  S DG+ F+T S D
Sbjct  179  VDSGTDHTAGINDMQLSKDGTMFVTASRD  207



>ref|NP_001087664.1| eukaryotic translation initiation factor 3 subunit I [Xenopus 
laevis]
 sp|Q66J51.1|EIF3I_XENLA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Xenopus laevis]
 gb|AAH81058.1| Eif3s2 protein [Xenopus laevis]
Length=325

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 126/212 (59%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            MRPIL++GHER +T +KYNR+GDLLF+ AKD    VW++ NGERLGTY GH GAVWC D+
Sbjct  1    MRPILLQGHERSITQIKYNRDGDLLFTVAKDPVVNVWYSVNGERLGTYNGHTGAVWCVDV  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              ++  +++GSAD + +LWD +TG QL     +S  R+  F  G  + + +TD  MG   
Sbjct  61   DWETRHVLSGSADNSCRLWDCETGKQLALLQTNSAVRTCGFDFGGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             +    +    + +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G++
Sbjct  121  FVSFIDLRDPSQIEDNEPYMKIPCSESKITSAVWGPLGENIIAGHENGELNHYSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            +    +   H K I  +  S D + F+T S D
Sbjct  181  VNSIKE---HSKQINDIQTSRDMTMFVTASKD  209



>ref|XP_008419625.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Poecilia reticulata]
Length=325

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = +3

Query  81   MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDI  260
            M+PIL++GHER +T +KYNREGDLLFS AKD    VW++ NGERLGTY GH GAVWC D 
Sbjct  1    MKPILLQGHERSITQIKYNREGDLLFSVAKDTVTNVWYSVNGERLGTYNGHTGAVWCVDC  60

Query  261  SRDSSRLITGSADQTVKLWDVKTGTQLFTFNFDSPGRSVDFAVGDKLAVMTTDPFMGLPS  440
              D+  ++TGSAD + +LWD +TG QL   N +S  R+  F     + + +TD  MG   
Sbjct  61   DWDTKNVLTGSADNSCRLWDCETGKQLALLNTNSAVRTCGFDFSGNIIMFSTDKQMGYQC  120

Query  441  AIHVKRIASDPEDQTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKL  620
             ++   +    + +     L++   + +I  AVWG L + +I+G E+  +  + A++G++
Sbjct  121  FLNFFDLRDPQQMEDNNPYLSVPCSECKITSAVWGALGEFVIAGHENGEINQFSAKSGEI  180

Query  621  LKESDQESGHKKGITSLAKSIDGSHFITGSLD  716
            LK++ +   H + I  +  S+D +  IT S D
Sbjct  181  LKKAKE---HTRQINDIQTSVDLTMVITASKD  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410