BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043I08

Length=789
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004237543.1|  PREDICTED: uncharacterized aarF domain-conta...    291   2e-88   Solanum lycopersicum
ref|XP_006340562.1|  PREDICTED: uncharacterized aarF domain-conta...    286   2e-86   Solanum tuberosum [potatoes]
ref|XP_009792370.1|  PREDICTED: uncharacterized aarF domain-conta...    282   8e-85   Nicotiana sylvestris
ref|XP_011040978.1|  PREDICTED: uncharacterized aarF domain-conta...    269   1e-84   Populus euphratica
ref|XP_011084352.1|  PREDICTED: uncharacterized aarF domain-conta...    277   3e-83   Sesamum indicum [beniseed]
ref|XP_009792369.1|  PREDICTED: uncharacterized aarF domain-conta...    277   4e-83   Nicotiana sylvestris
ref|XP_011040975.1|  PREDICTED: uncharacterized aarF domain-conta...    270   3e-82   Populus euphratica
ref|XP_011040976.1|  PREDICTED: uncharacterized aarF domain-conta...    269   3e-82   Populus euphratica
ref|XP_008236447.1|  PREDICTED: uncharacterized aarF domain-conta...    272   4e-81   Prunus mume [ume]
ref|XP_011040974.1|  PREDICTED: uncharacterized aarF domain-conta...    270   1e-80   Populus euphratica
ref|XP_007199666.1|  hypothetical protein PRUPE_ppa001434mg             270   1e-80   Prunus persica
ref|XP_011040973.1|  PREDICTED: uncharacterized aarF domain-conta...    270   2e-80   Populus euphratica
ref|XP_004142394.1|  PREDICTED: uncharacterized protein sll0005-like    263   1e-77   
ref|XP_004157521.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    263   1e-77   
gb|KGN52281.1|  hypothetical protein Csa_5G623450                       262   1e-77   Cucumis sativus [cucumbers]
ref|XP_008446897.1|  PREDICTED: uncharacterized aarF domain-conta...    261   5e-77   Cucumis melo [Oriental melon]
gb|EYU39822.1|  hypothetical protein MIMGU_mgv1a001466mg                257   6e-76   Erythranthe guttata [common monkey flower]
gb|KEH43526.1|  AarF domain kinase                                      252   2e-75   Medicago truncatula
gb|KJB73602.1|  hypothetical protein B456_011G240500                    256   3e-75   Gossypium raimondii
gb|KDP25718.1|  hypothetical protein JCGZ_23939                         254   1e-74   Jatropha curcas
ref|XP_003591940.1|  aarF domain-containing protein kinase, putative    253   4e-74   Medicago truncatula
emb|CDP04368.1|  unnamed protein product                                252   8e-74   Coffea canephora [robusta coffee]
ref|XP_010534414.1|  PREDICTED: uncharacterized aarF domain-conta...    249   4e-73   
ref|XP_006436281.1|  hypothetical protein CICLE_v10030711mg             249   1e-72   Citrus clementina [clementine]
ref|XP_002316360.2|  hypothetical protein POPTR_0010s22780g             248   3e-72   Populus trichocarpa [western balsam poplar]
ref|XP_004496288.1|  PREDICTED: uncharacterized protein sll0005-like    247   4e-72   Cicer arietinum [garbanzo]
gb|KFK36812.1|  hypothetical protein AALP_AA4G174700                    246   8e-72   Arabis alpina [alpine rockcress]
ref|NP_565901.1|  ATH subfamily protein ATH8                            236   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274556.1|  PREDICTED: uncharacterized aarF domain-conta...    246   2e-71   Vitis vinifera
ref|XP_010507623.1|  PREDICTED: uncharacterized aarF domain-conta...    241   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006293688.1|  hypothetical protein CARUB_v10022647mg             238   4e-70   
gb|KCW65390.1|  hypothetical protein EUGRSUZ_G02820                     241   6e-70   Eucalyptus grandis [rose gum]
ref|XP_010067294.1|  PREDICTED: uncharacterized aarF domain-conta...    241   6e-70   Eucalyptus grandis [rose gum]
ref|XP_010509063.1|  PREDICTED: uncharacterized aarF domain-conta...    241   6e-70   Camelina sativa [gold-of-pleasure]
gb|KCW65391.1|  hypothetical protein EUGRSUZ_G02820                     241   7e-70   Eucalyptus grandis [rose gum]
ref|XP_002879787.1|  hypothetical protein ARALYDRAFT_903159             239   4e-69   
ref|XP_006293689.1|  hypothetical protein CARUB_v10022647mg             238   6e-69   Capsella rubella
ref|XP_008381980.1|  PREDICTED: uncharacterized aarF domain-conta...    238   1e-68   
ref|NP_565900.1|  ATH subfamily protein ATH8                            238   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517256.1|  PREDICTED: uncharacterized aarF domain-conta...    237   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006411144.1|  hypothetical protein EUTSA_v10016257mg             237   3e-68   Eutrema salsugineum [saltwater cress]
ref|XP_004307396.1|  PREDICTED: uncharacterized aarF domain-conta...    236   7e-68   Fragaria vesca subsp. vesca
ref|XP_009333709.1|  PREDICTED: uncharacterized aarF domain-conta...    233   1e-66   Pyrus x bretschneideri [bai li]
emb|CDY14403.1|  BnaC03g21920D                                          231   4e-66   Brassica napus [oilseed rape]
ref|XP_010253633.1|  PREDICTED: uncharacterized aarF domain-conta...    231   5e-66   Nelumbo nucifera [Indian lotus]
ref|XP_007009802.1|  Kinase superfamily protein isoform 1               230   7e-66   
ref|XP_009133346.1|  PREDICTED: uncharacterized aarF domain-conta...    229   1e-65   Brassica rapa
gb|KHN00834.1|  Hypothetical protein glysoja_000502                     225   4e-64   Glycine soja [wild soybean]
ref|XP_010670015.1|  PREDICTED: uncharacterized aarF domain-conta...    225   5e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003556229.1|  PREDICTED: uncharacterized aarF domain-conta...    225   5e-64   Glycine max [soybeans]
ref|XP_003536357.1|  PREDICTED: uncharacterized aarF domain-conta...    220   3e-62   Glycine max [soybeans]
ref|XP_007143695.1|  hypothetical protein PHAVU_007G093900g             217   4e-61   Phaseolus vulgaris [French bean]
ref|XP_006589432.1|  PREDICTED: uncharacterized aarF domain-conta...    216   6e-61   Glycine max [soybeans]
gb|EPS60983.1|  hypothetical protein M569_13817                         211   5e-60   Genlisea aurea
emb|CAN75565.1|  hypothetical protein VITISV_032583                     212   2e-59   Vitis vinifera
ref|XP_009602168.1|  PREDICTED: uncharacterized aarF domain-conta...    194   2e-54   Nicotiana tomentosiformis
ref|XP_010099629.1|  Uncharacterized protein L484_013421                193   1e-52   
ref|XP_002533250.1|  Ubiquinone biosynthesis protein coq-8, putative    184   9e-50   
ref|XP_008807297.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    181   1e-48   
ref|XP_010906485.1|  PREDICTED: uncharacterized aarF domain-conta...    178   2e-47   
ref|XP_009392279.1|  PREDICTED: uncharacterized aarF domain-conta...    169   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854489.1|  hypothetical protein AMTR_s00175p00037000          155   3e-39   Amborella trichopoda
gb|KHN17125.1|  Hypothetical protein glysoja_011599                     150   1e-37   Glycine soja [wild soybean]
ref|XP_001774983.1|  predicted protein                                  139   1e-33   
gb|KDO48422.1|  hypothetical protein CISIN_1g0041462mg                  127   1e-32   Citrus sinensis [apfelsine]
ref|XP_010235940.1|  PREDICTED: uncharacterized aarF domain-conta...    128   2e-29   Brachypodium distachyon [annual false brome]
ref|XP_001760646.1|  predicted protein                                  127   2e-29   
ref|XP_004954281.1|  PREDICTED: uncharacterized aarF domain-conta...    122   2e-27   Setaria italica
gb|EEC74196.1|  hypothetical protein OsI_09349                          120   7e-27   Oryza sativa Indica Group [Indian rice]
dbj|BAG90272.1|  unnamed protein product                                120   8e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048444.2|  Os02g0805800                                       119   1e-26   
ref|XP_006649145.1|  PREDICTED: uncharacterized protein LOC102711509    119   3e-26   
gb|AAK98701.1|AC069158_13  Putative ABC transporter                     119   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644226.1|  PREDICTED: uncharacterized protein LOC100502...    118   5e-26   Zea mays [maize]
ref|XP_008644225.1|  PREDICTED: uncharacterized protein LOC100502...    118   6e-26   
ref|XP_002454741.1|  hypothetical protein SORBIDRAFT_04g036510          116   2e-25   
gb|EMT28124.1|  hypothetical protein F775_28121                         115   4e-25   
dbj|BAJ99480.1|  predicted protein                                      113   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH16035.1|  chorismate synthase                                   91.7    3e-19   Medicago truncatula
ref|XP_010529099.1|  PREDICTED: ethylene-responsive transcription...  89.7    9e-19   Tarenaya hassleriana [spider flower]
gb|KDO48423.1|  hypothetical protein CISIN_1g0041462mg                87.0    2e-18   Citrus sinensis [apfelsine]
ref|XP_002989934.1|  hypothetical protein SELMODRAFT_130784           91.3    4e-17   
gb|KDO48429.1|  hypothetical protein CISIN_1g0041461mg                73.2    2e-11   Citrus sinensis [apfelsine]
gb|KDO48427.1|  hypothetical protein CISIN_1g0041461mg                73.6    2e-11   Citrus sinensis [apfelsine]
ref|XP_010534416.1|  PREDICTED: uncharacterized aarF domain-conta...  68.9    6e-10   Tarenaya hassleriana [spider flower]
ref|WP_008180667.1|  hypothetical protein                             64.7    2e-08   Moorea producens
ref|XP_002295715.1|  hypothetical protein THAPS_28865                 63.5    4e-08   Thalassiosira pseudonana CCMP1335
ref|WP_017294374.1|  hypothetical protein                             62.0    1e-07   Geminocystis herdmanii
ref|WP_017309517.1|  hypothetical protein                             60.8    3e-07   Fischerella sp. PCC 9339
ref|WP_044451834.1|  hypothetical protein                             60.8    3e-07   Mastigocladus laminosus
ref|XP_002185748.1|  predicted protein                                60.8    4e-07   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_035151232.1|  hypothetical protein                             60.5    4e-07   Calothrix sp. 336/3
ref|WP_026722518.1|  hypothetical protein                             60.5    4e-07   Fischerella sp. PCC 9431
ref|WP_039715079.1|  hypothetical protein                             60.5    5e-07   
ref|WP_036028277.1|  hypothetical protein                             60.1    5e-07   Leptolyngbya sp. PCC 6406
ref|WP_015152556.1|  ABC-1 domain-containing protein                  60.1    5e-07   Cyanobacteria [blue-green bacteria]
ref|WP_009459174.1|  MULTISPECIES: hypothetical protein               60.1    6e-07   Fischerella thermalis
ref|WP_038018285.1|  hypothetical protein                             59.7    7e-07   
ref|WP_006510757.1|  putative unusual protein kinase                  59.7    7e-07   Xenococcus sp. PCC 7305
ref|WP_016868505.1|  hypothetical protein                             59.7    7e-07   Fischerella muscicola
gb|EDX84398.1|  ABC1 family protein                                   59.7    8e-07   Synechococcus sp. PCC 7335
ref|WP_011612081.1|  hypothetical protein                             59.3    1e-06   Trichodesmium erythraeum
ref|XP_009036188.1|  hypothetical protein AURANDRAFT_25238            59.3    1e-06   Aureococcus anophagefferens
ref|WP_015141931.1|  putative unusual protein kinase                  59.3    1e-06   Pleurocapsa minor
ref|XP_002502141.1|  predicted protein                                58.9    1e-06   Micromonas commoda
ref|WP_015190101.1|  ABC-1 domain-containing protein                  58.9    1e-06   Gloeocapsa sp. PCC 7428
ref|XP_009799241.1|  PREDICTED: uncharacterized aarF domain-conta...  58.5    2e-06   Nicotiana sylvestris
ref|XP_005836206.1|  hypothetical protein GUITHDRAFT_175426           58.5    2e-06   Guillardia theta CCMP2712
ref|WP_011057497.1|  hypothetical protein                             58.5    2e-06   Thermosynechococcus elongatus
ref|WP_044500806.1|  hypothetical protein                             58.2    2e-06   Nostoc sp. PCC 7107
ref|XP_003516816.1|  PREDICTED: uncharacterized aarF domain-conta...  58.2    3e-06   Glycine max [soybeans]
ref|WP_026101159.1|  hypothetical protein                             58.2    3e-06   
gb|KHN25542.1|  Putative aarF domain-containing protein kinase, c...  58.2    3e-06   Glycine soja [wild soybean]
ref|WP_017720052.1|  hypothetical protein                             58.2    3e-06   Oscillatoria sp. PCC 10802
ref|WP_015160804.1|  putative unusual protein kinase                  57.8    3e-06   Chamaesiphon minutus
gb|AFY43513.1|  ABC-1 domain-containing protein                       58.2    3e-06   Nostoc sp. PCC 7107
ref|XP_005848798.1|  hypothetical protein CHLNCDRAFT_34951            57.8    3e-06   Chlorella variabilis
ref|XP_005818965.1|  protein kinase, ABC-1                            57.8    3e-06   Guillardia theta CCMP2712
ref|WP_016861827.1|  hypothetical protein                             57.8    3e-06   Fischerella muscicola
ref|WP_017321507.1|  hypothetical protein                             57.8    4e-06   cyanobacterium PCC 7702
ref|XP_009610213.1|  PREDICTED: uncharacterized aarF domain-conta...  57.8    4e-06   Nicotiana tomentosiformis
ref|WP_015223480.1|  ABC-1 domain-containing protein                  57.4    5e-06   
ref|WP_015129918.1|  ABC-1 domain-containing protein                  57.0    5e-06   Calothrix sp. PCC 7507
ref|WP_007357558.1|  MULTISPECIES: hypothetical protein               57.0    5e-06   Kamptonema
ref|WP_015955262.1|  hypothetical protein                             57.0    6e-06   Cyanothece sp. PCC 7424
ref|WP_008200603.1|  hypothetical protein                             57.0    6e-06   Microcystis sp. T1-4
ref|WP_015202446.1|  ABC-1 domain-containing protein                  57.0    6e-06   Crinalium epipsammum
ref|WP_009631926.1|  putative unusual protein kinase                  57.0    7e-06   Synechocystis sp. PCC 7509
ref|WP_026796430.1|  hypothetical protein                             57.0    7e-06   Planktothrix
ref|XP_005707514.1|  aarF domain-containing kinase                    57.0    7e-06   Galdieria sulphuraria
ref|WP_044208672.1|  hypothetical protein                             57.0    7e-06   
ref|WP_012596357.1|  hypothetical protein                             56.6    7e-06   Cyanothece sp. PCC 8801
gb|EDX73847.1|  ABC1 family protein                                   56.6    7e-06   Coleofasciculus chthonoplastes PCC 7420
ref|WP_015138529.1|  putative unusual protein kinase                  56.6    8e-06   Nostoc sp. PCC 7524
ref|WP_013191748.1|  hypothetical protein                             56.6    8e-06   Trichormus azollae
ref|WP_015784467.1|  hypothetical protein                             56.6    8e-06   Cyanothece sp. PCC 8802
ref|WP_012409344.1|  hypothetical protein                             56.6    8e-06   Nostoc punctiforme
ref|WP_044195036.1|  hypothetical protein                             56.6    9e-06   
gb|AFY82052.1|  putative unusual protein kinase                       56.6    9e-06   Oscillatoria acuminata PCC 6304
ref|WP_038331356.1|  hypothetical protein                             56.6    9e-06   filamentous cyanobacterium ESFC-1
emb|CBN77649.1|  conserved unknown protein                            56.6    9e-06   Ectocarpus siliculosus
ref|WP_015215459.1|  ABC-1 domain-containing protein                  56.6    9e-06   Anabaena cylindrica
gb|AFY62190.1|  putative unusual protein kinase                       56.2    1e-05   Synechococcus sp. PCC 6312
ref|WP_042154100.1|  hypothetical protein                             56.2    1e-05   Planktothrix agardhii
ref|WP_015177243.1|  ABC-1 domain-containing protein                  56.2    1e-05   Oscillatoria nigro-viridis
ref|WP_029793013.1|  2-octaprenylphenol hydroxylase                   53.5    1e-05   
ref|WP_028089854.1|  hypothetical protein                             56.2    1e-05   Dolichospermum circinale
ref|WP_041429582.1|  hypothetical protein                             56.2    1e-05   
ref|WP_041934048.1|  hypothetical protein                             56.2    1e-05   Cyanothece sp. PCC 7822
gb|AHB88308.1|  ABC1 family kinase-like protein                       56.2    1e-05   Thermosynechococcus sp. NK55a
ref|WP_028083060.1|  hypothetical protein                             56.2    1e-05   Dolichospermum circinale
ref|WP_015955656.1|  hypothetical protein                             56.2    1e-05   Cyanothece sp. PCC 7424
gb|ADN17360.1|  ABC-1 domain protein                                  55.8    1e-05   Cyanothece sp. PCC 7822
ref|WP_041431644.1|  hypothetical protein                             55.8    1e-05   
ref|WP_002797231.1|  hypothetical protein                             55.8    1e-05   Microcystis aeruginosa
ref|WP_002780928.1|  hypothetical protein                             55.8    1e-05   Microcystis aeruginosa
ref|WP_006634777.1|  hypothetical protein                             55.8    2e-05   Microcoleus vaginatus
ref|WP_015166729.1|  ABC-1 domain-containing protein                  55.8    2e-05   
emb|CEF97545.1|  Aminoglycoside phosphotransferase                    55.8    2e-05   Ostreococcus tauri
ref|WP_017654602.1|  hypothetical protein                             55.8    2e-05   Fortiea contorta
dbj|GAL94053.1|  ubiquinone biosynthesis monooxygenase UbiB           55.8    2e-05   Microcystis aeruginosa NIES-44
gb|AIU50296.1|  ABC1-like kinase                                      55.8    2e-05   Acorus calamus [flagroot]
ref|WP_036481104.1|  hypothetical protein                             55.8    2e-05   Myxosarcina sp. GI1
ref|WP_009785293.1|  hypothetical protein                             55.5    2e-05   Lyngbya sp. PCC 8106
ref|WP_015228271.1|  protein kinase                                   55.8    2e-05   Dactylococcopsis salina
ref|WP_002788784.1|  hypothetical protein                             55.8    2e-05   Microcystis aeruginosa
ref|WP_015189201.1|  ABC-1 domain-containing protein                  55.5    2e-05   Gloeocapsa sp. PCC 7428
gb|EPS72803.1|  hypothetical protein M569_01954                       55.5    2e-05   Genlisea aurea
ref|WP_015219663.1|  ABC-1 domain-containing protein                  55.5    2e-05   Cyanobacterium aponinum
ref|WP_026785272.1|  MULTISPECIES: hypothetical protein               55.5    2e-05   Planktothrix
ref|WP_007305524.1|  hypothetical protein                             55.5    2e-05   Crocosphaera watsonii
ref|WP_021830591.1|  Ubiquinone biosynthesis monooxygenase UbiB       55.5    2e-05   Crocosphaera watsonii
emb|CCQ61264.1|  Ubiquinone biosynthesis monooxygenase UbiB           55.5    2e-05   Crocosphaera watsonii WH 0401
ref|WP_002803392.1|  hypothetical protein                             55.5    2e-05   Microcystis aeruginosa
ref|WP_023064752.1|  ABC1 family protein                              55.1    2e-05   Lyngbya aestuarii
ref|WP_010994768.1|  hypothetical protein                             55.1    3e-05   Nostocaceae
ref|WP_002776339.1|  hypothetical protein                             55.1    3e-05   Microcystis aeruginosa
gb|KIJ82026.1|  hypothetical protein SD80_22760                       55.1    3e-05   Scytonema tolypothrichoides VB-61278
ref|WP_024969577.1|  hypothetical protein                             55.1    3e-05   Microcystis aeruginosa
ref|WP_026102916.1|  hypothetical protein                             55.1    3e-05   Pleurocapsa sp. PCC 7319
ref|WP_002790785.1|  hypothetical protein                             55.1    3e-05   Microcystis aeruginosa
ref|WP_002750390.1|  hypothetical protein                             55.1    3e-05   Microcystis aeruginosa
ref|WP_016514450.1|  Aminoglycoside acetyltransferase regulator       55.1    3e-05   Microcystis aeruginosa
ref|WP_036400978.1|  hypothetical protein                             55.1    3e-05   Microcystis aeruginosa
ref|WP_026734382.1|  hypothetical protein                             55.1    3e-05   Fischerella sp. PCC 9605
gb|ELS47755.1|  putative aarF domain-containing protein               55.1    3e-05   Microcystis aeruginosa DIANCHI905
gb|ELP53295.1|  hypothetical protein O53_2099                         55.1    3e-05   Microcystis aeruginosa TAIHU98
ref|WP_002760159.1|  hypothetical protein                             55.1    3e-05   Microcystis aeruginosa
ref|WP_023072928.1|  abc-1 domain-containing protein                  55.1    3e-05   Leptolyngbya sp. Heron Island J
ref|WP_017969651.1|  hypothetical protein                             54.7    3e-05   
ref|XP_004238478.1|  PREDICTED: uncharacterized aarF domain-conta...  55.1    3e-05   
ref|WP_012953844.1|  hypothetical protein                             54.7    3e-05   Candidatus Atelocyanobacterium thalassa
ref|XP_006342209.1|  PREDICTED: uncharacterized aarF domain-conta...  55.1    3e-05   Solanum tuberosum [potatoes]
gb|AIU50339.1|  ABC1-like kinase                                      54.7    3e-05   Trachycarpus fortunei
ref|WP_029634227.1|  hypothetical protein [                           54.7    4e-05   [Scytonema hofmanni] UTEX B 1581
ref|WP_007260247.1|  ABC transporter                                  54.7    4e-05   Natronolimnobius innermongolicus
gb|AIU50327.1|  ABC1-like kinase                                      54.7    4e-05   Solanum lycopersicum
gb|AIU50318.1|  ABC1-like kinase                                      54.7    4e-05   Solanum tuberosum [potatoes]
gb|ABD02043.1|  ABC1 domain protein                                   54.7    4e-05   Synechococcus sp. JA-2-3B'a(2-13)
ref|XP_005535949.1|  unknown kinase with aarF domain                  54.7    4e-05   Cyanidioschyzon merolae strain 10D
ref|WP_011144395.1|  hypothetical protein                             54.7    4e-05   Gloeobacter violaceus
gb|AIU50335.1|  ABC1-like kinase                                      54.7    4e-05   Ginkgo biloba [ginkgo]
ref|WP_015171439.1|  ABC-1 domain-containing protein                  54.7    4e-05   Geitlerinema sp. PCC 7407
ref|WP_017715729.1|  hypothetical protein                             54.3    5e-05   Oscillatoria sp. PCC 10802
ref|WP_035798350.1|  hypothetical protein                             54.3    5e-05   Cyanothece sp. CCY0110
ref|WP_036007296.1|  hypothetical protein                             54.3    5e-05   
ref|WP_041437189.1|  hypothetical protein                             54.3    5e-05   
gb|EAZ93001.1|  ABC1-like protein                                     54.3    5e-05   Cyanothece sp. CCY0110
ref|WP_040054215.1|  hypothetical protein                             54.3    5e-05   
ref|WP_041619779.1|  hypothetical protein                             54.3    5e-05   
gb|AHJ26841.1|  Ubiquinone biosynthesis monooxygenase UbiB            54.3    5e-05   Nodularia spumigena CCY9414
ref|WP_016873798.1|  hypothetical protein                             54.3    5e-05   Chlorogloeopsis fritschii
ref|WP_017803762.1|  hypothetical protein                             54.3    5e-05   Nodularia spumigena
ref|WP_008232439.1|  Ubiquinone biosynthesis monooxygenase UbiB       54.3    5e-05   Richelia intracellularis
ref|WP_041032877.1|  hypothetical protein                             54.3    5e-05   Tolypothrix campylonemoides
ref|WP_041269011.1|  hypothetical protein                             54.3    6e-05   
ref|WP_009768695.1|  putative unusual protein kinase                  54.3    6e-05   Oscillatoriales cyanobacterium JSC-12
gb|AFZ34679.1|  ABC-1 domain-containing protein                       54.3    6e-05   Stanieria cyanosphaera PCC 7437
gb|AFY66942.1|  ABC-1 domain-containing protein                       53.9    6e-05   Geitlerinema sp. PCC 7407
ref|WP_002770082.1|  hypothetical protein                             53.9    6e-05   Microcystis aeruginosa
ref|WP_042203081.1|  hypothetical protein                             53.9    6e-05   Nodularia spumigena
ref|WP_006089855.1|  ABC transporter                                  53.9    6e-05   Natronorubrum tibetense
ref|XP_010921140.1|  PREDICTED: uncharacterized aarF domain-conta...  53.9    6e-05   Elaeis guineensis
gb|EAW42854.1|  ABC-1                                                 53.9    6e-05   Nodularia spumigena CCY9414
ref|XP_006854268.1|  hypothetical protein AMTR_s00039p00053980        53.9    6e-05   
ref|XP_009414258.1|  PREDICTED: uncharacterized aarF domain-conta...  53.9    6e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBJ31164.1|  ABC1-like                                            54.3    6e-05   Ectocarpus siliculosus
ref|WP_041456584.1|  hypothetical protein                             53.9    7e-05   Trichormus variabilis
gb|EYU31735.1|  hypothetical protein MIMGU_mgv1a001580mg              53.9    7e-05   Erythranthe guttata [common monkey flower]
ref|WP_040054212.1|  hypothetical protein                             53.9    7e-05   
gb|ABA19944.1|  ABC-1                                                 53.9    7e-05   Trichormus variabilis ATCC 29413
ref|WP_024546110.1|  hypothetical protein                             53.9    7e-05   Synechococcus sp. NKBG15041c
ref|WP_011933445.1|  hypothetical protein                             53.9    7e-05   Synechococcus sp. WH 7803
ref|WP_017971415.1|  hypothetical protein                             53.5    8e-05   
ref|XP_001418122.1|  predicted protein                                53.9    8e-05   Ostreococcus lucimarinus CCE9901
gb|AIU50325.1|  ABC1-like kinase                                      53.5    8e-05   Yucca filamentosa [Adam's-needle]
ref|WP_017943311.1|  hypothetical protein                             53.5    9e-05   
ref|WP_012161966.1|  hypothetical protein                             53.5    9e-05   Acaryochloris marina
ref|XP_003516441.1|  PREDICTED: uncharacterized aarF domain-conta...  53.5    9e-05   Glycine max [soybeans]
ref|XP_010241145.1|  PREDICTED: uncharacterized aarF domain-conta...  53.5    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_007508517.1|  predicted protein                                53.5    1e-04   Bathycoccus prasinos
ref|WP_015225890.1|  ABC-1 domain-containing protein                  53.5    1e-04   Halothece sp. PCC 7418
gb|KFK39723.1|  hypothetical protein AALP_AA3G280000                  53.5    1e-04   Arabis alpina [alpine rockcress]
dbj|BAD80505.1|  hypothetical protein                                 53.5    1e-04   Synechococcus elongatus PCC 6301
gb|KFK39722.1|  hypothetical protein AALP_AA3G280000                  53.5    1e-04   Arabis alpina [alpine rockcress]
ref|WP_012267363.1|  hypothetical protein                             53.5    1e-04   Microcystis aeruginosa
ref|XP_002518128.1|  Protein ABC1, mitochondrial precursor, putative  53.5    1e-04   Ricinus communis
ref|WP_011378187.1|  MULTISPECIES: hypothetical protein               53.1    1e-04   Synechococcus
ref|WP_040932777.1|  hypothetical protein                             53.1    1e-04   
ref|WP_019497415.1|  hypothetical protein                             53.1    1e-04   Calothrix sp. PCC 7103
ref|WP_040937941.1|  hypothetical protein                             53.1    1e-04   
ref|XP_009419816.1|  PREDICTED: uncharacterized aarF domain-conta...  53.1    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007513647.1|  predicted protein                                53.1    1e-04   Bathycoccus prasinos
ref|WP_015167115.1|  putative unusual protein kinase                  53.1    1e-04   
ref|XP_002499603.1|  hypothetical protein MICPUN_78920                53.1    1e-04   Micromonas commoda
gb|AIU50292.1|  ABC1-like kinase                                      53.1    1e-04   Musa acuminata [banana]
ref|WP_017315962.1|  hypothetical protein                             53.1    1e-04   Mastigocladopsis repens
emb|CDP07231.1|  unnamed protein product                              53.1    1e-04   Coffea canephora [robusta coffee]
ref|WP_027844133.1|  hypothetical protein                             53.1    1e-04   Mastigocoleus testarum
ref|WP_026731629.1|  hypothetical protein                             53.1    1e-04   Fischerella sp. PCC 9605
ref|XP_002885611.1|  ABC1 family protein                              53.1    1e-04   
ref|NP_566745.1|  ABC1 protein kinase 6                               53.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140799.1|  hypothetical protein PHAVU_008G143200g           53.1    1e-04   Phaseolus vulgaris [French bean]
ref|WP_038013572.1|  hypothetical protein                             52.8    1e-04   Synechococcus sp. WH 8016
ref|WP_038544363.1|  hypothetical protein                             52.8    1e-04   Synechococcus sp. KORDI-100
gb|EHA63132.1|  ABC-1 domain-containing protein                       52.8    1e-04   Synechococcus sp. WH 8016
ref|WP_041425918.1|  hypothetical protein                             52.8    2e-04   
gb|AIU50314.1|  ABC1-like kinase                                      52.8    2e-04   Canna indica [canna]
ref|WP_009555584.1|  putative unusual protein kinase                  52.8    2e-04   Oscillatoriales cyanobacterium JSC-12
ref|WP_010871776.1|  hypothetical protein                             52.8    2e-04   Synechocystis
gb|EAU74108.1|  possible kinase                                       52.8    2e-04   Synechococcus sp. RS9916
ref|XP_007134807.1|  hypothetical protein PHAVU_010G077900g           52.8    2e-04   Phaseolus vulgaris [French bean]
ref|XP_003079605.1|  Predicted unusual protein kinase (ISS)           52.8    2e-04   Ostreococcus tauri
ref|WP_038024208.1|  hypothetical protein                             52.4    2e-04   Synechococcus sp. RS9916
ref|WP_017287956.1|  hypothetical protein                             52.8    2e-04   Leptolyngbya boryana
ref|WP_015142325.1|  putative unusual protein kinase                  52.8    2e-04   Pleurocapsa minor
ref|WP_017302870.1|  hypothetical protein                             52.4    2e-04   
ref|XP_003555709.1|  PREDICTED: uncharacterized aarF domain-conta...  52.4    2e-04   Glycine max [soybeans]
ref|WP_008231578.1|  Ubiquinone biosynthesis monooxygenase UbiB       52.4    2e-04   Richelia intracellularis
ref|XP_010466773.1|  PREDICTED: uncharacterized aarF domain-conta...  52.4    2e-04   
ref|WP_038004385.1|  hypothetical protein                             52.4    2e-04   
ref|WP_037221370.1|  hypothetical protein                             52.4    2e-04   
ref|WP_010476340.1|  hypothetical protein                             52.4    2e-04   
gb|EAR18019.1|  possible kinase                                       52.4    2e-04   
ref|XP_002263052.1|  PREDICTED: uncharacterized aarF domain-conta...  52.4    2e-04   
ref|WP_011820480.1|  hypothetical protein                             52.4    2e-04   
ref|WP_043691501.1|  hypothetical protein                             52.4    2e-04   
ref|WP_023649153.1|  ubiquinone biosynthesis protein                  52.0    2e-04   
gb|KHN18016.1|  Hypothetical protein glysoja_041650                   52.4    2e-04   
ref|XP_010513104.1|  PREDICTED: uncharacterized aarF domain-conta...  52.4    2e-04   
gb|AIU50293.1|  ABC1-like kinase                                      52.0    3e-04   
ref|WP_012307454.1|  MULTISPECIES: hypothetical protein               52.0    3e-04   
ref|WP_015132937.1|  ABC-1 domain-containing protein                  52.0    3e-04   
ref|XP_011034732.1|  PREDICTED: uncharacterized aarF domain-conta...  52.0    3e-04   
gb|EJK66355.1|  hypothetical protein THAOC_12731                      52.4    3e-04   
ref|WP_006195012.1|  hypothetical protein                             52.0    3e-04   
ref|XP_006418814.1|  hypothetical protein EUTSA_v10002400mg           52.4    3e-04   
ref|WP_015194262.1|  ABC-1 domain-containing protein                  52.0    3e-04   
ref|XP_010061371.1|  PREDICTED: uncharacterized aarF domain-conta...  52.0    3e-04   
ref|WP_021041261.1|  putative unusual protein kinase                  52.0    3e-04   
ref|WP_006516340.1|  putative unusual protein kinase                  52.0    3e-04   
ref|WP_041233376.1|  hypothetical protein                             52.0    3e-04   
ref|XP_008457257.1|  PREDICTED: uncharacterized aarF domain-conta...  52.0    3e-04   
gb|AIU50311.1|  ABC1-like kinase                                      52.0    3e-04   
dbj|BAJ86128.1|  predicted protein                                    50.4    3e-04   
ref|WP_041426944.1|  hypothetical protein                             52.0    3e-04   
gb|AFZ22786.1|  putative unusual protein kinase                       52.0    3e-04   
ref|WP_041236922.1|  hypothetical protein                             52.0    3e-04   
ref|WP_005559396.1|  ABC transporter                                  52.0    3e-04   
gb|AIU50330.1|  ABC1-like kinase                                      52.0    3e-04   
ref|WP_015121605.1|  putative unusual protein kinase                  52.0    3e-04   
gb|AIU50303.1|  ABC1-like kinase                                      52.0    3e-04   
gb|ACL44711.1|  ABC-1 domain protein                                  51.6    3e-04   
ref|WP_026072972.1|  hypothetical protein                             51.6    3e-04   
gb|KDP20323.1|  hypothetical protein JCGZ_06409                       52.0    3e-04   
gb|ABI47267.1|  ABC1 domain protein                                   51.6    3e-04   
emb|CEF98671.1|  Aminoglycoside phosphotransferase                    52.0    3e-04   
ref|WP_029980407.1|  hypothetical protein                             48.9    3e-04   
emb|CBI34152.3|  unnamed protein product                              51.6    4e-04   
ref|WP_036906582.1|  hypothetical protein                             51.6    4e-04   
ref|WP_023394566.1|  protein kinase                                   51.6    4e-04   
ref|WP_017659336.1|  hypothetical protein                             51.6    4e-04   
gb|AIU50307.1|  ABC1-like kinase                                      51.6    4e-04   
ref|XP_008782652.1|  PREDICTED: uncharacterized aarF domain-conta...  51.6    4e-04   
ref|XP_003080369.1|  Predicted unusual protein kinase (ISS)           51.6    4e-04   
emb|CDY45347.1|  BnaC01g30510D                                        51.6    4e-04   
emb|CDO99419.1|  unnamed protein product                              51.6    4e-04   
ref|XP_007034432.1|  Kinase superfamily protein                       51.6    4e-04   
ref|WP_041038887.1|  hypothetical protein                             51.6    4e-04   
emb|CEF98748.1|  Protein kinase-like domain                           51.6    4e-04   
ref|XP_007145406.1|  hypothetical protein PHAVU_007G236200g           51.6    4e-04   
gb|KJB37797.1|  hypothetical protein B456_006G220400                  51.6    4e-04   
ref|WP_023076538.1|  abc-1 domain-containing protein                  51.6    4e-04   
ref|XP_003080278.1|  ABC1-like (ISS)                                  51.6    4e-04   
ref|XP_010488485.1|  PREDICTED: uncharacterized aarF domain-conta...  51.6    4e-04   
gb|KHG06807.1|  Uncharacterized protein F383_08209                    51.6    4e-04   
emb|CDX77465.1|  BnaA07g06030D                                        51.6    4e-04   
ref|WP_039752381.1|  hypothetical protein                             51.6    4e-04   
gb|KJB37795.1|  hypothetical protein B456_006G220400                  51.6    4e-04   
ref|XP_009106233.1|  PREDICTED: uncharacterized aarF domain-conta...  51.6    4e-04   
ref|XP_009102553.1|  PREDICTED: uncharacterized aarF domain-conta...  51.6    4e-04   
ref|WP_008162383.1|  ABC-1 domain-containing protein                  51.2    4e-04   
ref|XP_007011449.1|  Kinase superfamily protein isoform 1             51.6    5e-04   
gb|AIU50328.1|  ABC1-like kinase                                      51.2    5e-04   
ref|WP_023066347.1|  hypothetical protein                             51.2    5e-04   
ref|XP_001773944.1|  predicted protein                                51.2    5e-04   
gb|KJB37796.1|  hypothetical protein B456_006G220400                  51.6    5e-04   
ref|WP_026104425.1|  hypothetical protein                             51.2    5e-04   
ref|XP_002440874.1|  hypothetical protein SORBIDRAFT_09g011240        51.2    5e-04   
gb|KJB73078.1|  hypothetical protein B456_011G213700                  51.2    5e-04   
ref|WP_006883952.1|  ABC transporter                                  51.2    5e-04   
ref|XP_011091406.1|  PREDICTED: uncharacterized aarF domain-conta...  51.2    5e-04   
ref|WP_015224805.1|  ABC-1 domain-containing protein                  51.2    5e-04   
gb|KEF41127.1|  hypothetical protein ER33_13235                       51.2    5e-04   
ref|WP_024125871.1|  ABC1 family kinase-like protein                  51.2    5e-04   
ref|XP_010093894.1|  hypothetical protein L484_019931                 50.8    5e-04   
ref|WP_007737908.1|  ABC-1 domain-containing protein                  51.2    5e-04   
gb|ELR96330.1|  putative unusual protein kinase                       51.2    5e-04   
ref|WP_034937996.1|  hypothetical protein                             51.2    5e-04   
ref|XP_006297015.1|  hypothetical protein CARUB_v10013006mg           51.2    6e-04   
ref|XP_010936094.1|  PREDICTED: uncharacterized aarF domain-conta...  51.2    6e-04   
emb|CBI40831.3|  unnamed protein product                              51.2    6e-04   
gb|AIU50295.1|  ABC1-like kinase                                      51.2    6e-04   
gb|KJB73079.1|  hypothetical protein B456_011G213700                  51.2    6e-04   
ref|XP_005775524.1|  hypothetical protein EMIHUDRAFT_447814           50.8    6e-04   
ref|XP_005781936.1|  hypothetical protein EMIHUDRAFT_113732           50.8    6e-04   
ref|WP_041431041.1|  hypothetical protein                             50.8    6e-04   
ref|WP_009545414.1|  MULTISPECIES: hypothetical protein               50.8    6e-04   
ref|WP_019646285.1|  hypothetical protein                             50.8    6e-04   
gb|AIU50308.1|  ABC1-like kinase                                      50.8    6e-04   
gb|AIU50338.1|  ABC1-like kinase                                      50.8    6e-04   
gb|KHN38818.1|  Putative aarF domain-containing protein kinase, c...  50.8    6e-04   
ref|WP_039729150.1|  MULTISPECIES: hypothetical protein               50.8    6e-04   
gb|AFW81602.1|  ubiquinone biosynthesis protein ubiB                  50.8    7e-04   
gb|AIU50299.1|  ABC1-like kinase                                      50.8    7e-04   
ref|WP_029981386.1|  hypothetical protein                             47.8    7e-04   
ref|WP_038021987.1|  hypothetical protein                             50.8    7e-04   
ref|WP_006624092.1|  MULTISPECIES: hypothetical protein               50.8    7e-04   
ref|WP_036008022.1|  hypothetical protein                             50.8    7e-04   
gb|AFY59807.1|  putative unusual protein kinase                       50.8    7e-04   
ref|WP_027403516.1|  hypothetical protein                             50.8    7e-04   
ref|WP_008053046.1|  hypothetical protein                             50.8    7e-04   
emb|CCI31033.1|  putative aminotransferase class-III                  50.8    7e-04   
ref|XP_010936092.1|  PREDICTED: uncharacterized aarF domain-conta...  50.8    7e-04   
ref|XP_009621317.1|  PREDICTED: uncharacterized aarF domain-conta...  50.8    7e-04   
ref|XP_010936093.1|  PREDICTED: uncharacterized aarF domain-conta...  50.8    7e-04   
ref|XP_004138953.1|  PREDICTED: uncharacterized protein sll0005-like  50.8    8e-04   
ref|WP_015183142.1|  protein kinase                                   50.8    8e-04   
emb|CDX85152.1|  BnaC07g07540D                                        50.8    8e-04   
ref|XP_004164124.1|  PREDICTED: uncharacterized protein sll0005-like  50.8    8e-04   
ref|XP_010650257.1|  PREDICTED: uncharacterized aarF domain-conta...  50.8    8e-04   
ref|XP_003521978.1|  PREDICTED: uncharacterized aarF domain-conta...  50.8    8e-04   
ref|WP_006619178.1|  hypothetical protein                             50.4    8e-04   
ref|WP_028036154.1|  2-octaprenylphenol hydroxylase                   50.4    8e-04   
ref|WP_014276577.1|  hypothetical protein                             50.4    8e-04   
gb|AIU50332.1|  ABC1-like kinase                                      50.4    8e-04   
ref|XP_006354710.1|  PREDICTED: uncharacterized aarF domain-conta...  50.8    8e-04   
ref|XP_006576433.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    8e-04   
ref|WP_029015981.1|  2-octaprenylphenol hydroxylase                   50.4    8e-04   
ref|XP_002983481.1|  hypothetical protein SELMODRAFT_118439           50.4    8e-04   
ref|WP_038018988.1|  hypothetical protein                             50.4    9e-04   
ref|WP_029168360.1|  2-octaprenylphenol hydroxylase                   50.4    9e-04   
emb|CBJ26037.1|  ABC transporter-like                                 50.1    9e-04   
ref|XP_004237437.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    9e-04   
gb|KIJ85106.1|  hypothetical protein SD80_07805                       50.4    0.001   
gb|KGN61457.1|  hypothetical protein Csa_2G129160                     50.4    0.001   
ref|XP_010532799.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    0.001   
ref|WP_029167204.1|  2-octaprenylphenol hydroxylase                   50.4    0.001   
ref|WP_008012432.1|  ABC-1 domain-containing protein                  50.4    0.001   
ref|WP_007141595.1|  ABC transporter                                  50.4    0.001   
gb|EDX86790.1|  ABC1 family protein                                   50.4    0.001   
emb|CDY18081.1|  BnaA01g23420D                                        50.4    0.001   
ref|WP_005581056.1|  membrane protein                                 50.4    0.001   
ref|XP_009793949.1|  PREDICTED: uncharacterized aarF domain-conta...  50.4    0.001   
ref|WP_012593750.1|  MULTISPECIES: hypothetical protein               50.4    0.001   



>ref|XP_004237543.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Solanum lycopersicum]
Length=844

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 164/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
             AL NV EVVRKD+EF+KKGI KGL+WAN+ FR+P+++KS+ D +WLR++E+P  S+ E+
Sbjct  42   NALRNVTEVVRKDAEFIKKGIGKGLQWANKTFRMPKLTKSLDDFIWLRHVEEPGVSS-EV  100

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WPQP YPELSG+DLFMAD+ ALE Y NYFYC+ K WT PLPE YDP++V++YFKL
Sbjct  101  SDAPSWPQPRYPELSGIDLFMADVEALETYLNYFYCISKRWTKPLPETYDPEQVSEYFKL  160

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTF  684
            RPH+VA RLLEVF AF SA I  +I G+LPT N ++ +ETS Y+ G VLKETML+LGPTF
Sbjct  161  RPHVVALRLLEVFVAFTSAAIQIRISGLLPTSNEDVVKETSNYILGKVLKETMLNLGPTF  220

Query  685  IKVGQSLSTRPDIIGSEISK  744
            IK+GQSLSTRPDIIGSEI+K
Sbjct  221  IKIGQSLSTRPDIIGSEITK  240



>ref|XP_006340562.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Solanum tuberosum]
Length=844

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
              L NV EVV+KD+EF+KKGI KGL+WAN+ FRIP+++KS+ D +WLR++E+P  S+ E+
Sbjct  42   NTLRNVTEVVKKDAEFIKKGIGKGLQWANKTFRIPKLTKSLDDFIWLRHVEEPRVSS-EV  100

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WPQP YPELSG+DLFMAD+ ALE Y NYFYC+ K WT PLPE YDP++V++YF L
Sbjct  101  FDAPSWPQPHYPELSGIDLFMADVEALETYLNYFYCISKRWTKPLPETYDPEQVSEYFNL  160

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTF  684
            RPH+VA RLLEVF AF SA I  +I G+LPT N ++ +ETS Y+ G VLKETML+LGPTF
Sbjct  161  RPHVVALRLLEVFVAFTSAAIQIRISGLLPTSNEDVVKETSDYILGKVLKETMLNLGPTF  220

Query  685  IKVGQSLSTRPDIIGSEISK  744
            IK+GQSLSTRPDIIGSEI+K
Sbjct  221  IKIGQSLSTRPDIIGSEITK  240



>ref|XP_009792370.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X2 [Nicotiana sylvestris]
Length=843

 Score =   282 bits (721),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 164/200 (82%), Gaps = 1/200 (1%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
             A+ NV EVV+KD+EF+K+GI KG++WAN+AF IP+++KS+ + +WLR++EDP  SA  +
Sbjct  41   NAIGNVTEVVKKDAEFIKRGIGKGMQWANKAFGIPKLTKSLDNFIWLRHVEDPR-SAVTV  99

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WPQP YPELSG++LF+AD+ ALEAY NYFYC+ K WT PLPE YDP++V++YF L
Sbjct  100  SDAPSWPQPRYPELSGMELFVADIEALEAYLNYFYCISKRWTKPLPETYDPEQVSEYFNL  159

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTF  684
            RPH+VA RLLEVF AF SA I  ++ G+LPT N ++++E S Y+FG VLKETML+LGPTF
Sbjct  160  RPHVVALRLLEVFVAFTSAAIQIRLSGLLPTSNKDVEKENSNYIFGKVLKETMLNLGPTF  219

Query  685  IKVGQSLSTRPDIIGSEISK  744
            IK+GQSLSTRPDIIG++ISK
Sbjct  220  IKIGQSLSTRPDIIGADISK  239



>ref|XP_011040978.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic isoform X5 [Populus euphratica]
Length=365

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VRKD EF+KKGI KG+ WANEAFRIPQVSK++ D++WLRN+ED N+   E 
Sbjct  39   GNFSHFGDTVRKDFEFIKKGINKGMDWANEAFRIPQVSKTLDDILWLRNLEDHNSPPIEP  98

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
            +S   WPQPSYP L+G+DL MADL+ALE+Y+ YFYCL K+W+ PLPE YDPQEVADYF  
Sbjct  99   QS---WPQPSYPGLTGVDLLMADLKALESYARYFYCLSKIWSKPLPEVYDPQEVADYFNC  155

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVFTAFA+ATI  +  G+      + + +++   S+Y  G VLKETML+L
Sbjct  156  RPHLVAFRLLEVFTAFATATIRIRASGMRKFSRSSSDEDVNGNISQYDLGMVLKETMLNL  215

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EI+K
Sbjct  216  GPTFIKVGQSLSTRPDIIGTEITK  239



>ref|XP_011084352.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Sesamum indicum]
Length=814

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 168/243 (69%), Gaps = 12/243 (5%)
 Frame = +1

Query  43   AQLAASVPLLCSvkatstavkkskaapkpkaG---------HGGALDNVVEVVRKDSEFL  195
            A +A  VP+LCS KAT    K   +      G          GG L N+VEVV+KD EFL
Sbjct  2    ASVAPLVPVLCSTKATPRTRKNHFSGSSKSFGPKKNQKLSKSGGGLGNIVEVVQKDVEFL  61

Query  196  KKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWPQPSYPELSGL  375
            K G  KGL+WAN+AFRIP+VSKSV D+VWLRN+EDP A  +   S   WPQP YPELSG 
Sbjct  62   KAGFGKGLQWANKAFRIPEVSKSVEDLVWLRNVEDPQAKFSRFPS---WPQPYYPELSGT  118

Query  376  DLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFA  555
            DLF+ADL+ALE Y  Y+Y L K+WT PLPE YD QEV DYF LRPH+VA RLLEVF AF 
Sbjct  119  DLFLADLKALEVYVGYYYYLAKMWTKPLPEFYDAQEVTDYFTLRPHVVALRLLEVFMAFV  178

Query  556  SATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSE  735
            SATI F+I  I      +  +  S Y FG VLK+TML+LGPTFIKVGQSLSTRPDIIG E
Sbjct  179  SATIKFRISRISSAAEEDGHKNVSDYNFGIVLKDTMLNLGPTFIKVGQSLSTRPDIIGYE  238

Query  736  ISK  744
            ISK
Sbjct  239  ISK  241



>ref|XP_009792369.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X1 [Nicotiana sylvestris]
Length=844

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
             A+ NV EVV+KD+EF+K+GI KG++WAN+AF IP+++KS+ + +WLR++EDP  SA  +
Sbjct  41   NAIGNVTEVVKKDAEFIKRGIGKGMQWANKAFGIPKLTKSLDNFIWLRHVEDPR-SAVTV  99

Query  325  KSRTRWPQPSYP-ELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
                 WPQP YP ELSG++LF+AD+ ALEAY NYFYC+ K WT PLPE YDP++V++YF 
Sbjct  100  SDAPSWPQPRYPAELSGMELFVADIEALEAYLNYFYCISKRWTKPLPETYDPEQVSEYFN  159

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPT  681
            LRPH+VA RLLEVF AF SA I  ++ G+LPT N ++++E S Y+FG VLKETML+LGPT
Sbjct  160  LRPHVVALRLLEVFVAFTSAAIQIRLSGLLPTSNKDVEKENSNYIFGKVLKETMLNLGPT  219

Query  682  FIKVGQSLSTRPDIIGSEISK  744
            FIK+GQSLSTRPDIIG++ISK
Sbjct  220  FIKIGQSLSTRPDIIGADISK  240



>ref|XP_011040975.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic isoform X3 [Populus euphratica]
Length=603

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VRKD EF+KKGI KG+ WANEAFRIPQVSK++ D++WLRN+ED N+   E 
Sbjct  39   GNFSHFGDTVRKDFEFIKKGINKGMDWANEAFRIPQVSKTLDDILWLRNLEDHNSPPIEP  98

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
            +S   WPQPSYP L+G+DL MADL+ALE+Y+ YFYCL K+W+ PLPE YDPQEVADYF  
Sbjct  99   QS---WPQPSYPGLTGVDLLMADLKALESYARYFYCLSKIWSKPLPEVYDPQEVADYFNC  155

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVFTAFA+ATI  +  G+      + + +++   S+Y  G VLKETML+L
Sbjct  156  RPHLVAFRLLEVFTAFATATIRIRASGMRKFSRSSSDEDVNGNISQYDLGMVLKETMLNL  215

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EI+K
Sbjct  216  GPTFIKVGQSLSTRPDIIGTEITK  239



>ref|XP_011040976.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic isoform X4 [Populus euphratica]
Length=588

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VRKD EF+KKGI KG+ WANEAFRIPQVSK++ D++WLRN+ED N+   E 
Sbjct  39   GNFSHFGDTVRKDFEFIKKGINKGMDWANEAFRIPQVSKTLDDILWLRNLEDHNSPPIEP  98

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
            +S   WPQPSYP L+G+DL MADL+ALE+Y+ YFYCL K+W+ PLPE YDPQEVADYF  
Sbjct  99   QS---WPQPSYPGLTGVDLLMADLKALESYARYFYCLSKIWSKPLPEVYDPQEVADYFNC  155

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVFTAFA+ATI  +  G+      + + +++   S+Y  G VLKETML+L
Sbjct  156  RPHLVAFRLLEVFTAFATATIRIRASGMRKFSRSSSDEDVNGNISQYDLGMVLKETMLNL  215

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EI+K
Sbjct  216  GPTFIKVGQSLSTRPDIIGTEITK  239



>ref|XP_008236447.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Prunus mume]
Length=832

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (78%), Gaps = 10/209 (5%)
 Frame = +1

Query  139  HGGALDN---VVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNA  309
            HG AL +   + +VVRKD EFLK+GI  G++WAN+AFRIP+VSK++ DVVWLRN+EDPNA
Sbjct  37   HGRALGDFGHLGQVVRKDVEFLKRGIGSGIQWANKAFRIPEVSKTLDDVVWLRNLEDPNA  96

Query  310  SAAELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVA  489
                  S   WPQPSYPELSG+DLFMADL+A EAY+ YFY L K+W+ PLPE YDP+ + 
Sbjct  97   PPLPAPS---WPQPSYPELSGVDLFMADLKAFEAYALYFYYLSKVWSKPLPEVYDPESIG  153

Query  490  DYFKLRPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKE  657
            DYF+ RPH+VAFRLLEVF++FASA I  +  GI     P+ +  I+   S+Y FG VLKE
Sbjct  154  DYFRCRPHVVAFRLLEVFSSFASAAIRIRTSGIKKFLRPSSDEGINENVSQYNFGMVLKE  213

Query  658  TMLSLGPTFIKVGQSLSTRPDIIGSEISK  744
            TML+LGPTFIKVGQSLSTRPDIIG+EISK
Sbjct  214  TMLNLGPTFIKVGQSLSTRPDIIGAEISK  242



>ref|XP_011040974.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic isoform X2 [Populus euphratica]
Length=813

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VRKD EF+KKGI KG+ WANEAFRIPQVSK++ D++WLRN+ED N+   E 
Sbjct  39   GNFSHFGDTVRKDFEFIKKGINKGMDWANEAFRIPQVSKTLDDILWLRNLEDHNSPPIEP  98

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
            +S   WPQPSYP L+G+DL MADL+ALE+Y+ YFYCL K+W+ PLPE YDPQEVADYF  
Sbjct  99   QS---WPQPSYPGLTGVDLLMADLKALESYARYFYCLSKIWSKPLPEVYDPQEVADYFNC  155

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVFTAFA+ATI  +  G+      + + +++   S+Y  G VLKETML+L
Sbjct  156  RPHLVAFRLLEVFTAFATATIRIRASGMRKFSRSSSDEDVNGNISQYDLGMVLKETMLNL  215

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EI+K
Sbjct  216  GPTFIKVGQSLSTRPDIIGTEITK  239



>ref|XP_007199666.1| hypothetical protein PRUPE_ppa001434mg [Prunus persica]
 gb|EMJ00865.1| hypothetical protein PRUPE_ppa001434mg [Prunus persica]
Length=830

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   ++ +V RKD EFLK+GI  G++WAN+AFRIP+VSK++ D+VWLRN+EDPNA     
Sbjct  42   GDFGHLGQVFRKDVEFLKRGIGSGIQWANKAFRIPEVSKTLDDIVWLRNLEDPNAPPLPA  101

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
             S   WPQPSYPELSG+DLFMADL+A EAY+ YFY L K+W+ PLPE YDP+ V DYF+ 
Sbjct  102  PS---WPQPSYPELSGVDLFMADLKAFEAYALYFYYLSKVWSKPLPEVYDPESVGDYFRC  158

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVF++FASA I  +  GI     P+++  I+   S+Y FG VLKETML+L
Sbjct  159  RPHVVAFRLLEVFSSFASAAIRIRTSGIKKLLRPSLDEGINENVSQYNFGMVLKETMLNL  218

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EISK
Sbjct  219  GPTFIKVGQSLSTRPDIIGAEISK  242



>ref|XP_011040973.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic isoform X1 [Populus euphratica]
Length=826

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VRKD EF+KKGI KG+ WANEAFRIPQVSK++ D++WLRN+ED N+   E 
Sbjct  39   GNFSHFGDTVRKDFEFIKKGINKGMDWANEAFRIPQVSKTLDDILWLRNLEDHNSPPIEP  98

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
            +S   WPQPSYP L+G+DL MADL+ALE+Y+ YFYCL K+W+ PLPE YDPQEVADYF  
Sbjct  99   QS---WPQPSYPGLTGVDLLMADLKALESYARYFYCLSKIWSKPLPEVYDPQEVADYFNC  155

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVFTAFA+ATI  +  G+      + + +++   S+Y  G VLKETML+L
Sbjct  156  RPHLVAFRLLEVFTAFATATIRIRASGMRKFSRSSSDEDVNGNISQYDLGMVLKETMLNL  215

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EI+K
Sbjct  216  GPTFIKVGQSLSTRPDIIGTEITK  239



>ref|XP_004142394.1| PREDICTED: uncharacterized protein sll0005-like [Cucumis sativus]
Length=831

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 153/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  166  EVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWP  345
            +VVRKD EF+K G+ KG+RWAN+AFRIPQVSKSV DV+WLRNIEDP A      SR   P
Sbjct  46   DVVRKDVEFIKGGLGKGIRWANDAFRIPQVSKSVDDVLWLRNIEDPQAVNLPTPSR---P  102

Query  346  QPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAF  525
            QPSYPELSG+DLFMADL+ALEAY+ Y+Y L K+WT PLPE YDP+ VA+YF  RPHIV  
Sbjct  103  QPSYPELSGVDLFMADLKALEAYAVYYYSLSKIWTKPLPEVYDPESVAEYFGCRPHIVGL  162

Query  526  RLLEVFTAFASATIIFQIFGI--LPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
            RLLEVF++FASA I  ++  +   P  +   D + S+  FG VLKET+L+LGPTFIKVGQ
Sbjct  163  RLLEVFSSFASAAIRIRMSRVQKFPGTSLHEDSDESKSNFGLVLKETLLNLGPTFIKVGQ  222

Query  700  SLSTRPDIIGSEISK  744
            SLSTRPDIIGSEISK
Sbjct  223  SLSTRPDIIGSEISK  237



>ref|XP_004157521.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein sll0005-like 
[Cucumis sativus]
Length=831

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 154/198 (78%), Gaps = 5/198 (3%)
 Frame = +1

Query  157  NVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRT  336
            +  +VVRKD EF+K G+ KG+RWAN+AFRIPQVSKSV DV+WLRNIEDP A      SR 
Sbjct  43   HFADVVRKDVEFIKGGLGKGIRWANDAFRIPQVSKSVDDVLWLRNIEDPQAVNLPTPSR-  101

Query  337  RWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHI  516
              PQPSYPELSG+DLFMADL+ALEAY+ Y+Y L K+WT PLPE YDP+ VA+YF  RPHI
Sbjct  102  --PQPSYPELSGVDLFMADLKALEAYAVYYYSLSKIWTKPLPEVYDPESVAEYFGCRPHI  159

Query  517  VAFRLLEVFTAFASATIIFQIFGI--LPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIK  690
            V  RLLEVF++FASA I  ++  +   P  +   D + S+  FG VLKET+L+LGPTFIK
Sbjct  160  VGLRLLEVFSSFASAAIRIRMSRVQKFPGTSLHEDSDESKSNFGLVLKETLLNLGPTFIK  219

Query  691  VGQSLSTRPDIIGSEISK  744
            VGQSLSTRPDIIGSEISK
Sbjct  220  VGQSLSTRPDIIGSEISK  237



>gb|KGN52281.1| hypothetical protein Csa_5G623450 [Cucumis sativus]
Length=842

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 153/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  166  EVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWP  345
            +VVRKD EF+K G+ KG+RWAN+AFRIPQVSKSV DV+WLRNIEDP A      SR   P
Sbjct  46   DVVRKDVEFIKGGLGKGIRWANDAFRIPQVSKSVDDVLWLRNIEDPQAVNLPTPSR---P  102

Query  346  QPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAF  525
            QPSYPELSG+DLFMADL+ALEAY+ Y+Y L K+WT PLPE YDP+ VA+YF  RPHIV  
Sbjct  103  QPSYPELSGVDLFMADLKALEAYAVYYYSLSKIWTKPLPEVYDPESVAEYFGCRPHIVGL  162

Query  526  RLLEVFTAFASATIIFQIFGI--LPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
            RLLEVF++FASA I  ++  +   P  +   D + S+  FG VLKET+L+LGPTFIKVGQ
Sbjct  163  RLLEVFSSFASAAIRIRMSRVQKFPGTSLHEDSDESKSNFGLVLKETLLNLGPTFIKVGQ  222

Query  700  SLSTRPDIIGSEISK  744
            SLSTRPDIIGSEISK
Sbjct  223  SLSTRPDIIGSEISK  237



>ref|XP_008446897.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Cucumis melo]
Length=844

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 156/198 (79%), Gaps = 5/198 (3%)
 Frame = +1

Query  157  NVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRT  336
            +  +VVRKD EF+K G+ +G+RWAN+AFRIPQVSKSV DV+WLRNIEDP A      S+ 
Sbjct  45   HFADVVRKDVEFIKVGLGRGIRWANDAFRIPQVSKSVDDVLWLRNIEDPQAVNLPTPSQ-  103

Query  337  RWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHI  516
              PQPSYPELSG+DLFMADL+ALEAY+ Y+Y L K+WT PLPE YDPQ VA+YF+ RPHI
Sbjct  104  --PQPSYPELSGVDLFMADLKALEAYAVYYYSLSKVWTKPLPEVYDPQSVAEYFRCRPHI  161

Query  517  VAFRLLEVFTAFASATIIFQIFGI--LPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIK  690
            V  RLLEVF++FASA+I  ++  +   P  +   D + S+  FG VLKET+L+LGPTFIK
Sbjct  162  VGLRLLEVFSSFASASIRIRMSRVQKFPGTSLYEDSDESKSKFGLVLKETLLNLGPTFIK  221

Query  691  VGQSLSTRPDIIGSEISK  744
            VGQS+STRPDIIGSEISK
Sbjct  222  VGQSISTRPDIIGSEISK  239



>gb|EYU39822.1| hypothetical protein MIMGU_mgv1a001466mg [Erythranthe guttata]
Length=814

 Score =   257 bits (657),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = +1

Query  157  NVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRT  336
            NVVEVV+KD  FLK G+ KGL+WAN+AFRIP+VSKSV D +WLRN+ED    AA      
Sbjct  57   NVVEVVQKDVAFLKAGLGKGLQWANKAFRIPEVSKSVEDFIWLRNVED--PQAAAFAPPP  114

Query  337  RWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHI  516
             WPQP YPE+SG+DLFM+DL+ALE Y  YFY   K+WT PLPE YD +EVA+YF LRPH+
Sbjct  115  SWPQPYYPEISGVDLFMSDLKALEVYFGYFYYRSKMWTKPLPEIYDAEEVAEYFALRPHV  174

Query  517  VAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVG  696
            VA RLLEVFTAF SATI  +I  I    + +   + S Y FG VLKETML+LGPTFIK G
Sbjct  175  VALRLLEVFTAFVSATIKLRISSISSAADEDSREKASEYNFGIVLKETMLNLGPTFIKAG  234

Query  697  QSLSTRPDIIGSEISK  744
            QSLSTRPD+IG EISK
Sbjct  235  QSLSTRPDVIGYEISK  250



>gb|KEH43526.1| AarF domain kinase [Medicago truncatula]
Length=614

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 156/205 (76%), Gaps = 9/205 (4%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  +VVRKD EFLK+G   G+ WAN+AFRIPQ++K V D+VWLRN+EDP A++   
Sbjct  34   GNFGHFGQVVRKDMEFLKRGFNNGVAWANDAFRIPQIAKKVDDLVWLRNLEDPQATSFST  93

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
             S   WP+P YP LSG+DL M DL+ALEAY++YFY L K+W+ PLPE YDPQ+VA YF  
Sbjct  94   PS---WPEPWYPGLSGVDLLMYDLKALEAYASYFYHLSKIWSKPLPETYDPQDVAHYFSA  150

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI---LPTMNTE--IDRETSRYVFGCVLKETMLS  669
            RPH+VA R+LEVF++FASA +  +  G+   LP +N E  +D +TS Y FG VLKETML+
Sbjct  151  RPHVVALRMLEVFSSFASAGVSIRTSGLRKFLP-INAEGGMDDKTSEYNFGLVLKETMLN  209

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTFIKVGQSLSTRPDIIG E+SK
Sbjct  210  LGPTFIKVGQSLSTRPDIIGVEMSK  234



>gb|KJB73602.1| hypothetical protein B456_011G240500 [Gossypium raimondii]
Length=845

 Score =   256 bits (653),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 149/204 (73%), Gaps = 6/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  +VVR+D +FLK G+ +G+ WANE FRIPQ  K+V DVVWLRN+EDPN S    
Sbjct  48   GNFSHFGDVVRRDMDFLKTGVQRGVEWANETFRIPQAKKAVDDVVWLRNLEDPNFSPP--  105

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WPQP YP LSG+DL MADL+ALEAY +YFY   K W+ PLPE YD +EV DYF  
Sbjct  106  AQPPLWPQPYYPALSGMDLMMADLKALEAYVSYFYYQSKKWSKPLPEAYDAEEVTDYFSH  165

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFG----ILPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVF++FASA I  ++ G    + P  + +ID   S+Y FG VLKETMLSL
Sbjct  166  RPHVVAFRLLEVFSSFASAAIRIRMAGLKKSLRPGSSKDIDENLSQYNFGMVLKETMLSL  225

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG EISK
Sbjct  226  GPTFIKVGQSLSTRPDIIGPEISK  249



>gb|KDP25718.1| hypothetical protein JCGZ_23939 [Jatropha curcas]
Length=838

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 154/204 (75%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VRKD +FLKKGI +G+ WANEAFRIPQV K++ DV+WLRN+EDP A   E 
Sbjct  42   GNFSHFRDAVRKDFQFLKKGIGRGIDWANEAFRIPQVFKTLDDVLWLRNLEDPKAPPLE-  100

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WPQ SY  L+G+DL MADL+ALEAY++YFY L K+W+ PLPE YDPQ+V+ YF  
Sbjct  101  --PVAWPQTSYTGLTGVDLVMADLKALEAYASYFYYLSKIWSKPLPEVYDPQDVSHYFSC  158

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VA RLLEVF+AFASATI  +   I     P+ + E++   S+Y FG VLKETML+L
Sbjct  159  RPHVVALRLLEVFSAFASATIRIRTSRIRKLLRPSSDKELNGNISQYDFGLVLKETMLNL  218

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EISK
Sbjct  219  GPTFIKVGQSLSTRPDIIGTEISK  242



>ref|XP_003591940.1| aarF domain-containing protein kinase, putative [Medicago truncatula]
 gb|AES62191.1| AarF domain kinase [Medicago truncatula]
Length=824

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 157/208 (75%), Gaps = 15/208 (7%)
 Frame = +1

Query  136  GHGGALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASA  315
            GH G      +VVRKD EFLK+G   G+ WAN+AFRIPQ++K V D+VWLRN+EDP A++
Sbjct  37   GHFG------QVVRKDMEFLKRGFNNGVAWANDAFRIPQIAKKVDDLVWLRNLEDPQATS  90

Query  316  AELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADY  495
                S   WP+P YP LSG+DL M DL+ALEAY++YFY L K+W+ PLPE YDPQ+VA Y
Sbjct  91   FSTPS---WPEPWYPGLSGVDLLMYDLKALEAYASYFYHLSKIWSKPLPETYDPQDVAHY  147

Query  496  FKLRPHIVAFRLLEVFTAFASATIIFQIFGI---LPTMNTE--IDRETSRYVFGCVLKET  660
            F  RPH+VA R+LEVF++FASA +  +  G+   LP +N E  +D +TS Y FG VLKET
Sbjct  148  FSARPHVVALRMLEVFSSFASAGVSIRTSGLRKFLP-INAEGGMDDKTSEYNFGLVLKET  206

Query  661  MLSLGPTFIKVGQSLSTRPDIIGSEISK  744
            ML+LGPTFIKVGQSLSTRPDIIG E+SK
Sbjct  207  MLNLGPTFIKVGQSLSTRPDIIGVEMSK  234



>emb|CDP04368.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   252 bits (643),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  175  RKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWPQPS  354
            +KD EFL+KG +KG+ WAN    +P+++KS+ D +WLR++EDP    + L++ + WPQP 
Sbjct  44   KKDFEFLRKGFSKGVEWANTTLHLPKIAKSIDDFIWLRHVEDPRV-VSPLRTPS-WPQPY  101

Query  355  YPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLL  534
            YPELSG+DL +ADL+ALEAY  YFY L KLWT PLPE YD QEVADYF+LRPH+VA RLL
Sbjct  102  YPELSGIDLLVADLQALEAYIRYFYYLSKLWTKPLPESYDSQEVADYFRLRPHVVALRLL  161

Query  535  EVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTR  714
            EVF AF+SA I  +I GI  + +   D++ S+Y FG +LKETML+LGPTFIK+GQSLSTR
Sbjct  162  EVFAAFSSAAIRMRISGIGSSKSNVADKDISQYSFGILLKETMLNLGPTFIKIGQSLSTR  221

Query  715  PDIIGSEISK  744
            PDIIG+EISK
Sbjct  222  PDIIGTEISK  231



>ref|XP_010534414.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010534415.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X2 [Tarenaya hassleriana]
Length=808

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 149/205 (73%), Gaps = 15/205 (7%)
 Frame = +1

Query  142  GGALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAE  321
             G L NV EVVRKD EFLK  I  G+RWAN+AFR+P+ +K   +V WLRN+EDP A   E
Sbjct  34   AGGLGNVSEVVRKDVEFLKDKIGGGIRWANKAFRVPEATKKAEEVFWLRNLEDPAAPPLE  93

Query  322  LKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
             +S   WPQPSYP LSG+DLFMAD++ALEAY+ YFY L KLW+ PLPE Y+P+ VADYF 
Sbjct  94   PQS---WPQPSYPGLSGVDLFMADVKALEAYAGYFYYLSKLWSRPLPEVYEPEAVADYFS  150

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR----ETSRYVFGCVLKETMLS  669
             RPH+VAFRLLEVF AF  A I  Q         +E D+    E S   FG VLKET+L+
Sbjct  151  CRPHVVAFRLLEVFFAFMFAAIRIQ--------TSESDKGRNVEASGKNFGIVLKETLLN  202

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTFIKVGQSLSTRPDIIG+E+SK
Sbjct  203  LGPTFIKVGQSLSTRPDIIGTEVSK  227



>ref|XP_006436281.1| hypothetical protein CICLE_v10030711mg [Citrus clementina]
 ref|XP_006485871.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Citrus sinensis]
 gb|ESR49521.1| hypothetical protein CICLE_v10030711mg [Citrus clementina]
Length=829

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 155/204 (76%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VRKD EFLKK I KG+ WAN+ FR+PQVSK++ DV+WLRN+EDP A  AEL
Sbjct  35   GDFSHFGDAVRKDMEFLKKRIGKGIGWANQTFRLPQVSKTLDDVLWLRNLEDPRA--AEL  92

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
            +    WPQPSYP L+G DL MADL+ALEAY+NYFY ++K+W+ PLPE Y+PQ+VADYF  
Sbjct  93   EP-CDWPQPSYPGLTGADLLMADLKALEAYANYFYHMLKIWSKPLPEVYNPQDVADYFNC  151

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRE----TSRYVFGCVLKETMLSL  672
            RPHIV  RLLEV + F SA I  +   I   + ++++++     S+Y FG +LKET+L+L
Sbjct  152  RPHIVGLRLLEVGSCFLSAVIRIRTSRIRKFLRSDLEKDFDGNISQYNFGMILKETVLNL  211

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIGS+ISK
Sbjct  212  GPTFIKVGQSLSTRPDIIGSDISK  235



>ref|XP_002316360.2| hypothetical protein POPTR_0010s22780g [Populus trichocarpa]
 gb|EEF02531.2| hypothetical protein POPTR_0010s22780g [Populus trichocarpa]
Length=826

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + V KD EF+KKGI KG+ WANEAFRIPQVSK++ D++WLRN+ED N+   E 
Sbjct  39   GNFSHFGDTVGKDFEFIKKGINKGMDWANEAFRIPQVSKTLDDILWLRNLEDHNSPPIEP  98

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
            +S   WPQPSYP L+G+DL +ADL+ALE+Y++YFYCL K+W+ PLPE YDPQEVADYF  
Sbjct  99   QS---WPQPSYPGLTGVDLLLADLKALESYASYFYCLSKIWSKPLPEAYDPQEVADYFNC  155

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNT----EIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVFTAFA+ATI  +  G+   + +    +++   S+Y  G VLKETML+L
Sbjct  156  RPHLVAFRLLEVFTAFATATIRIRASGMRKFLRSGSDEDVNGNISQYDLGMVLKETMLNL  215

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+EI+K
Sbjct  216  GPTFIKVGQSLSTRPDIIGTEITK  239



>ref|XP_004496288.1| PREDICTED: uncharacterized protein sll0005-like [Cicer arietinum]
Length=831

 Score =   247 bits (631),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 154/205 (75%), Gaps = 9/205 (4%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  +VVRKD EFLK+G   G+ WAN+AFRIP+++K + D+VWLRN+EDP+A++   
Sbjct  36   GNFGHFGQVVRKDMEFLKRGFNNGVSWANDAFRIPRIAKKIDDLVWLRNLEDPHATSFST  95

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
             S   WP+P YP LSG+DL M DL+ALEAY++YFY L K+W+ PLPE YDPQ+VA YF  
Sbjct  96   PS---WPEPWYPGLSGVDLLMYDLKALEAYASYFYHLSKIWSKPLPEAYDPQDVAHYFSA  152

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI---LPTMNTE--IDRETSRYVFGCVLKETMLS  669
            RPH+VA R++EV ++FASA +  +  G+   LP MN E   D +TS Y FG VLKETML 
Sbjct  153  RPHVVALRIIEVCSSFASAMVSIRTAGLRKFLP-MNAEEDADDKTSEYNFGLVLKETMLK  211

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTFIKVGQSLSTRPDIIG E+SK
Sbjct  212  LGPTFIKVGQSLSTRPDIIGFEMSK  236



>gb|KFK36812.1| hypothetical protein AALP_AA4G174700 [Arabis alpina]
Length=824

 Score =   246 bits (629),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 148/203 (73%), Gaps = 11/203 (5%)
 Frame = +1

Query  136  GHGGALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASA  315
            GH G      EVVR D EFLK  I  G++WANEAFR+P+V+KS  +++WLR++EDP  S+
Sbjct  44   GHFG------EVVRNDVEFLKNKIGIGIKWANEAFRVPEVTKSAEELLWLRHLEDP-VSS  96

Query  316  AELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADY  495
              L+ +  WPQPSY  LSG+DL MAD++ALEAY+ Y YCL K+W+ PLPE YD QEVADY
Sbjct  97   TPLEPKRSWPQPSYSGLSGVDLLMADVKALEAYAGYVYCLSKMWSRPLPEVYDAQEVADY  156

Query  496  FKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLG  675
            F  RPH+VAFRLLEVF+AF  A I  +        +     E S+ +FG VLKETML LG
Sbjct  157  FNCRPHVVAFRLLEVFSAFMVAAIRLRT----SASDKRKTLEASKQIFGMVLKETMLHLG  212

Query  676  PTFIKVGQSLSTRPDIIGSEISK  744
            PTFIKVGQSLSTRPD+IG+EISK
Sbjct  213  PTFIKVGQSLSTRPDLIGTEISK  235



>ref|NP_565901.1| ATH subfamily protein ATH8 [Arabidopsis thaliana]
 gb|AAK82561.1| At2g39190/T16B24.17 [Arabidopsis thaliana]
 gb|AAM14998.1| putative ABC transporter; alternative splicing isoform Structure 
for this isoform supported by cDNA: gi_15081812_gb_AY048299 
1_ [Arabidopsis thaliana]
 gb|AAO11631.1| At2g39190/T16B24.17 [Arabidopsis thaliana]
 gb|AEC09643.1| ATH subfamily protein ATH8 [Arabidopsis thaliana]
Length=374

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
             L +  +VVR D +FLK  I  GLRWANEAFR+P+V+KS  ++ WLR++ED   ++  LK
Sbjct  42   GLGHFADVVRNDVDFLKNKIGIGLRWANEAFRVPEVTKSAEELFWLRHLED--HTSQNLK  99

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
            S++ WPQPSY  L+G+DLFMAD++ALE Y+ YFY L K+W+ PLPE YD Q VADYF  R
Sbjct  100  SQS-WPQPSYSGLTGVDLFMADVKALETYAGYFYSLSKMWSRPLPEVYDSQAVADYFNCR  158

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            PH+VAFRLLEVF+AF  A I  +    +   +     E S  +FG VLKETML LGPTFI
Sbjct  159  PHVVAFRLLEVFSAFTIAAIRLRTSASVKGKSL----EASEQIFGMVLKETMLHLGPTFI  214

Query  688  KVGQSLSTRPDIIGSEISK  744
            KVGQSLSTRPDIIG+EISK
Sbjct  215  KVGQSLSTRPDIIGTEISK  233



>ref|XP_002274556.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Vitis vinifera]
 emb|CBI31476.3| unnamed protein product [Vitis vinifera]
Length=824

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 148/197 (75%), Gaps = 7/197 (4%)
 Frame = +1

Query  166  EVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWP  345
            EVV KD EFLKK I +G++WAN A RIPQ+SKS+  ++WLR  EDP A++    S   WP
Sbjct  37   EVVGKDMEFLKKRIGRGVQWANGALRIPQLSKSLDRLLWLRMTEDPLAASLPPPS---WP  93

Query  346  QPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAF  525
            QPSYP LSG+DLFMADL+ALE Y++YFY L KLW+ PLPE YDP EVADYF  RPHIVA 
Sbjct  94   QPSYPGLSGVDLFMADLKALETYASYFYHLSKLWSKPLPEVYDPLEVADYFNRRPHIVAL  153

Query  526  RLLEVFTAFASATIIFQIFGIL----PTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKV  693
            RLLEVF++FA A I  +  GI       M+ +I+   S Y FG VLKETML+LGPTFIKV
Sbjct  154  RLLEVFSSFAFAAIRIRTSGITMFYGSNMDRDINGNISPYNFGMVLKETMLNLGPTFIKV  213

Query  694  GQSLSTRPDIIGSEISK  744
            GQS+STRPDIIG EISK
Sbjct  214  GQSISTRPDIIGPEISK  230



>ref|XP_010507623.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic-like [Camelina sativa]
Length=770

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
             L +  +VVR D +FLK  I  GLRWANEAFR+P+V+KS  ++ WLR++ED  AS    K
Sbjct  45   GLGHFTDVVRSDFDFLKNKIGIGLRWANEAFRVPEVTKSAEELFWLRHLEDHRASTNSEK  104

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
                WPQPSY  LSG+DLFMAD++ALEAY+ YFYCL K+W+ PLPE YD Q VADYF  R
Sbjct  105  QA--WPQPSYSGLSGVDLFMADVKALEAYAGYFYCLSKMWSRPLPEVYDSQAVADYFNCR  162

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            PH+VA RLLEVF+AF  A I  +        +   D E S   FG VLKETML LGPTFI
Sbjct  163  PHVVALRLLEVFSAFMIAAIRLRT----SASDKGKDLEASEKNFGMVLKETMLRLGPTFI  218

Query  688  KVGQSLSTRPDIIGSEISKK  747
            KVGQSLSTRPDIIG+EISK+
Sbjct  219  KVGQSLSTRPDIIGTEISKE  238



>ref|XP_006293688.1| hypothetical protein CARUB_v10022647mg [Capsella rubella]
 gb|EOA26586.1| hypothetical protein CARUB_v10022647mg [Capsella rubella]
Length=598

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 142/199 (71%), Gaps = 6/199 (3%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
             L +  +VVR D ++LK  I  GLRWANEAFR+P+V+KS  ++ WLR++ED +AS    K
Sbjct  45   GLGHFADVVRNDVDYLKNKIGVGLRWANEAFRVPEVTKSAEELFWLRHLEDHHASKNVEK  104

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
                WPQPSY  LSG+DLFMAD++ALEAY+ YFYCL K+W+ PLPE YD Q VADYF  R
Sbjct  105  QA--WPQPSYSGLSGVDLFMADVKALEAYAGYFYCLSKMWSRPLPEVYDSQAVADYFNCR  162

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            PH+VAFRLLEVF+AF  A I  +        N E   +     FG VLKETML LGPTFI
Sbjct  163  PHVVAFRLLEVFSAFMIAAIRLRSSASDKGKNLEASEQN----FGMVLKETMLRLGPTFI  218

Query  688  KVGQSLSTRPDIIGSEISK  744
            KVGQSLSTRPDIIG+E SK
Sbjct  219  KVGQSLSTRPDIIGTETSK  237



>gb|KCW65390.1| hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis]
Length=839

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 148/204 (73%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + V+KD+ FL+K I +G+ WANEA RIP V+K++ DVVWLR +E+P+A   E 
Sbjct  48   GDFSHFADAVKKDASFLRKRIGRGIEWANEALRIPLVAKTLDDVVWLRVLENPDAPPVE-  106

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WP+P YPELSGLDL MADLRALEAY  YFYCL ++W+ PLPE Y+ ++V  YF  
Sbjct  107  --DCPWPRPCYPELSGLDLVMADLRALEAYMAYFYCLSRVWSRPLPEVYNVEDVNYYFSC  164

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRET----SRYVFGCVLKETMLSL  672
            RPH+VA RLLEVF +FASAT+  +  GI   +    D++     S+Y FG  LKETML+L
Sbjct  165  RPHVVALRLLEVFFSFASATVKIRASGIASYLRLNSDKDNDGNISQYNFGLALKETMLNL  224

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIGSEISK
Sbjct  225  GPTFIKVGQSLSTRPDIIGSEISK  248



>ref|XP_010067294.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Eucalyptus grandis]
 gb|KCW65392.1| hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis]
Length=842

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 148/204 (73%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + V+KD+ FL+K I +G+ WANEA RIP V+K++ DVVWLR +E+P+A   E 
Sbjct  48   GDFSHFADAVKKDASFLRKRIGRGIEWANEALRIPLVAKTLDDVVWLRVLENPDAPPVE-  106

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WP+P YPELSGLDL MADLRALEAY  YFYCL ++W+ PLPE Y+ ++V  YF  
Sbjct  107  --DCPWPRPCYPELSGLDLVMADLRALEAYMAYFYCLSRVWSRPLPEVYNVEDVNYYFSC  164

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRET----SRYVFGCVLKETMLSL  672
            RPH+VA RLLEVF +FASAT+  +  GI   +    D++     S+Y FG  LKETML+L
Sbjct  165  RPHVVALRLLEVFFSFASATVKIRASGIASYLRLNSDKDNDGNISQYNFGLALKETMLNL  224

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIGSEISK
Sbjct  225  GPTFIKVGQSLSTRPDIIGSEISK  248



>ref|XP_010509063.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic-like [Camelina sativa]
Length=818

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 143/203 (70%), Gaps = 12/203 (6%)
 Frame = +1

Query  136  GHGGALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASA  315
            GH G      +VVR D +FLK  I  GLRWANEAFR+P+V+KS  ++ WLR++ED  AS 
Sbjct  47   GHFG------DVVRSDFDFLKNKIGIGLRWANEAFRVPEVTKSAEELFWLRHLEDHRASM  100

Query  316  AELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADY  495
               K    WPQPSY  LSG+DLFMAD++ALEAY+ YFYCL K+W+ PLPE YD Q VADY
Sbjct  101  NSEKQS--WPQPSYSGLSGVDLFMADVKALEAYAGYFYCLSKMWSKPLPEVYDSQAVADY  158

Query  496  FKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLG  675
            F  RPH+VA RLLEVF+AF  A I  +        +   D E S   FG VLKETML LG
Sbjct  159  FNCRPHVVALRLLEVFSAFMIAAIRLRT----SASDKGKDLEASEQNFGMVLKETMLRLG  214

Query  676  PTFIKVGQSLSTRPDIIGSEISK  744
            PTFIKVGQSLSTRPDIIG+EISK
Sbjct  215  PTFIKVGQSLSTRPDIIGTEISK  237



>gb|KCW65391.1| hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis]
Length=831

 Score =   241 bits (615),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 148/204 (73%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + V+KD+ FL+K I +G+ WANEA RIP V+K++ DVVWLR +E+P+A   E 
Sbjct  48   GDFSHFADAVKKDASFLRKRIGRGIEWANEALRIPLVAKTLDDVVWLRVLENPDAPPVE-  106

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                 WP+P YPELSGLDL MADLRALEAY  YFYCL ++W+ PLPE Y+ ++V  YF  
Sbjct  107  --DCPWPRPCYPELSGLDLVMADLRALEAYMAYFYCLSRVWSRPLPEVYNVEDVNYYFSC  164

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRET----SRYVFGCVLKETMLSL  672
            RPH+VA RLLEVF +FASAT+  +  GI   +    D++     S+Y FG  LKETML+L
Sbjct  165  RPHVVALRLLEVFFSFASATVKIRASGIASYLRLNSDKDNDGNISQYNFGLALKETMLNL  224

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIGSEISK
Sbjct  225  GPTFIKVGQSLSTRPDIIGSEISK  248



>ref|XP_002879787.1| hypothetical protein ARALYDRAFT_903159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56046.1| hypothetical protein ARALYDRAFT_903159 [Arabidopsis lyrata subsp. 
lyrata]
Length=786

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 142/193 (74%), Gaps = 7/193 (4%)
 Frame = +1

Query  166  EVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWP  345
            +VVR D +FLK  I  GL WANEAFR+P+V+KS  ++ WLR++ED  +S+ E +S   WP
Sbjct  11   DVVRNDVDFLKNKIGIGLWWANEAFRVPEVTKSAEELFWLRHLEDHASSSLESQS---WP  67

Query  346  QPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAF  525
            QPSY  LSG+DLFMAD++ALEAY+ YFYCL K+W+ PLPE YD Q VADYF  RPH+VAF
Sbjct  68   QPSYSGLSGVDLFMADVKALEAYAAYFYCLSKMWSRPLPEVYDSQAVADYFNCRPHVVAF  127

Query  526  RLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSL  705
            RLLEVF+AF  A I  +        +     E S   FG VLKETML LGPTFIKVGQSL
Sbjct  128  RLLEVFSAFMVAAIRLRT----SASDKSKSLEASEQNFGMVLKETMLHLGPTFIKVGQSL  183

Query  706  STRPDIIGSEISK  744
            STRPDIIG+EISK
Sbjct  184  STRPDIIGTEISK  196



>ref|XP_006293689.1| hypothetical protein CARUB_v10022647mg [Capsella rubella]
 gb|EOA26587.1| hypothetical protein CARUB_v10022647mg [Capsella rubella]
Length=821

 Score =   238 bits (608),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 142/199 (71%), Gaps = 6/199 (3%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
             L +  +VVR D ++LK  I  GLRWANEAFR+P+V+KS  ++ WLR++ED +AS    K
Sbjct  45   GLGHFADVVRNDVDYLKNKIGVGLRWANEAFRVPEVTKSAEELFWLRHLEDHHASKNVEK  104

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
                WPQPSY  LSG+DLFMAD++ALEAY+ YFYCL K+W+ PLPE YD Q VADYF  R
Sbjct  105  QA--WPQPSYSGLSGVDLFMADVKALEAYAGYFYCLSKMWSRPLPEVYDSQAVADYFNCR  162

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            PH+VAFRLLEVF+AF  A I  +        N E   +     FG VLKETML LGPTFI
Sbjct  163  PHVVAFRLLEVFSAFMIAAIRLRSSASDKGKNLEASEQN----FGMVLKETMLRLGPTFI  218

Query  688  KVGQSLSTRPDIIGSEISK  744
            KVGQSLSTRPDIIG+E SK
Sbjct  219  KVGQSLSTRPDIIGTETSK  237



>ref|XP_008381980.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Malus domestica]
Length=839

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 159/205 (78%), Gaps = 9/205 (4%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   ++ +VVRKD EFLK+GI +G+ WAN+AFRIP+VSK+V DVVWLRN+EDP+A  +  
Sbjct  47   GDFGHLGQVVRKDVEFLKRGIGRGIEWANKAFRIPEVSKAVDDVVWLRNLEDPDAPPSPA  106

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
             S     QP+YPELSG+DL MADL+ALE Y+ YFY L K+W+ PLPE YDP+ VA+YF+ 
Sbjct  107  PSWP---QPAYPELSGVDLLMADLKALETYALYFYYLSKIWSKPLPEVYDPESVAEYFRC  163

Query  505  RPHIVAFRLLEVFTAFASATI-----IFQIFGILPTMNTEIDRETSRYVFGCVLKETMLS  669
            RPH+VA RLLEVF++FASA I      F+ F  L + + +I+   S+Y FG VLKETMLS
Sbjct  164  RPHVVALRLLEVFSSFASAAIRIRTAXFRKFLRLSS-DVDINENISQYNFGMVLKETMLS  222

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTFIKVGQSLSTRPDIIG+E++K
Sbjct  223  LGPTFIKVGQSLSTRPDIIGAEMAK  247



>ref|NP_565900.1| ATH subfamily protein ATH8 [Arabidopsis thaliana]
 gb|AAC28988.2| putative ABC transporter; alternative splicing isoform gene prediction 
data combined with cDNA alignment data to generate 
this model [Arabidopsis thaliana]
 gb|AEC09644.1| ATH subfamily protein ATH8 [Arabidopsis thaliana]
Length=814

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
             L +  +VVR D +FLK  I  GLRWANEAFR+P+V+KS  ++ WLR++ED   ++  LK
Sbjct  42   GLGHFADVVRNDVDFLKNKIGIGLRWANEAFRVPEVTKSAEELFWLRHLED--HTSQNLK  99

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
            S++ WPQPSY  L+G+DLFMAD++ALE Y+ YFY L K+W+ PLPE YD Q VADYF  R
Sbjct  100  SQS-WPQPSYSGLTGVDLFMADVKALETYAGYFYSLSKMWSRPLPEVYDSQAVADYFNCR  158

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            PH+VAFRLLEVF+AF  A I  +    +   +     E S  +FG VLKETML LGPTFI
Sbjct  159  PHVVAFRLLEVFSAFTIAAIRLRTSASVKGKSL----EASEQIFGMVLKETMLHLGPTFI  214

Query  688  KVGQSLSTRPDIIGSEISK  744
            KVGQSLSTRPDIIG+EISK
Sbjct  215  KVGQSLSTRPDIIGTEISK  233



>ref|XP_010517256.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Camelina sativa]
 ref|XP_010517257.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Camelina sativa]
Length=818

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 140/199 (70%), Gaps = 6/199 (3%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
             L +  +VVR D +FLK  I  GLRWANEAFR+P+V+KS  ++ WLR++ED  AS    K
Sbjct  45   GLGHFTDVVRSDFDFLKNKIGIGLRWANEAFRVPEVTKSAEELFWLRHLEDHRASTNSEK  104

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
                WPQPSY  LSG+DLFMAD++ALEAY+ YFYCL K+W+ PLPE YD Q VADYF  R
Sbjct  105  QA--WPQPSYSGLSGVDLFMADVKALEAYAGYFYCLSKMWSKPLPEVYDSQAVADYFNCR  162

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            PH+VA RLLEVF+A   A I  +        N E   +     FG VLKETML LGPTFI
Sbjct  163  PHVVALRLLEVFSAVTIAAIRVRTSASDKGKNLEASEQN----FGMVLKETMLRLGPTFI  218

Query  688  KVGQSLSTRPDIIGSEISK  744
            KVGQSLSTRPDIIG+EISK
Sbjct  219  KVGQSLSTRPDIIGTEISK  237



>ref|XP_006411144.1| hypothetical protein EUTSA_v10016257mg [Eutrema salsugineum]
 gb|ESQ52597.1| hypothetical protein EUTSA_v10016257mg [Eutrema salsugineum]
Length=817

 Score =   237 bits (604),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 144/200 (72%), Gaps = 7/200 (4%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
             L +V +VVR D EFLK  I  G+RWANEAFR+P+V+KS  ++ WLR++EDP +   E +
Sbjct  45   GLGHVADVVRNDVEFLKNKIGIGIRWANEAFRVPEVTKSAEELFWLRHLEDPASPPLEPR  104

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
            S   WPQP Y  L+G+DLFMAD++ALEAY+ Y Y L K+W+ PLPE YDPQ VADYF  R
Sbjct  105  S---WPQPEYAGLTGVDLFMADVKALEAYAGYIYFLSKMWSRPLPEVYDPQAVADYFNCR  161

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            PH+VAFRLLEVF+AF  A I  +     P     +  E S    G VLKETML LGPTFI
Sbjct  162  PHVVAFRLLEVFSAFMIAAIRLRTSA--PDKGKNL--EASGQNIGMVLKETMLHLGPTFI  217

Query  688  KVGQSLSTRPDIIGSEISKK  747
            KVGQSLSTRPDIIG+EISK+
Sbjct  218  KVGQSLSTRPDIIGTEISKE  237



>ref|XP_004307396.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Fragaria vesca subsp. vesca]
Length=832

 Score =   236 bits (601),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 145/207 (70%), Gaps = 13/207 (6%)
 Frame = +1

Query  136  GHGGALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASA  315
            GH G      + V KD EFLK+ I  G  WAN+  RIP+V K++ DVVWLRN+E+P A  
Sbjct  42   GHFG------QAVSKDVEFLKRRIGGGFEWANKTLRIPEVFKAIDDVVWLRNLEEPYAPP  95

Query  316  AELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADY  495
                   RWP+PSYPE +G+DL +ADL+ALE Y+ YFY L K W+ PLPE YDPQ VADY
Sbjct  96   L---PEARWPRPSYPEFTGVDLLVADLKALETYALYFYYLSKSWSKPLPEVYDPQRVADY  152

Query  496  FKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTE----IDRETSRYVFGCVLKETM  663
            F  RPH+V FRLLEV ++FASA I  +  GI   + +     ID   S+Y FG VLKETM
Sbjct  153  FSCRPHVVTFRLLEVVSSFASAAIRIRTSGIKNYLRSSSGDAIDEGLSQYNFGMVLKETM  212

Query  664  LSLGPTFIKVGQSLSTRPDIIGSEISK  744
            L+LGPTFIKVGQSLSTRPDIIG+EI++
Sbjct  213  LNLGPTFIKVGQSLSTRPDIIGAEIAQ  239



>ref|XP_009333709.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Pyrus x bretschneideri]
Length=839

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 155/204 (76%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   ++ +VVRKD EFLK GI +G+ WA +AFRIP+VSK+V DVVWLRN+EDP+A  +  
Sbjct  47   GDFGHLGQVVRKDLEFLKTGIGRGIEWAYKAFRIPEVSKAVDDVVWLRNLEDPDAPPSPA  106

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
             S     QP+YPELSG+DL +ADL+ALE Y+ YFY L K+W+ PLPE YDP+ VA+YF  
Sbjct  107  PSWP---QPAYPELSGVDLLVADLKALETYALYFYYLSKIWSKPLPEVYDPESVAEYFSC  163

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTM----NTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VA RLLEVF++FASA I  +  GI   +    + +I+   S+Y FG VLKETMLSL
Sbjct  164  RPHVVALRLLEVFSSFASAAIRIRTTGIKKFLRLSSDVDINENISQYNFGMVLKETMLSL  223

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG+E++K
Sbjct  224  GPTFIKVGQSLSTRPDIIGAEMAK  247



>emb|CDY14403.1| BnaC03g21920D [Brassica napus]
Length=822

 Score =   231 bits (589),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 146/209 (70%), Gaps = 14/209 (7%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
            +L +V +VVR D EFLK  I  G++WAN AFR+P+V+KS  +V WLR++ED  +   E  
Sbjct  49   SLGHVADVVRNDVEFLKNKIGIGIKWANVAFRVPEVTKSAEEVFWLRHLEDSASPPLEQP  108

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
            S    PQPSY  L+G+DL MAD++ALEAY+ Y YCL K+W+ PLPE YDPQ VADYF  R
Sbjct  109  S---LPQPSYSGLTGVDLLMADVKALEAYAGYIYCLSKMWSRPLPEVYDPQAVADYFNCR  165

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR----ETSRYVFGCVLKETMLSLG  675
            PH+VAFRLLEVF+AF  A I  +        ++E D+    E S   FG VLKETML LG
Sbjct  166  PHVVAFRLLEVFSAFMVAVIRLRT-------SSESDKGKKLEASGQKFGMVLKETMLHLG  218

Query  676  PTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            PTFIKVGQSLSTRPD+IG+E +K  +  Q
Sbjct  219  PTFIKVGQSLSTRPDLIGTETAKALSELQ  247



>ref|XP_010253633.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Nelumbo nucifera]
Length=831

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 153/207 (74%), Gaps = 7/207 (3%)
 Frame = +1

Query  136  GHGGALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASA  315
            G  G   ++ +VVRKD EFLKKG  +G+ WA++A  +PQ+SK+V D +WL  +E P+AS 
Sbjct  35   GFIGNFSHLAQVVRKDVEFLKKGFNQGVSWASDALHLPQLSKTVDDFIWLHYLEVPDASP  94

Query  316  AELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADY  495
                S     QPSYP LSG+DL MADL+ALEAY+NYFY L K+W+ PLPE YDPQEV DY
Sbjct  95   EPPPSWP---QPSYPGLSGMDLVMADLKALEAYTNYFYHLFKIWSRPLPEIYDPQEVTDY  151

Query  496  FKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRE----TSRYVFGCVLKETM  663
            F  RPH+VA RL+EVF++FASA I  +I GIL     ++D++    TS Y FG VLKET+
Sbjct  152  FSCRPHLVALRLVEVFSSFASAAIKLRISGILKFNRWDVDKDGNDNTSEYYFGRVLKETL  211

Query  664  LSLGPTFIKVGQSLSTRPDIIGSEISK  744
            L+LGPTFIKVGQSLSTRPDIIG EI+K
Sbjct  212  LNLGPTFIKVGQSLSTRPDIIGPEITK  238



>ref|XP_007009802.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007009804.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18612.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18614.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=845

 Score =   230 bits (587),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  + VR+D EFLKKG+ +G  WA+E FR+PQV K++ DVVWLRN+EDP+ S    
Sbjct  50   GNFSHFGDAVRRDVEFLKKGVKRGAEWASETFRVPQVKKALDDVVWLRNLEDPHFSPPAQ  109

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
                   QP YPELSGLDL MADL+ALEAY +Y+Y   K W+ PLPE Y+ +EV DYF  
Sbjct  110  PPPWP--QPYYPELSGLDLMMADLKALEAYVSYYYYQSKKWSKPLPEAYNAEEVVDYFSR  167

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGI----LPTMNTEIDRETSRYVFGCVLKETMLSL  672
            RPH+VAFRLLEVF++FASA I  ++ GI     P     ID   ++Y FG VLKETMLSL
Sbjct  168  RPHVVAFRLLEVFSSFASAAIRIRMSGIKKSLRPGSAKGIDENFAQYNFGMVLKETMLSL  227

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIG EISK
Sbjct  228  GPTFIKVGQSLSTRPDIIGPEISK  251



>ref|XP_009133346.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Brassica rapa]
 emb|CDY07670.1| BnaA03g18410D [Brassica napus]
Length=822

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 144/203 (71%), Gaps = 14/203 (7%)
 Frame = +1

Query  148  ALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELK  327
            +L +V +VVR D EFLK  I  G++WAN AFR+P+V+KS  +V WLR++ED  +   E  
Sbjct  49   SLGHVADVVRNDVEFLKNKIGIGIKWANVAFRVPEVTKSAEEVFWLRHLEDSASPPLEQP  108

Query  328  SRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
            S    PQPSY  L+G+DL MAD++ALEAY+ Y YCL K+W+ PLPE YDPQ VADYF  R
Sbjct  109  S---LPQPSYSGLTGVDLLMADVKALEAYAGYIYCLSKMWSRPLPEVYDPQAVADYFNCR  165

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR----ETSRYVFGCVLKETMLSLG  675
            PH+VAFRLLEVF+AF  A I  +        ++E D+    E S   FG VLKETML LG
Sbjct  166  PHVVAFRLLEVFSAFMVAAIRLRT-------SSESDKGKKLEASGQKFGMVLKETMLHLG  218

Query  676  PTFIKVGQSLSTRPDIIGSEISK  744
            PTFIKVGQSLSTRPD+IG+E +K
Sbjct  219  PTFIKVGQSLSTRPDLIGTETAK  241



>gb|KHN00834.1| Hypothetical protein glysoja_000502 [Glycine soja]
Length=823

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 146/205 (71%), Gaps = 9/205 (4%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   ++ +VVRKD EFLK+GI  G+ WANE FRIP+ +K + DVVWLRN+EDP++     
Sbjct  31   GDFSHLAQVVRKDMEFLKRGIDNGVAWANETFRIPEAAKKIDDVVWLRNLEDPHSPPLPS  90

Query  325  KSRTR-WPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
             S  + W    YP LSG+DL M DL ALEAY++YFY L KLW+ PLP+ YDPQEV+ YF 
Sbjct  91   PSWPQPW----YPGLSGVDLLMYDLEALEAYASYFYYLSKLWSRPLPQAYDPQEVSQYFS  146

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGILPTM----NTEIDRETSRYVFGCVLKETMLS  669
            +RPH+V  R+LEV  +FA+A I  +  G    +      ++D  +S+Y FG VLKET+L+
Sbjct  147  VRPHVVTLRVLEVLFSFATAMISIRTSGFRKFLRLIPEEDVDDASSQYNFGMVLKETLLN  206

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTFIKVGQSLSTRPDIIG E+SK
Sbjct  207  LGPTFIKVGQSLSTRPDIIGVEMSK  231



>ref|XP_010670015.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=817

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 146/204 (72%), Gaps = 7/204 (3%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   ++   V+KD EFLK  I+K +   NE   + ++ K+V D VWLRN+EDPN+  ++ 
Sbjct  43   GNFGHMFGAVKKDWEFLKNKISKSVELVNENSHVSKILKNVDDTVWLRNLEDPNSPPSQP  102

Query  325  KSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKL  504
             S   WPQPSYP LSG+DL  ADL+AL  Y +YFY + K W+ PLPE YD + V++YF  
Sbjct  103  IS---WPQPSYPALSGMDLLTADLQALAVYGSYFYSMSKTWSRPLPEIYDAEVVSNYFNC  159

Query  505  RPHIVAFRLLEVFTAFASATIIFQIFGILPTMN--TEIDRET--SRYVFGCVLKETMLSL  672
            RPHI+AFRLLEVFTAF+SA I  +   I   +N  +++D+ T  S+Y FG +LKETML+L
Sbjct  160  RPHIIAFRLLEVFTAFSSAVIKIRASRIRGFINSRSDVDKNTNSSQYEFGKILKETMLNL  219

Query  673  GPTFIKVGQSLSTRPDIIGSEISK  744
            GPTFIKVGQSLSTRPDIIGSEISK
Sbjct  220  GPTFIKVGQSLSTRPDIIGSEISK  243



>ref|XP_003556229.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
Length=823

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 146/205 (71%), Gaps = 9/205 (4%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   ++ +VVRKD EFLK+GI  G+ WANE FRIP+ +K + DVVWLRN+EDP++     
Sbjct  31   GDFSHLAQVVRKDMEFLKRGIDNGVAWANETFRIPEAAKKIDDVVWLRNLEDPHSPPLPS  90

Query  325  KSRTR-WPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
             S  + W    YP LSG+DL M DL ALEAY++YFY L KLW+ PLP+ YDPQEV+ YF 
Sbjct  91   PSWPQPW----YPGLSGVDLLMYDLEALEAYASYFYYLSKLWSRPLPQAYDPQEVSQYFS  146

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGILPTM----NTEIDRETSRYVFGCVLKETMLS  669
            +RPH+V  R+LEV  +FA+A I  +  G    +      ++D  +S+Y FG VLKET+L+
Sbjct  147  VRPHVVTLRVLEVLFSFATAMISIRTSGFRKFLRLIPEEDVDDASSQYNFGMVLKETLLN  206

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTFIKVGQSLSTRPDIIG E+SK
Sbjct  207  LGPTFIKVGQSLSTRPDIIGVEMSK  231



>ref|XP_003536357.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Glycine max]
Length=825

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 143/199 (72%), Gaps = 11/199 (6%)
 Frame = +1

Query  166  EVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWP  345
            +VVRKD EFLK+GI  G+ WA E FRIP+V+K + DVVWLRN+EDP +      S     
Sbjct  40   QVVRKDVEFLKRGIDNGVAWAKETFRIPEVAKKIDDVVWLRNLEDPTSPPLPSPSWP---  96

Query  346  QPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAF  525
            QP YP L+G+DL M DL+A EAY++YFY   KLWT PLP+ YDPQ+VA YF +RPH+V  
Sbjct  97   QPCYPGLTGVDLLMYDLKAFEAYASYFYYFSKLWTRPLPQDYDPQQVAQYFSVRPHLVTL  156

Query  526  RLLEVFTAFASATIIFQIFG------ILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFI  687
            R+LEV  +FA+A I  +  G      ++P    ++D  +S+Y FG VLKET+L+LGPTFI
Sbjct  157  RVLEVLFSFATAMISIRTSGFSKFLRLIP--EEDVDDTSSQYNFGMVLKETLLNLGPTFI  214

Query  688  KVGQSLSTRPDIIGSEISK  744
            KVGQSLSTRPDIIG E+SK
Sbjct  215  KVGQSLSTRPDIIGVEMSK  233



>ref|XP_007143695.1| hypothetical protein PHAVU_007G093900g [Phaseolus vulgaris]
 gb|ESW15689.1| hypothetical protein PHAVU_007G093900g [Phaseolus vulgaris]
Length=826

 Score =   217 bits (552),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 146/205 (71%), Gaps = 9/205 (4%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G   +  +VVRKD EFLK+GI  G+ WAN  FRIPQV+K + +VVWLR++EDP++  +  
Sbjct  34   GDFSHFAQVVRKDVEFLKRGIDDGVAWANHTFRIPQVAKKIDEVVWLRHLEDPHSPPSPS  93

Query  325  KSRTR-WPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
             S  + W    YP L+ +DL M DL+ALEAY++YFY L K+W+ PLPE YDP++VA YF 
Sbjct  94   PSWPQPW----YPGLTAVDLLMYDLKALEAYASYFYYLSKVWSKPLPEVYDPEDVAQYFS  149

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGILPTM----NTEIDRETSRYVFGCVLKETMLS  669
            +RPH+V FR+LEV  + A+A I  +  G    +      ++D  +S+Y FG VLKET+L+
Sbjct  150  VRPHVVTFRVLEVLFSLATAMISIRTSGFKKFLRLVPQEDLDDTSSQYNFGMVLKETLLN  209

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTFIKVGQSLSTRPDIIG E+SK
Sbjct  210  LGPTFIKVGQSLSTRPDIIGVEMSK  234



>ref|XP_006589432.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Glycine max]
Length=827

 Score =   216 bits (551),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 144/201 (72%), Gaps = 13/201 (6%)
 Frame = +1

Query  166  EVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWP  345
            +VVRKD EFLK+GI  G+ WA E FRIP+V+K + DVVWLRN+EDP +      S     
Sbjct  40   QVVRKDVEFLKRGIDNGVAWAKETFRIPEVAKKIDDVVWLRNLEDPTSPPLPSPSWP---  96

Query  346  QPSYPE--LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIV  519
            QP YP+  L+G+DL M DL+A EAY++YFY   KLWT PLP+ YDPQ+VA YF +RPH+V
Sbjct  97   QPCYPDAGLTGVDLLMYDLKAFEAYASYFYYFSKLWTRPLPQDYDPQQVAQYFSVRPHLV  156

Query  520  AFRLLEVFTAFASATIIFQIFG------ILPTMNTEIDRETSRYVFGCVLKETMLSLGPT  681
              R+LEV  +FA+A I  +  G      ++P    ++D  +S+Y FG VLKET+L+LGPT
Sbjct  157  TLRVLEVLFSFATAMISIRTSGFSKFLRLIP--EEDVDDTSSQYNFGMVLKETLLNLGPT  214

Query  682  FIKVGQSLSTRPDIIGSEISK  744
            FIKVGQSLSTRPDIIG E+SK
Sbjct  215  FIKVGQSLSTRPDIIGVEMSK  235



>gb|EPS60983.1| hypothetical protein M569_13817, partial [Genlisea aurea]
Length=583

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 4/192 (2%)
 Frame = +1

Query  172  VRKDSEFLKKGI-AKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWPQ  348
            + +D  +L+  I  +GL W+  A RIP+V K V D +WLRN+EDP AS+ E  S   WP+
Sbjct  1    LHRDVSYLRSSIVGRGLLWSKTALRIPEVFKLVDDFIWLRNVEDPVASSFEFPS---WPK  57

Query  349  PSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFR  528
            P Y ELSG DLF+ADL AL+ Y+ YFY  +++WT PLP+ YD + V +YF LRPH+VA R
Sbjct  58   PFYSELSGADLFLADLDALKVYAAYFYHRLRMWTKPLPDVYDAELVTEYFILRPHVVAIR  117

Query  529  LLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLS  708
            L+EVFTAF  A I F++  I    + +    TS Y FG +LK+TML LGPTFIK+GQSLS
Sbjct  118  LIEVFTAFVFAIIKFRVSRIGFIGDKDDHGSTSDYYFGMILKDTMLELGPTFIKIGQSLS  177

Query  709  TRPDIIGSEISK  744
            TRPDIIG ++SK
Sbjct  178  TRPDIIGHDVSK  189



>emb|CAN75565.1| hypothetical protein VITISV_032583 [Vitis vinifera]
Length=825

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 135/198 (68%), Gaps = 8/198 (4%)
 Frame = +1

Query  166  EVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWP  345
            EVV KD EFLKK I +G++WAN A RIPQ+SKS+  ++WLR  EDP A++    S   WP
Sbjct  37   EVVXKDMEFLKKRIGRGVQWANGALRIPQLSKSLDRLLWLRMTEDPLAASLPPPS---WP  93

Query  346  QPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAF  525
            QPSYP LSG+DLFMADL+ALE Y++YFY L KLW+ PLPE YDP EVADYF  RPHIVA 
Sbjct  94   QPSYPGLSGVDLFMADLKALETYASYFYHLSKLWSKPLPEVYDPLEVADYFNRRPHIVAL  153

Query  526  RLLEVFTAFASATIIFQIFGIL----PTMNTEIDRETSRYVFGCVLKETMLSLGPTFIK-  690
            RLLEVF++FA A I  +  GI       M+ +I+   S Y FG        S  P     
Sbjct  154  RLLEVFSSFAFAAIRIRTSGITMFYGSNMDRDINGNISPYNFGMSQDYKYASYMPLLADA  213

Query  691  VGQSLSTRPDIIGSEISK  744
            VGQS+STRPDIIG EISK
Sbjct  214  VGQSISTRPDIIGPEISK  231



>ref|XP_009602168.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana tomentosiformis]
Length=469

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +1

Query  361  ELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEV  540
            ELSG+DLF+AD+ ALEAY NYFYC+ K  T PLPE YDP++V++YF LRPH+VA RLLEV
Sbjct  12   ELSGMDLFVADIEALEAYLNYFYCISKRLTRPLPETYDPEQVSEYFNLRPHVVALRLLEV  71

Query  541  FTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPD  720
            F AF SA I  +I G+LPT + ++++ETS Y+FG VLKETML+LGPTFIK+GQSLSTRPD
Sbjct  72   FVAFTSAAIQIRISGLLPTSSKDVEKETSNYIFGKVLKETMLNLGPTFIKIGQSLSTRPD  131

Query  721  IIGSEISK  744
            IIG++ISK
Sbjct  132  IIGADISK  139



>ref|XP_010099629.1| Uncharacterized protein L484_013421 [Morus notabilis]
 gb|EXB80095.1| Uncharacterized protein L484_013421 [Morus notabilis]
Length=829

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 131/195 (67%), Gaps = 10/195 (5%)
 Frame = +1

Query  181  DSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSRTRWPQPSYP  360
            D EF+K GI KGL WAN+AFRIPQVSK++ + VWLRN+EDPNAS     S     QPSYP
Sbjct  44   DMEFVKNGIGKGLEWANKAFRIPQVSKAIDEFVWLRNMEDPNASPQPSPSWP---QPSYP  100

Query  361  ELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEV  540
             LSG+DLFMADL+ALEAY  YFY L K W+ PLPE YD Q VADYF  RPH+VAFRLLEV
Sbjct  101  GLSGVDLFMADLKALEAYGAYFYYLSKTWSKPLPEVYDAQRVADYFNCRPHVVAFRLLEV  160

Query  541  FTAFASATIIFQIFG------ILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIK-VGQ  699
            F++FA+ATI  +         +  + + +I+   S Y FG        S        VGQ
Sbjct  161  FSSFAAATIRIRTSDSRLRKFLRSSGDNDINGGLSEYNFGVSQDYQYASYMRLLADAVGQ  220

Query  700  SLSTRPDIIGSEISK  744
            SLSTRPDIIGSEISK
Sbjct  221  SLSTRPDIIGSEISK  235



>ref|XP_002533250.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
 gb|EEF29135.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
Length=791

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            L+G+DLFMADL+ALEAY++YFY L KLW+ PLPE YDPQ+VADYF  RPH+VA RLLEVF
Sbjct  66   LTGMDLFMADLKALEAYASYFYYLSKLWSKPLPEVYDPQDVADYFSCRPHVVALRLLEVF  125

Query  544  TAFASATIIFQIFG----ILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLST  711
            +AFASATI  +  G    + P  + +++   S+Y FG VLKETML+LGPTFIKVGQSLST
Sbjct  126  SAFASATIRIRASGMRKFLQPNSDRDVNGNISQYNFGVVLKETMLNLGPTFIKVGQSLST  185

Query  712  RPDIIGSEISK  744
            RPDIIG+EISK
Sbjct  186  RPDIIGTEISK  196



>ref|XP_008807297.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized aarF domain-containing 
protein kinase At1g79600, chloroplastic-like [Phoenix 
dactylifera]
Length=809

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 131/205 (64%), Gaps = 19/205 (9%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G + +V+ VVR+D EFL +             R   VSK++ D+ WLRN+EDP A  A  
Sbjct  29   GVMGHVLRVVRRDREFLTR-------------RFRSVSKALGDIFWLRNLEDPRALHAS-  74

Query  325  KSRTRWPQPSYPE-LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
            +    WP+ S+P  L G+DL MADL AL+ Y+ Y     ++W+ PLP+ YDPQ+V+DYF 
Sbjct  75   RPPAHWPKISHPPGLWGVDLMMADLEALKVYAGYIQLASRIWSVPLPDLYDPQKVSDYFN  134

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRE----TSRYVFGCVLKETMLS  669
             RPH++AFR++EV ++FA   +  Q+          + R+    TS+Y  G +LKE+ L+
Sbjct  135  CRPHVLAFRIIEVVSSFALVALKMQMSRSFSLSRHGVSRDDSLYTSQYYIGLLLKESFLN  194

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTF+KVGQSLSTRPDIIGSEISK
Sbjct  195  LGPTFVKVGQSLSTRPDIIGSEISK  219



>ref|XP_010906485.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Elaeis guineensis]
Length=809

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 130/205 (63%), Gaps = 19/205 (9%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G +  V+ V R+D EFL +             R   VSK++ D+ WLRN+EDP A  A  
Sbjct  29   GVMRQVLRVGRRDREFLNR-------------RFQFVSKALGDLFWLRNLEDPRALHAS-  74

Query  325  KSRTRWPQPSYPE-LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
            +    W + S+P  L G+DL MADL AL+ Y++Y      LW+ PLP+ YDPQ+V+DYF 
Sbjct  75   RPPAHWSKISHPPGLWGVDLMMADLEALKVYADYIQLASGLWSVPLPDLYDPQKVSDYFN  134

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRE----TSRYVFGCVLKETMLS  669
             RPH++AFR++EV ++FA A I  Q+         ++ R+    TS+Y  G +LKE+ L+
Sbjct  135  CRPHVLAFRIIEVISSFAFAAIKMQMSRSFNLRRHDVSRDDSLYTSQYYIGLLLKESFLN  194

Query  670  LGPTFIKVGQSLSTRPDIIGSEISK  744
            LGPTF+KVGQSLSTRPDIIGSEISK
Sbjct  195  LGPTFVKVGQSLSTRPDIIGSEISK  219



>ref|XP_009392279.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Musa acuminata subsp. malaccensis]
Length=801

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 129/207 (62%), Gaps = 23/207 (11%)
 Frame = +1

Query  145  GALDNVVEVVRKDSEFLKKGIAKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAEL  324
            G + N++ V+R D +FL++             R+  +S ++ +++WLRN+EDP A     
Sbjct  30   GGMGNMLRVLRNDRDFLRE-------------RLRPLSNALGNLLWLRNLEDPRAKDV-C  75

Query  325  KSRTRWPQPSYPE-LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFK  501
            +    WP+ S+P  LSGLDL MAD  AL+ Y+N+     K+   PLPE YDP++V  YF 
Sbjct  76   RPPATWPKISHPPGLSGLDLMMADFEALKVYANHLQDTCKVLFMPLPEIYDPEKVELYFS  135

Query  502  LRPHIVAFRLLEVFTAFASATIIFQIFGI------LPTMNTEIDRETSRYVFGCVLKETM  663
             RPHI+AFR+ EVF +FASA I  Q   I         +N   D   SRY  G ++KE++
Sbjct  136  CRPHILAFRITEVFLSFASAAIKLQASKISNLNKHRANLNDGFD--GSRYHIGQIVKESL  193

Query  664  LSLGPTFIKVGQSLSTRPDIIGSEISK  744
            L+LGPTF+KVGQSLSTRPDIIGS+ISK
Sbjct  194  LNLGPTFVKVGQSLSTRPDIIGSDISK  220



>ref|XP_006854489.1| hypothetical protein AMTR_s00175p00037000 [Amborella trichopoda]
 gb|ERN15956.1| hypothetical protein AMTR_s00175p00037000 [Amborella trichopoda]
Length=779

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 122/203 (60%), Gaps = 12/203 (6%)
 Frame = +1

Query  160  VVEVVRKDSEFLKKGI--AKGLRWANEAFRIPQVSKSVSDVVWLRNIEDPNASAAELKSR  333
            ++++++ D++ LKKG+               P +   V D +WLRN EDP+  A      
Sbjct  1    MLQIIKNDAQCLKKGLDLVASKLPLPNPNPNPNLLNHVEDAIWLRNFEDPSLKAPLPPLL  60

Query  334  TR--WPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLR  507
                W    Y  L+GL+L +ADL+AL  Y++Y     ++W  PLPE YDP+ VADYF  R
Sbjct  61   WPQPW----YSGLTGLELLLADLKALGEYADYLRHASRIWHIPLPETYDPELVADYFSCR  116

Query  508  PHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEID----RETSRYVFGCVLKETMLSLG  675
             H++ FR++EVF +FASA I  +   I  +  + ++    R  S+Y  G +LKE ML+LG
Sbjct  117  LHVLIFRVIEVFFSFASAAIKMRTSAIFKSRGSRMEPNDGRNQSQYYMGTLLKEAMLNLG  176

Query  676  PTFIKVGQSLSTRPDIIGSEISK  744
            PTF+KVGQSLSTRPDIIGSEI K
Sbjct  177  PTFVKVGQSLSTRPDIIGSEICK  199



>gb|KHN17125.1| Hypothetical protein glysoja_011599 [Glycine soja]
Length=716

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 8/126 (6%)
 Frame = +1

Query  385  MADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASAT  564
            M+DL+A EAY++YFY   KLWT PLP+ YDPQ+VA YF +RPH+V  R+LEV  +FA+A 
Sbjct  1    MSDLKAFEAYASYFYYFSKLWTRPLPQDYDPQQVAQYFSVRPHLVTLRVLEVLFSFATAM  60

Query  565  IIFQIFG------ILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            I  +  G      ++P    ++D  +S+Y FG VLKET+L+LGPTFIKVGQSLSTRPDII
Sbjct  61   ISIRTSGFSKFLRLIP--EEDVDDTSSQYNFGMVLKETLLNLGPTFIKVGQSLSTRPDII  118

Query  727  GSEISK  744
            G E+SK
Sbjct  119  GVEMSK  124



>ref|XP_001774983.1| predicted protein [Physcomitrella patens]
 gb|EDQ60249.1| predicted protein [Physcomitrella patens]
Length=790

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 104/176 (59%), Gaps = 18/176 (10%)
 Frame = +1

Query  247  PQVSKSVSDVVWLRNIEDPNASAAELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYF  426
            P  SK V ++V LR IED NA+   L     WPQP YPEL G DL +AD + LE+YS+Y 
Sbjct  24   PLFSKKVGEIVALRIIEDENATPGALGF---WPQPYYPELRGKDLLIADFKTLESYSSYI  80

Query  427  YCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATI----------IFQ  576
              +++ +  PL   YDP +VA YF  RPH++ +RLLEV  AF S  +            +
Sbjct  81   QSVLQNFQVPLQTNYDPDQVAAYFHRRPHVLLYRLLEVGVAFGSVALERGVRMSTLKKNK  140

Query  577  IFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISK  744
            + GI    NTE+  +T+       LK+ +L LG TFIKV QSLS RPD+IG+E +K
Sbjct  141  LGGISEKDNTEVTLKTA-----VSLKQALLGLGSTFIKVAQSLSARPDLIGTETAK  191



>gb|KDO48422.1| hypothetical protein CISIN_1g0041462mg, partial [Citrus sinensis]
Length=143

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 11/103 (11%)
 Frame = +1

Query  253  VSKSVSDVVWLRNIEDPNASAAELKSRTRWPQPSYPEL--------SGLDLFMADLRALE  408
            VSK++ DV+WLRN+EDP A  AEL+    WPQPSYP L        +G DL MADL+ALE
Sbjct  44   VSKTLDDVLWLRNLEDPRA--AELEP-CDWPQPSYPGLIWLILIGLTGADLLMADLKALE  100

Query  409  AYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLE  537
            AY+NYFY ++K+W+ PLPE Y+PQ+VADYF  RPHIV  RLLE
Sbjct  101  AYANYFYHMLKIWSKPLPEVYNPQDVADYFNCRPHIVGLRLLE  143



>ref|XP_010235940.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Brachypodium distachyon]
Length=941

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 12/142 (8%)
 Frame = +1

Query  340  WPQPSYPE-LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHI  516
            +P  SYP  LS ++L MADL AL+ Y +Y+Y ++   T PLP+ YDP  +A YF  RPHI
Sbjct  201  FPPHSYPPGLSCMELMMADLAALKLYISYYYAIL---TTPLPQHYDPDLLAQYFVSRPHI  257

Query  517  VAFRLLEVFTAFASATIIFQIFGIL-----PTMNTEIDRE---TSRYVFGCVLKETMLSL  672
            +AFR +++  AF SA +  QI   +      T  + I  E    S+Y+ G +LK+T L L
Sbjct  258  LAFRTVQILLAFVSAAVKVQISKRMNLTTDATYRSSISNEGFNASQYMVGQLLKDTFLDL  317

Query  673  GPTFIKVGQSLSTRPDIIGSEI  738
            GPTF+KVGQSLSTRPDIIGSEI
Sbjct  318  GPTFVKVGQSLSTRPDIIGSEI  339



>ref|XP_001760646.1| predicted protein [Physcomitrella patens]
 gb|EDQ74385.1| predicted protein [Physcomitrella patens]
Length=855

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 113/207 (55%), Gaps = 19/207 (9%)
 Frame = +1

Query  160  VVEVVRKDSEFLKKGIAKGLRWANEAFRI-PQVSKSVSDVVWLRNIEDPNASAAELKSRT  336
            V  +V  D +F+K          +++ R+ P + K + ++V L+ IED N+  A      
Sbjct  68   VANIVANDIDFIK----------SKSTRVRPSLRKKIGEIVALKIIEDENSVPA---GPA  114

Query  337  RWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHI  516
             WP+P YPEL G DL  ADLR LE+YS++   + + +  PL  +YDP +VA YF  RPH+
Sbjct  115  FWPEPYYPELRGKDLLDADLRTLESYSSFVQGVFQSFKVPLQNEYDPDQVAAYFHRRPHV  174

Query  517  VAFRLLEVFTAFASATIIFQIFGILPTMN-----TEIDRETSRYVFGCVLKETMLSLGPT  681
            +  R LEV  AF S  +   +       N     +E D+          LK+T+L LG T
Sbjct  175  LLLRFLEVGAAFGSVALERNMRMAALKRNKMGEISEADKLKVTLQTAESLKKTLLGLGTT  234

Query  682  FIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            FIKV QSLS+RPD+IG+E +K  +  Q
Sbjct  235  FIKVAQSLSSRPDLIGAETAKVLSELQ  261



>ref|XP_004954281.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Setaria italica]
Length=942

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 11/132 (8%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MADL AL+ Y NY+  ++   T PLP+ YDP  +A YF  RPH++AFR +++ 
Sbjct  210  LSCMELMMADLEALKIYINYYSTIL---TTPLPQHYDPDLLAQYFASRPHVLAFRTIQIL  266

Query  544  TAFASATIIFQIF--------GILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
             AF SA +  QI             + N+  + + S+Y+ G +LKE  L LGPTF+KVGQ
Sbjct  267  FAFVSAVVKMQISKRSQLTAEATYSSGNSSNNFDASQYMVGQLLKEMFLDLGPTFVKVGQ  326

Query  700  SLSTRPDIIGSE  735
            SLSTRPDIIGSE
Sbjct  327  SLSTRPDIIGSE  338



>gb|EEC74196.1| hypothetical protein OsI_09349 [Oryza sativa Indica Group]
Length=961

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 88/136 (65%), Gaps = 12/136 (9%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MAD+ AL+ Y NY+   V + T PLP+ YDP+ ++ YF  RPHI+AFR +++ 
Sbjct  218  LSCMELMMADIEALKLYINYY---VAILTTPLPQHYDPEILSRYFTSRPHILAFRTIQII  274

Query  544  TAFASATIIFQIFG--ILPTMNTEIDRET-------SRYVFGCVLKETMLSLGPTFIKVG  696
             AF SA +  QI     L T  T     T       S+Y+ G +LKET L LGPTF+KVG
Sbjct  275  FAFVSAAVKMQISKRTNLITDATYSGNSTGSKGFNASQYMVGQLLKETFLDLGPTFVKVG  334

Query  697  QSLSTRPDIIGSEISK  744
            QSLSTRPDI GSEIS+
Sbjct  335  QSLSTRPDITGSEISE  350



>dbj|BAG90272.1| unnamed protein product [Oryza sativa Japonica Group]
Length=818

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 87/136 (64%), Gaps = 12/136 (9%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MAD+ AL+ Y NY+   V + T PLP+ YDP+ ++ YF  RPHI+AFR +++ 
Sbjct  75   LSCMELMMADIEALKLYINYY---VAILTTPLPQHYDPEILSRYFTSRPHILAFRTIQII  131

Query  544  TAFASATIIFQI---FGILPTMNTEIDR------ETSRYVFGCVLKETMLSLGPTFIKVG  696
             AF SA +  QI     ++       +         S+Y+ G +LKET L LGPTF+KVG
Sbjct  132  FAFVSAAVKMQISKRTNLITDATYSCNSTGSKGFNASQYMVGQLLKETFLDLGPTFVKVG  191

Query  697  QSLSTRPDIIGSEISK  744
            QSLSTRPDI GSEIS+
Sbjct  192  QSLSTRPDITGSEISE  207



>ref|NP_001048444.2| Os02g0805800 [Oryza sativa Japonica Group]
 dbj|BAD19381.1| putative ubiquinone biosynthesis protein ubiB [Oryza sativa Japonica 
Group]
 dbj|BAD19429.1| putative ubiquinone biosynthesis protein ubiB [Oryza sativa Japonica 
Group]
 gb|EEE58008.1| hypothetical protein OsJ_08784 [Oryza sativa Japonica Group]
 dbj|BAF10358.2| Os02g0805800 [Oryza sativa Japonica Group]
Length=961

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 12/136 (9%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MAD+ AL+ Y NY+   V + T PLP+ YDP+ ++ YF  RPHI+AFR +++ 
Sbjct  218  LSCMELMMADIEALKLYINYY---VAILTTPLPQHYDPEILSRYFTSRPHILAFRTIQII  274

Query  544  TAFASATIIFQI-------FGILPTMNTEIDR--ETSRYVFGCVLKETMLSLGPTFIKVG  696
             AF SA +  QI            + N+   +    S+Y+ G +LKET L LGPTF+KVG
Sbjct  275  FAFVSAAVKMQISKRTNLITDATYSCNSTGSKGFNASQYMVGQLLKETFLDLGPTFVKVG  334

Query  697  QSLSTRPDIIGSEISK  744
            QSLSTRPDI GSEIS+
Sbjct  335  QSLSTRPDITGSEISE  350



>ref|XP_006649145.1| PREDICTED: uncharacterized protein LOC102711509 [Oryza brachyantha]
Length=1229

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 86/136 (63%), Gaps = 12/136 (9%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L  AD+ AL+ Y NY+   V + T PLP+ YDP+ ++ YF  RPHI+AFR +++ 
Sbjct  488  LSCMELMRADVEALKLYINYY---VAILTTPLPQHYDPELLSRYFTSRPHILAFRTIQII  544

Query  544  TAFASATIIFQIFGILPTMNTEIDR---------ETSRYVFGCVLKETMLSLGPTFIKVG  696
             AF S  +  QI      +    +          + S+Y+FG +LKET L LGPTF+KVG
Sbjct  545  FAFVSGAVKMQISKRANLITDATNSGNSIRSKGFDASQYMFGQLLKETFLDLGPTFVKVG  604

Query  697  QSLSTRPDIIGSEISK  744
            QSLSTRPDI GSEIS+
Sbjct  605  QSLSTRPDITGSEISE  620



>gb|AAK98701.1|AC069158_13 Putative ABC transporter [Oryza sativa Japonica Group]
Length=1372

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 12/136 (9%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MAD+ AL+ Y NY+   V + T PLP+ YDP+ ++ YF  RPHI+AFR +++ 
Sbjct  612  LSCMELMMADIEALKLYINYY---VAILTTPLPQHYDPEILSRYFTSRPHILAFRTIQII  668

Query  544  TAFASATIIFQI-------FGILPTMNTEIDR--ETSRYVFGCVLKETMLSLGPTFIKVG  696
             AF SA +  QI            + N+   +    S+Y+ G +LKET L LGPTF+KVG
Sbjct  669  FAFVSAAVKMQISKRTNLITDATYSCNSTGSKGFNASQYMVGQLLKETFLDLGPTFVKVG  728

Query  697  QSLSTRPDIIGSEISK  744
            QSLSTRPDI GSEIS+
Sbjct  729  QSLSTRPDITGSEISE  744



>ref|XP_008644226.1| PREDICTED: uncharacterized protein LOC100502250 isoform X2 [Zea 
mays]
Length=938

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 86/133 (65%), Gaps = 11/133 (8%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MADL AL+ Y NY+  ++   T PLP+ YDP  +A YF  RPHI+A R++++ 
Sbjct  204  LSCMELMMADLEALKLYINYYSAIL---TTPLPQHYDPDLLAQYFASRPHILASRVIQIL  260

Query  544  TAFASATIIFQIF--------GILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
              F SA +  +I             + N+    + ++Y+ G +LKET L+LGPTFIKVGQ
Sbjct  261  FTFLSAVVKMRISKRAQLTTDATYSSGNSGNGFDDTQYMVGQLLKETFLNLGPTFIKVGQ  320

Query  700  SLSTRPDIIGSEI  738
            SLSTRPDIIGSEI
Sbjct  321  SLSTRPDIIGSEI  333



>ref|XP_008644225.1| PREDICTED: uncharacterized protein LOC100502250 isoform X1 [Zea 
mays]
Length=960

 Score =   118 bits (295),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 86/133 (65%), Gaps = 11/133 (8%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MADL AL+ Y NY+  ++   T PLP+ YDP  +A YF  RPHI+A R++++ 
Sbjct  204  LSCMELMMADLEALKLYINYYSAIL---TTPLPQHYDPDLLAQYFASRPHILASRVIQIL  260

Query  544  TAFASATIIFQIF--------GILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
              F SA +  +I             + N+    + ++Y+ G +LKET L+LGPTFIKVGQ
Sbjct  261  FTFLSAVVKMRISKRAQLTTDATYSSGNSGNGFDDTQYMVGQLLKETFLNLGPTFIKVGQ  320

Query  700  SLSTRPDIIGSEI  738
            SLSTRPDIIGSEI
Sbjct  321  SLSTRPDIIGSEI  333



>ref|XP_002454741.1| hypothetical protein SORBIDRAFT_04g036510 [Sorghum bicolor]
 gb|EES07717.1| hypothetical protein SORBIDRAFT_04g036510 [Sorghum bicolor]
Length=763

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = +1

Query  373  LDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAF  552
            ++L MADL AL+ Y NY+  ++   T PLP+ YDP  +A YF  RPHI+A R++++   F
Sbjct  1    MELMMADLEALKLYINYYSAIL---TTPLPQHYDPDLLAQYFASRPHILASRVIQILFTF  57

Query  553  ASATIIFQIF--GILPTMNTEIDRETSR------YVFGCVLKETMLSLGPTFIKVGQSLS  708
             SA    QI+    L T  T     +S+      Y+ G +LKET L+LGPTF+KVGQSLS
Sbjct  58   LSAVAKMQIYKRAQLITDATYSSGSSSKGFNDTQYMLGQLLKETFLNLGPTFVKVGQSLS  117

Query  709  TRPDIIGSEI  738
            TRPDIIGSEI
Sbjct  118  TRPDIIGSEI  127



>gb|EMT28124.1| hypothetical protein F775_28121 [Aegilops tauschii]
Length=857

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 83/135 (61%), Gaps = 11/135 (8%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MAD  AL  Y NYF  ++     PLP+ YDP  +A YF  RPHI+ FR +++ 
Sbjct  151  LSCMELMMADADALNLYVNYFLAIL---NTPLPQHYDPDLLAQYFVSRPHILVFRTVQIL  207

Query  544  TAFASATIIFQIFG-----ILPTMNTEIDRE---TSRYVFGCVLKETMLSLGPTFIKVGQ  699
             AF       Q+F         T ++ +  E    S+Y+ G +LK+T L LGPTFIKVGQ
Sbjct  208  FAFLVGAAKVQMFKKASLTTDATHSSSVSNEGFDASQYMVGQLLKDTFLDLGPTFIKVGQ  267

Query  700  SLSTRPDIIGSEISK  744
            SLSTRPDI+GSEIS+
Sbjct  268  SLSTRPDILGSEISE  282



>dbj|BAJ99480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=951

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 85/135 (63%), Gaps = 11/135 (8%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LS ++L MAD  AL+ Y NYF  ++   + PLP+ YDP  +  YF  RPHI+ FR +++ 
Sbjct  222  LSCMELMMADADALKLYVNYFLAIL---STPLPQHYDPDLLEQYFFSRPHILVFRTVQIL  278

Query  544  TAFASATIIFQIFG-----ILPTMNTEIDRE---TSRYVFGCVLKETMLSLGPTFIKVGQ  699
             AF    +  Q+F         T ++ +  E    S+++ G +LK+T L LGPTFIKVGQ
Sbjct  279  FAFLVGAVKVQMFKRASLTTDATHSSSVSNEGFDASQFMVGQLLKDTFLDLGPTFIKVGQ  338

Query  700  SLSTRPDIIGSEISK  744
            SLSTRPDI+GSEIS+
Sbjct  339  SLSTRPDILGSEISE  353



>gb|KEH16035.1| chorismate synthase [Medicago truncatula]
Length=140

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEV  540
            LSG+DL M DL+ALEAY++YFY L K+W+ PLPE YDPQ+VA YF  RPH+VA R+LE+
Sbjct  30   LSGVDLLMYDLKALEAYASYFYHLSKIWSKPLPETYDPQDVAHYFSARPHVVALRMLEI  88



>ref|XP_010529099.1| PREDICTED: ethylene-responsive transcription factor 12-like, 
partial [Tarenaya hassleriana]
Length=120

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +1

Query  280  WLRNIEDPNASA----AELKSRTRWPQPSYPELSGLDLFMADLRALEAYSNYFYCLVKLW  447
            W   I DP+  A        +    P   +  LSG+DLFMAD++ALEAY+ YF+ L KLW
Sbjct  31   WAAEIRDPHKVARVWLGTFDTTETCPTKIFVGLSGVDLFMADVKALEAYAGYFHYLPKLW  90

Query  448  TGPLPEKYDPQEVADYFKLRPHIVAFRLLE  537
            +  LPE Y+P+ VADYF  RPH+VAFRLLE
Sbjct  91   SRLLPEVYEPEAVADYFSCRPHVVAFRLLE  120



>gb|KDO48423.1| hypothetical protein CISIN_1g0041462mg, partial [Citrus sinensis]
 gb|KDO48424.1| hypothetical protein CISIN_1g0041462mg, partial [Citrus sinensis]
 gb|KDO48425.1| hypothetical protein CISIN_1g0041462mg, partial [Citrus sinensis]
Length=51

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  385  MADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLE  537
            MADL+ALEAY+NYFY ++K+W+ PLPE Y+PQ+VADYF  RPHIV  RLLE
Sbjct  1    MADLKALEAYANYFYHMLKIWSKPLPEVYNPQDVADYFNCRPHIVGLRLLE  51



>ref|XP_002989934.1| hypothetical protein SELMODRAFT_130784, partial [Selaginella 
moellendorffii]
 gb|EFJ08947.1| hypothetical protein SELMODRAFT_130784, partial [Selaginella 
moellendorffii]
Length=694

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 76/133 (57%), Gaps = 7/133 (5%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LSG DL  AD+  +  Y +     + +W  PL E YDP+++A YF  RPH++ FR LEV 
Sbjct  3    LSGWDLVAADIATIRQYFDNVKMQLAIWKLPLQEAYDPEDLAVYFNARPHLLLFRALEVS  62

Query  544  TAFASATIIFQIF--GILPTMNTE--IDRETSRYVFGC--VLKETMLSLGPTFIKVGQSL  705
             AF S   ++ +F   I P    E   + E  + +     + K+T+L LGPTF KV QSL
Sbjct  63   AAF-SYLFVWYMFEKSITPLTKREPSSEEENKKMMMKTAEMFKQTVLRLGPTFTKVAQSL  121

Query  706  STRPDIIGSEISK  744
            STR D+IG E ++
Sbjct  122  STRSDLIGPETAQ  134



>gb|KDO48429.1| hypothetical protein CISIN_1g0041461mg, partial [Citrus sinensis]
Length=382

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  598  MNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISK  744
            +  + D   S+Y FG +LKET+L+LGPTFIKVGQSLSTRPDIIGS+ISK
Sbjct  25   LEKDFDGNISQYNFGMILKETVLNLGPTFIKVGQSLSTRPDIIGSDISK  73



>gb|KDO48427.1| hypothetical protein CISIN_1g0041461mg, partial [Citrus sinensis]
 gb|KDO48428.1| hypothetical protein CISIN_1g0041461mg, partial [Citrus sinensis]
Length=667

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  598  MNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISK  744
            +  + D   S+Y FG +LKET+L+LGPTFIKVGQSLSTRPDIIGS+ISK
Sbjct  25   LEKDFDGNISQYNFGMILKETVLNLGPTFIKVGQSLSTRPDIIGSDISK  73



>ref|XP_010534416.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X3 [Tarenaya hassleriana]
Length=684

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = +1

Query  511  HIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR----ETSRYVFGCVLKETMLSLGP  678
            H + F   ++      A  +  +   L    +E D+    E S   FG VLKET+L+LGP
Sbjct  22   HFLKFMNRKLLQTTLVAGHMLWLLDFLRIQTSESDKGRNVEASGKNFGIVLKETLLNLGP  81

Query  679  TFIKVGQSLSTRPDIIGSEISK  744
            TFIKVGQSLSTRPDIIG+E+SK
Sbjct  82   TFIKVGQSLSTRPDIIGTEVSK  103



>ref|WP_008180667.1| hypothetical protein [Moorea producens]
 gb|EGJ33799.1| putative unusual protein kinase [Moorea producens 3L]
Length=573

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 10/88 (11%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQI--FGILPTMNTEIDRETSRYVFG  642
            YDPQ +A Y++ RP +V +R L +   FAS    F++  +G     N ++ R T      
Sbjct  20   YDPQAIARYYRSRPWVVIWRCLRIVWGFASFVFSFKLDQWGNRTEQN-KLKRATQ-----  73

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+E + +LGPTFIKVGQ+LSTRPD+I
Sbjct  74   --LRELLTNLGPTFIKVGQALSTRPDLI  99



>ref|XP_002295715.1| hypothetical protein THAPS_28865 [Thalassiosira pseudonana CCMP1335]
 gb|ACI64432.1| hypothetical protein THAPS_28865 [Thalassiosira pseudonana CCMP1335]
Length=727

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            LP +YDP  +  +F  RP+++  R+ +V T   +  + F +  +   + ++ D E  R  
Sbjct  67   LPYEYDPIALQKFFSKRPNLIVARIFQVATTGGNVLLNFAMDALTGKLKSDPDLEVRR--  124

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L++T+ SLGP FIK+GQ+LS RPDI+
Sbjct  125  -AAELRDTITSLGPFFIKLGQALSIRPDIL  153



>ref|WP_017294374.1| hypothetical protein [Geminocystis herdmanii]
Length=557

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRET-SRYVFGC  645
            Y+PQ +ADY++ RP +  FR L++        + F IF I  T++    +E  ++     
Sbjct  19   YNPQSIADYYRFRPWLGIFRSLKII-------LYFGIFIIQLTLDKWFHQEQKNKQKRAE  71

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  72   KLRKILTKLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  110



>ref|WP_017309517.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=570

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A +++ RP +   R L +  +FA    IF +   L     ++  E ++     
Sbjct  12   RYDPDEIAKFYRYRPWLAWRRALRIIWSFA----IFILSLKLDEWQNQV--EQNKLKRAT  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  66   QLRELLTRLGPTFIKVGQALSTRPDLIRKDFLEELVKLQ  104



>ref|WP_044451834.1| hypothetical protein, partial [Mastigocladus laminosus]
 gb|KIY11432.1| hypothetical protein SP67_22475, partial [Mastigocladus laminosus 
UU774]
Length=562

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A +++ RP +   R L +  +FA    IF +   L     ++  E ++     
Sbjct  12   RYDPDEIAKFYRYRPWLAWRRALRIIWSFA----IFILSLKLDEWQNQV--EQNKLKRAT  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  66   QLRELLTRLGPTFIKVGQALSTRPDLIRKDFLEELVKLQ  104



>ref|XP_002185748.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65218.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=745

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 53/93 (57%), Gaps = 9/93 (10%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTA---FASATIIFQIFGILPTMNTEIDRETS  627
            LP  Y+PQ + ++F  RP  VA R+L++ +    FA  TI  Q+ G    +    D E  
Sbjct  94   LPFDYNPQALKEFFSKRPLAVATRILQLLSVGGIFAFNTIFDQLLG---RVKNNPDLEVQ  150

Query  628  RYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            R      L++ + SLGP FIK+GQ+LS RPD++
Sbjct  151  R---AAELRDLITSLGPFFIKIGQALSIRPDVL  180



>ref|WP_035151232.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB82685.1| hypothetical protein IJ00_07045 [Calothrix sp. 336/3]
Length=571

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIV---AFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            +YDPQE+A Y+  RP +    A +++  F  F  A    + F +          E ++Y 
Sbjct  12   RYDPQEIARYYGYRPWLAWGRAIKIIGSFVVFLLALKWDEWFSL---------EEQNKYK  62

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L++ + +LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  63   RATQLRQLLTNLGPTFIKVGQALSTRPDLVRKDFLEELIKLQ  104



>ref|WP_026722518.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=570

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A Y++ RP +   R L +  +FA+  +  +          ++  E +R     
Sbjct  12   RYDPDEIAQYYRYRPWLAWRRALRIVWSFATFILSLK----WDEWQNQV--EENRLKRAA  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  66   QLRELLTRLGPTFIKVGQALSTRPDLVRKDFLEELVKLQ  104



>ref|WP_039715079.1| hypothetical protein [Scytonema millei]
 gb|KIF17519.1| hypothetical protein QH73_29430 [Scytonema millei VB511283]
Length=571

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 8/89 (9%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++YDP+ +A Y++ RP +   R  +V   FA       IFG+    +   DRE    +  
Sbjct  10   KRYDPEAIAQYYRFRPLLAVARTFKVVWLFAGF-----IFGL--KWDDWRDREEENKLKR  62

Query  643  CV-LKETMLSLGPTFIKVGQSLSTRPDII  726
             V L++ +  LGPTFIKVGQ+LSTRPD++
Sbjct  63   AVQLRQLLTDLGPTFIKVGQALSTRPDLV  91



>ref|WP_036028277.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=571

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 10/90 (11%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPT--MNTEIDRETSRYV  636
            ++YDPQ +A Y++ RP  V  R L+V     S      +FG+L     + E   +  R  
Sbjct  2    KRYDPQAIARYYRKRPWRVFLRALQVILMLGSF-----VFGLLCDRWFHQEARNQPQR--  54

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  55   -ATQLRQLLTRLGPTFIKVGQALSTRPDLI  83



>ref|WP_015152556.1| ABC-1 domain-containing protein [Chroococcidiopsis thermalis]
 gb|AFY86005.1| ABC-1 domain-containing protein [Chroococcidiopsis thermalis 
PCC 7203]
Length=570

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 8/89 (9%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++YDP+ +A Y++ RP +   R  +V   FA       IFG+    +   DRE    +  
Sbjct  10   KRYDPEAIAQYYRFRPLLAVARAFKVVWLFAGF-----IFGL--KWDDWRDREEENKLKR  62

Query  643  CV-LKETMLSLGPTFIKVGQSLSTRPDII  726
             V L++ +  LGPTFIKVGQ+LSTRPD++
Sbjct  63   AVQLRQLLTDLGPTFIKVGQALSTRPDLV  91



>ref|WP_009459174.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC09687.1| ABC-1 domain-containing protein [Fischerella sp. JSC-11]
Length=570

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 56/99 (57%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A Y++ RP +   R L +  +FA+   IF +         ++++  S+     
Sbjct  12   RYDPDEIASYYRYRPWLAWARALNIIWSFAA--FIFSL--KWDEWQNQVEQNKSKR--AA  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  66   QLRQLLTRLGPTFIKVGQALSTRPDLVRKDFLEELVKLQ  104



>ref|WP_038018285.1| hypothetical protein, partial [Synechococcus sp. PCC 7335]
Length=562

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 12/91 (13%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEV---FTAFASATIIFQIFGILPTMNTEIDRETSRY  633
            ++YD +E+A Y++ RP  V +R L V     +FA A ++  +FG           E ++ 
Sbjct  3    QQYDWREIARYYRKRPLTVLWRALTVAWMLGSFAIALVLDHLFG---------RSEATQN  53

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                 L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  54   RRAARLRQILTHLGPTFIKVGQALSTRPDLI  84



>ref|WP_006510757.1| putative unusual protein kinase [Xenococcus sp. PCC 7305]
 gb|ELS02183.1| putative unusual protein kinase [Xenococcus sp. PCC 7305]
Length=567

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 16/95 (17%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            LP  Y+ +E++ Y++ RP +V +R +++   F S  ++ Q            DR T++ V
Sbjct  12   LPTGYNQKEISRYYRYRPWLVIWRAIKIIWFFGSFFLLLQW-----------DRWTNQPV  60

Query  637  F-----GCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                     LK  + SLGPTFIKVGQ+LSTRPD+I
Sbjct  61   ATSQRRATQLKNILTSLGPTFIKVGQALSTRPDLI  95



>ref|WP_016868505.1| hypothetical protein [Fischerella muscicola]
Length=570

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A Y++ RP +   R L V  +FA+   IF     L     +   E ++     
Sbjct  12   RYDPNEIASYYRYRPWLAWARALNVIWSFAA--FIFS----LKWDEWQNQVEQNKLKRAT  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  66   QLRQLLTRLGPTFIKVGQALSTRPDLVRKDFLEELVKLQ  104



>gb|EDX84398.1| ABC1 family protein [Synechococcus sp. PCC 7335]
Length=585

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 12/91 (13%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEV---FTAFASATIIFQIFGILPTMNTEIDRETSRY  633
            ++YD +E+A Y++ RP  V +R L V     +FA A ++  +FG           E ++ 
Sbjct  26   QQYDWREIARYYRKRPLTVLWRALTVAWMLGSFAIALVLDHLFG---------RSEATQN  76

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                 L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  77   RRAARLRQILTHLGPTFIKVGQALSTRPDLI  107



>ref|WP_011612081.1| hypothetical protein [Trichodesmium erythraeum]
 gb|ABG51718.1| ABC-1 [Trichodesmium erythraeum IMS101]
Length=569

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 10/101 (10%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL--PTMNTEIDRETSRYVF  639
            +YDP+ +A Y+  R  +V +R L +F +F S      + GIL       +++    R   
Sbjct  11   RYDPEAIAKYYYYRLWLVMWRFLVIFFSFTSF-----VLGILWDKWRYKKVEDTPER---  62

Query  640  GCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
               L++ + +LGPTFIKVGQ+LSTRPD+I  +  ++ T  Q
Sbjct  63   ATQLRKILTNLGPTFIKVGQALSTRPDLIRKDFLEELTKLQ  103



>ref|XP_009036188.1| hypothetical protein AURANDRAFT_25238 [Aureococcus anophagefferens]
 gb|EGB09063.1| hypothetical protein AURANDRAFT_25238 [Aureococcus anophagefferens]
Length=446

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 12/93 (13%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR---ETS  627
            LP  Y+P+ +A YF  RP  VA RL +VF            FG L  +  +  R   E S
Sbjct  8    LPTTYEPETLAAYFGERPGAVARRLFQVFGTS---------FGYLSAVAWDAARGKLEES  58

Query  628  RYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                   L+ T++SLGP FIK+GQ+LS RPDI+
Sbjct  59   EVRRAAALRNTIVSLGPFFIKLGQALSIRPDIL  91



>ref|WP_015141931.1| putative unusual protein kinase [Pleurocapsa minor]
 gb|AFY75623.1| putative unusual protein kinase [Pleurocapsa sp. PCC 7327]
Length=572

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YD + +A Y+++RP +  +R L V   F   T  F +     T  TE +++        
Sbjct  20   RYDAEAIAKYYRIRPWLYIWRTLTVVWVFG--TFFFSLLWDKWTNRTEKNKQKR----AS  73

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  74   QLRQLLTHLGPTFIKVGQALSTRPDLI  100



>ref|XP_002502141.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO63399.1| predicted protein, partial [Micromonas sp. RCC299]
Length=723

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            LP  YDP+ +A Y++ RP  VA R+L++ T   S      I GI+  + T    E S   
Sbjct  62   LPLYYDPELIAQYWRRRPGAVAQRILQLSTIAGSF-----ITGIIADLVTNKTSENS-VK  115

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSE  735
                L+E + SLGP +IK+GQ+LS RPDI+  +
Sbjct  116  RAIQLREIVTSLGPAYIKLGQALSIRPDILSPQ  148



>ref|WP_015190101.1| ABC-1 domain-containing protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ32233.1| ABC-1 domain-containing protein [Gloeocapsa sp. PCC 7428]
Length=570

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 10/101 (10%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL--PTMNTEIDRETSRYVF  639
            +YDP+ +A Y++ RP +V +R   +   FA       I G+      N E   E +++  
Sbjct  12   RYDPEAIARYYRYRPWLVLWRACTIIWCFAGF-----ILGLYWDKWQNRE---EQNKFKR  63

Query  640  GCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
               L++ +  LGPTFIKVGQ+LSTRPD+I  +   +    Q
Sbjct  64   ATQLRQILTRLGPTFIKVGQALSTRPDLIRKDFLDELVKLQ  104



>ref|XP_009799241.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana sylvestris]
Length=711

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 6/85 (7%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y P+ +A  +  RP  V  R L++FT   S    F +   L  +N E+DR     +    
Sbjct  93   YSPELLATKYGSRPFKVVSRALQIFTGLGS----FALKVWLDRLNGELDRNMR--LRAVE  146

Query  649  LKETMLSLGPTFIKVGQSLSTRPDI  723
            L++T  +LGPTF+K+GQ LSTRPD+
Sbjct  147  LRQTFTNLGPTFVKIGQGLSTRPDL  171



>ref|XP_005836206.1| hypothetical protein GUITHDRAFT_175426 [Guillardia theta CCMP2712]
 gb|EKX49226.1| hypothetical protein GUITHDRAFT_175426 [Guillardia theta CCMP2712]
Length=744

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +1

Query  439  KLWTGPLPE-KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEID  615
            K W  P P+ KYDP + A YF++R  +   RL+E+ +   SA  +F+++     ++  + 
Sbjct  65   KSWQEPFPDGKYDPNKAASYFQMRFPLAVKRLIEIISV--SAGFLFRLY-----LDERLG  117

Query  616  R-ETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            R E         L   +  LGPTFIK+GQSLS R DI+
Sbjct  118  RAEEEERARSKELVALVARLGPTFIKIGQSLSVRSDIL  155



>ref|WP_011057497.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_682450.1| hypothetical protein tlr1660 [Thermosynechococcus elongatus BP-1]
 dbj|BAC09212.1| tlr1660 [Thermosynechococcus elongatus BP-1]
Length=573

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP+ +A Y+   P  V +R +++  +F +  ++ Q    L   +T+      R +   
Sbjct  19   RYDPEAIARYYWRHPWQVIWRFVDISVSFLTFWLLLQWDKWLGQQDTQ------RPLRAM  72

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ ++ LGPTFIK+GQ+LSTRPD+I  +  ++ T  Q
Sbjct  73   QLRKLLIRLGPTFIKIGQALSTRPDLICPDYLEELTLLQ  111



>ref|WP_044500806.1| hypothetical protein [Nostoc sp. PCC 7107]
Length=574

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P+ +A +++ RP +   RLL +  +FA   +       L     +   E +R    
Sbjct  10   KRYNPEAIARHYRYRPWLAWGRLLRIIWSFAGFILS------LKWDEWQDQVEQNRGKRA  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L+E + SLGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  64   TQLRELLTSLGPTFIKVGQALSTRPDLIRKDFLEELVKLQ  103



>ref|XP_003516816.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform 1 [Glycine max]
 ref|XP_003516817.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform 2 [Glycine max]
Length=698

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y+PQ +A  +  +P  V  R L++ TA  S    F +  +L   N  +D+  +R V    
Sbjct  86   YNPQLIASMYGSQPIKVVRRTLQILTALGS----FGLKLLLDQRNGALDK--NRRVRAVE  139

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            LK+    LGPTF+K+GQ LSTRPDI   E  ++ +  Q
Sbjct  140  LKDIFTKLGPTFVKLGQGLSTRPDICPPEYLEELSELQ  177



>ref|WP_026101159.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=566

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV--  636
            ++YDP+E+A Y++ R  +V +R + V    A        F +    +  + R++SR V  
Sbjct  9    QQYDPEEIARYYRWRFPLVVWRTVSVLLRLA-------WFCLGSQSDRLLGRQSSRQVQR  61

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L+  +  LGPTFIKVGQ+LSTRPD++  +  ++ T  Q
Sbjct  62   RASQLRALLADLGPTFIKVGQALSTRPDLVRVDYLEELTKLQ  103



>gb|KHN25542.1| Putative aarF domain-containing protein kinase, chloroplastic 
[Glycine soja]
Length=622

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y+PQ +A  +  +P  V  R L++ TA  S    F +  +L   N  +D+  +R V    
Sbjct  10   YNPQLIASMYGSQPIKVVRRTLQILTALGS----FGLKLLLDQRNGALDK--NRRVRAVE  63

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            LK+    LGPTF+K+GQ LSTRPDI   E  ++ +  Q
Sbjct  64   LKDIFTKLGPTFVKLGQGLSTRPDICPPEYLEELSELQ  101



>ref|WP_017720052.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=570

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTM-NTEIDRETSRYVFG  642
            +YDPQ +A +++ RP     R L++   FA       + G+L      + DR  S+    
Sbjct  11   RYDPQAIAQFYRYRPWQAVGRALKIIWFFAGF-----LLGLLSDQWQHQADRHKSQR--A  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L+  +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  64   EHLRHILTDLGPTFIKVGQALSTRPDLIRKDFLEELVKLQ  103



>ref|WP_015160804.1| putative unusual protein kinase [Chamaesiphon minutus]
 gb|AFY94683.1| putative unusual protein kinase [Chamaesiphon minutus PCC 6605]
Length=572

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL---PTMNTEIDRETSRYV  636
            +Y+ Q +A Y+  RP +V +R L +   FA   I     G+L      NTE ++      
Sbjct  11   RYNAQAIAKYYNRRPWLVIWRALVIVWLFAGFLI-----GLLLDRSVGNTEANKNQR---  62

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPTFIKVGQSLSTRPD+I
Sbjct  63   -AEQLREILTQLGPTFIKVGQSLSTRPDLI  91



>gb|AFY43513.1| ABC-1 domain-containing protein [Nostoc sp. PCC 7107]
Length=594

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P+ +A +++ RP +   RLL +  +FA   +       L     +   E +R    
Sbjct  30   KRYNPEAIARHYRYRPWLAWGRLLRIIWSFAGFILS------LKWDEWQDQVEQNRGKRA  83

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L+E + SLGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  84   TQLRELLTSLGPTFIKVGQALSTRPDLIRKDFLEELVKLQ  123



>ref|XP_005848798.1| hypothetical protein CHLNCDRAFT_34951 [Chlorella variabilis]
 gb|EFN56696.1| hypothetical protein CHLNCDRAFT_34951 [Chlorella variabilis]
Length=466

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 15/94 (16%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEV---FTAFASATIIFQI----FGILPTMNTEIDRETS  627
            YDP    DYFK  P ++A R+ +V      FASA +  Q+     G+ P        E  
Sbjct  112  YDPAAAEDYFKKHPLLLARRVAKVGAYLMQFASALVAAQVDAAVLGVRP--------EPG  163

Query  628  RYVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIG  729
                  VL++  + LGPTF+K+ Q+LS RPD+IG
Sbjct  164  AAAPELVLQQLAVKLGPTFVKLAQTLSMRPDLIG  197



>ref|XP_005818965.1| protein kinase, ABC-1 [Guillardia theta CCMP2712]
 gb|EKX31985.1| protein kinase, ABC-1 [Guillardia theta CCMP2712]
Length=784

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            LP  Y+P  + DY++ RP IV  RL++V TA +     F +  +L  +   I  E +  +
Sbjct  108  LPLTYEPDLLKDYYRKRPGIVLARLVQVMTAASG----FFLPLVLDAITGNI--EKNDVI  161

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSE  735
                L+E + SLGP FIK+GQ+L+ RPDI+  +
Sbjct  162  RTRKLREILTSLGPFFIKLGQALAIRPDILSPQ  194



>ref|WP_016861827.1| hypothetical protein [Fischerella muscicola]
Length=570

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A +++ RP +   R L +  +FA+  +  +          ++  E ++     
Sbjct  12   RYDPDEIAKFYRYRPWLAWRRALRIIWSFATFILSLK----WDEWQNQV--EQNKLKRAA  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  66   QLRELLTRLGPTFIKVGQALSTRPDLVRKDFLEELVKLQ  104



>ref|WP_017321507.1| hypothetical protein [cyanobacterium PCC 7702]
Length=573

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR-ETSRYVFG  642
            +YDP  +A Y++ RP +V  R + +   FAS  +  +        +   +R E ++Y   
Sbjct  12   RYDPDAIARYYRYRPWLVWARAIVIIWNFASFILSLK-------WDEWRERVEENKYKRA  64

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L++ +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  65   AQLRQILTRLGPTFIKVGQALSTRPDLVRKDFLEELVKLQ  104



>ref|XP_009610213.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Nicotiana tomentosiformis]
Length=707

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRET-SRYVFGC  645
            Y P+ +A  +  RP  V  R L++FT   S    F +   L  +N E+DR   SR +   
Sbjct  93   YSPELLATKYGSRPLKVLSRALQIFTGLGS----FALKVWLDRLNGELDRNMRSRAI---  145

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDI  723
             L++T  +LGPTF+K+GQ LSTRPD+
Sbjct  146  ELRQTFTNLGPTFVKIGQGLSTRPDL  171



>ref|WP_015223480.1| ABC-1 domain-containing protein [Cyanobacterium stanieri]
 gb|AFZ48165.1| ABC-1 domain-containing protein [Cyanobacterium stanieri PCC 
7202]
Length=564

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            KYDP+ +A Y+  RP +  FR L++ T F    ++F I   L     +   E ++     
Sbjct  20   KYDPRAIARYYNNRPWLGIFRSLKIITLF----VVFVIQLYLDKFFKQ--EEKNKLKRAE  73

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ + SLG TFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  74   RLRKILTSLGATFIKVGQALSTRPDLIKPDFLEELIKLQ  112



>ref|WP_015129918.1| ABC-1 domain-containing protein [Calothrix sp. PCC 7507]
 gb|AFY34111.1| ABC-1 domain-containing protein [Calothrix sp. PCC 7507]
Length=575

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 16/95 (17%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR-----E  621
            L  +Y+P  +A Y++ RP +   RL+ +  +FA              +N + D      E
Sbjct  8    LLRRYNPDAIARYYRYRPWLAWGRLIRIIWSFAGFI-----------LNLKFDEWQDQIE  56

Query  622  TSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
             ++      L+E +  LGPTFIKVGQSLSTRPD+I
Sbjct  57   QNKKKRATQLRELLTRLGPTFIKVGQSLSTRPDLI  91



>ref|WP_007357558.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN58380.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=558

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDPQ +A Y++ RP    +R L +  +FA     F +  I  +   E+           
Sbjct  11   RYDPQAIAQYYRSRPWQAIWRALTIVWSFAG----FVLGMIWDSWQHEVAAHQPER--AS  64

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  65   HLRQILTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



>ref|WP_015955262.1| hypothetical protein [Cyanothece sp. PCC 7424]
 gb|ACK71666.1| ABC-1 domain protein [Cyanothece sp. PCC 7424]
Length=567

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            E YDP+ +A Y++ RP    +R L +   F     I QI     T  TE+++    Y   
Sbjct  19   EIYDPEAIARYYRYRPWSFIWRTLTIIWFFG--LFIAQIKLDQWTGQTEVNK----YKRA  72

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              +++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  73   SQIRKILTHLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  112



>ref|WP_008200603.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI32045.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=663

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 18/102 (18%)
 Frame = +1

Query  448  TGPLPE------KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTM  600
            TGP+ +      +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P  
Sbjct  33   TGPMDDNVAESWRYNPQVINDYYRRRPLEVVGRLIEIALPVLSFVIGIWWDKLRGKSP--  90

Query  601  NTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
              EI R          L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  91   KNEIRR-------AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_015202446.1| ABC-1 domain-containing protein [Crinalium epipsammum]
 gb|AFZ12324.1| ABC-1 domain-containing protein [Crinalium epipsammum PCC 9333]
Length=570

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +Y+P+ +A Y++ RP +  +R L +  +FA   +  Q        + ++  E ++Y    
Sbjct  11   RYEPEAIAQYYRSRPWLAIWRTLVIIGSFAGFILGLQ----WDKWSNQV--EQNKYQRAT  64

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E +  LG TFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  65   QLRELLTKLGATFIKVGQALSTRPDLVRKDFLEELVKLQ  103



>ref|WP_009631926.1| putative unusual protein kinase [Synechocystis sp. PCC 7509]
Length=566

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEI---DRETSRYV  636
            +Y+P+ +  YF+ RP +V  R+L         TII+   G +  M T+      E ++ +
Sbjct  12   RYNPETLVKYFRFRPWLVWGRIL---------TIIWFFSGFIVGMKTDEWLGKAEQNQPL  62

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  63   RATQLRKIITRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  104



>ref|WP_026796430.1| hypothetical protein [Planktothrix prolifica]
Length=548

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 16/104 (15%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEV---FTAFASATIIFQIFGIL--PTMNTEIDRETSR  630
            +YDP+E+A Y + RP +   R + V   FT F        I G+L     + +++    R
Sbjct  11   RYDPEEIARYHRRRPWLAIGRTIMVIWYFTGF--------ILGLLWDKWQHGDVEHTPQR  62

Query  631  YVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             +    L+  +  LGPT+IKVGQ+LSTRPD+I  +  ++ T  Q
Sbjct  63   AIH---LRHVLTDLGPTYIKVGQALSTRPDLIRKDFLEELTKLQ  103



>ref|XP_005707514.1| aarF domain-containing kinase [Galdieria sulphuraria]
 gb|EME30994.1| aarF domain-containing kinase [Galdieria sulphuraria]
Length=733

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 12/122 (10%)
 Frame = +1

Query  364  LSGLDLFMADLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVF  543
            LSG+ LF  D+R L +   YF     L        YD +E+  Y+  RP + A RL  V 
Sbjct  127  LSGMQLFKQDVRYLLSLWRYFGRKAFL-------TYDKEEIISYYDRRPWLAAARLASVG  179

Query  544  TAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDI  723
                   I      ILP  +T      +R      L + ++++GPTFIKV Q+LS RPD+
Sbjct  180  IPLLQWYIKLLWDRILPGRSTTHLSWRAR-----ELVQLVMNMGPTFIKVAQALSNRPDV  234

Query  724  IG  729
            +G
Sbjct  235  VG  236



>ref|WP_044208672.1| hypothetical protein [Coleofasciculus chthonoplastes]
Length=571

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A  ++ RP +V +R L +   F        I G L         E +R+    
Sbjct  16   RYDPDEIAAKYRYRPWVVLWRALRIIWNFVQF-----ILG-LKWDEWRNQVEKNRFKRAA  69

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+  +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  70   QLRHILTRLGPTFIKVGQALSTRPDLVRKDFLEELIKLQ  108



>ref|WP_012596357.1| hypothetical protein [Cyanothece sp. PCC 8801]
 gb|ACK67096.1| ABC-1 domain protein [Cyanothece sp. PCC 8801]
Length=572

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP+ +A Y+++RP  V +R + +  +F    I  Q    L    T+ ++  +      
Sbjct  20   RYDPKVIARYYQVRPWEVIWRAITIIWSFGWFLIHLQWEKWLNPNRTDQNKCATE-----  74

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  75   -LRQILTRLGPTFIKVGQALSTRPDLIHPDFLQELIKLQ  112



>gb|EDX73847.1| ABC1 family protein [Coleofasciculus chthonoplastes PCC 7420]
Length=576

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP E+A  ++ RP +V +R L +   F        I G L         E +R+    
Sbjct  21   RYDPDEIAAKYRYRPWVVLWRALRIIWNFVQF-----ILG-LKWDEWRNQVEKNRFKRAA  74

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+  +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  75   QLRHILTRLGPTFIKVGQALSTRPDLVRKDFLEELIKLQ  113



>ref|WP_015138529.1| putative unusual protein kinase [Nostoc sp. PCC 7524]
 gb|AFY48084.1| putative unusual protein kinase [Nostoc sp. PCC 7524]
Length=574

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +Y+P  +A Y++ RP  V  RL+ +  +FA    +F +FG L     +   E +R     
Sbjct  11   RYNPDTIARYYRYRPWQVWGRLITIAWSFA----VF-VFG-LKWDEWQNRVEQNREKRAT  64

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L+E +  LGPTFIKVGQ+LSTRPD+I
Sbjct  65   QLRELLTKLGPTFIKVGQALSTRPDLI  91



>ref|WP_013191748.1| hypothetical protein [Trichormus azollae]
 gb|ADI64732.1| ABC-1 domain protein ['Nostoc azollae' 0708]
Length=574

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P  +A Y++ RP +   RLL +  +FAS  +  +          ++++   +    
Sbjct  10   QQYNPDAIARYYRYRPWLAWGRLLRIIFSFASFILSLK----WDEWQNQVEQNQGKR--A  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+E +   GPTFIKVGQ+LSTRPD+I
Sbjct  64   TQLRELLTHFGPTFIKVGQALSTRPDLI  91



>ref|WP_015784467.1| hypothetical protein [Cyanothece sp. PCC 8802]
 gb|ACV01851.1| ABC-1 domain protein [Cyanothece sp. PCC 8802]
Length=572

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (56%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP+ +A Y+++RP  V +R + +  +F    I  Q    L    T+ ++  +      
Sbjct  20   RYDPKVIARYYQVRPWEVIWRAITIIWSFGWFLIHLQWEKWLNPNRTDQNKCATE-----  74

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  75   -LRQILTRLGPTFIKVGQALSTRPDLIHPDFLQELIKLQ  112



>ref|WP_012409344.1| hypothetical protein [Nostoc punctiforme]
 gb|ACC81351.1| ABC-1 domain protein [Nostoc punctiforme PCC 73102]
Length=574

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (55%), Gaps = 8/99 (8%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR-ETSRYVFGC  645
            Y+P  +A Y+  RP +   RLL + ++FA       +F I    +   D+ E ++     
Sbjct  12   YNPDAIARYYSYRPWLAWGRLLRIISSFA-------VFIISLKWDEWQDKVEQNKGKRAI  64

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  65   QLRELLTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



>ref|WP_044195036.1| hypothetical protein [Oscillatoria acuminata]
Length=569

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDPQ +A Y++ RP  V +R + V    +S      I G+     T    E  R     
Sbjct  11   RYDPQAIASYYRSRPWKVIWRAITVIWYLSSF-----ILGLKWDEWTN-QAEQQRQKRAT  64

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L+  + +LGPTFIKVGQ+LSTRPD+I
Sbjct  65   QLQNILTTLGPTFIKVGQALSTRPDLI  91



>gb|AFY82052.1| putative unusual protein kinase [Oscillatoria acuminata PCC 6304]
Length=584

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDPQ +A Y++ RP  V +R + V    +S      I G+     T    E  R     
Sbjct  26   RYDPQAIASYYRSRPWKVIWRAITVIWYLSSF-----ILGLKWDEWTN-QAEQQRQKRAT  79

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L+  + +LGPTFIKVGQ+LSTRPD+I
Sbjct  80   QLQNILTTLGPTFIKVGQALSTRPDLI  106



>ref|WP_038331356.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=560

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YD + +A Y++ RP  +  R++  F       II      L         E ++Y    
Sbjct  2    EYDAERIARYYRRRPLTIIARIVATFW------IIGGFIARLLWDRWRGHTEKNKYKRAT  55

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+ET+  LGPTFIKVGQ+LSTRPD++  +  ++ T  Q
Sbjct  56   DLRETLTHLGPTFIKVGQALSTRPDLVRKDYLEELTKLQ  94



>emb|CBN77649.1| conserved unknown protein [Ectocarpus siliculosus]
Length=760

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 8/94 (9%)
 Frame = +1

Query  448  TGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEI-DRET  624
            T  LP  YDP+ + DYF  RP +   R L++  AF+     +    +L     ++ + E 
Sbjct  57   TDRLPLVYDPEALKDYFARRPQVATRRTLQLAGAFSGFVTSY----LLDLARGKVKENEI  112

Query  625  SRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            +R +    L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  113  ARAI---QLREIITSLGPFYIKLGQALSIRPDIL  143



>ref|WP_015215459.1| ABC-1 domain-containing protein [Anabaena cylindrica]
 gb|AFZ58834.1| ABC-1 domain-containing protein [Anabaena cylindrica PCC 7122]
Length=558

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGI-LPTMNTEIDRETSRYVF  639
            ++Y+P  +A Y++ RP +   RLL +  +FA       I G+       ++++   +   
Sbjct  10   KQYNPDAIARYYRYRPWLAWGRLLRIILSFAGF-----ILGLKWDEWQNQVEQNKGKR--  62

Query  640  GCVLKETMLSLGPTFIKVGQSLSTRPDII  726
               L+E +  LGPTFIKVGQ+LSTRPD+I
Sbjct  63   ATQLRELLTHLGPTFIKVGQALSTRPDLI  91



>gb|AFY62190.1| putative unusual protein kinase [Synechococcus sp. PCC 6312]
Length=576

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIV---AFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            KYDPQ +  Y+  RP +     FR++ +FT F       + F            E +  +
Sbjct  26   KYDPQSLNRYYGFRPWLTFGRLFRIIALFTLFWCKLRWDEWFN---------QTEENLPI  76

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L++ ++ LGPTFIKVGQ+LSTRPD+I      + T  Q
Sbjct  77   RAMQLRQLLIKLGPTFIKVGQALSTRPDLINRNYLDELTLLQ  118



>ref|WP_042154100.1| hypothetical protein [Planktothrix agardhii]
 gb|KEI67113.1| hypothetical protein A19Y_2152 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=553

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 55/104 (53%), Gaps = 16/104 (15%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEV---FTAFASATIIFQIFGIL--PTMNTEIDRETSR  630
            +YDP+E+A Y + RP +   R + V   FT F        I G+L     + +++    R
Sbjct  11   RYDPEEIARYHRRRPWLAIGRTIMVIWYFTGF--------ILGLLWDKWQHGDVEHTPQR  62

Query  631  YVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                  L+  +  LGPT+IKVGQ+LSTRPD+I  +  ++ T  Q
Sbjct  63   ---ATHLRHVLTDLGPTYIKVGQALSTRPDLIRKDFLEELTKLQ  103



>ref|WP_015177243.1| ABC-1 domain-containing protein [Oscillatoria nigro-viridis]
 gb|AFZ07984.1| ABC-1 domain-containing protein [Oscillatoria nigro-viridis PCC 
7112]
Length=558

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 54/101 (53%), Gaps = 10/101 (10%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL--PTMNTEIDRETSRYVF  639
            +YDPQ +A Y++ RP    +R + V  +FA       + G+L     ++    +  R   
Sbjct  11   RYDPQAIAQYYRKRPQKAIWRAITVIWSFAGF-----VLGMLWDSWQHSVAAHQPER---  62

Query  640  GCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
               L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  63   AAHLRQILTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



>ref|WP_029793013.1| 2-octaprenylphenol hydroxylase, partial [alpha proteobacterium 
SCGC AAA487-M09]
Length=120

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = +1

Query  556  SATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSE  735
            S  ++ +IFG      T  +++++    G  LK   L+LGP FIK+GQ L+TRPDI+G E
Sbjct  33   SIKVLIKIFGF-----TTFNKDSANKSAGERLKNAFLTLGPAFIKLGQFLATRPDIVGEE  87

Query  736  ISKKSTSXQ  762
             +K+    Q
Sbjct  88   FAKELQQLQ  96



>ref|WP_028089854.1| hypothetical protein [Dolichospermum circinale]
Length=558

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 6/88 (7%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P+ +A YF+ RP +V  RLL +  +FA    +F     L     +   E ++    
Sbjct  10   KQYNPEAIARYFRYRPWLVWGRLLSIIWSFAG--FVFS----LKWDEWQEQVEENQGQRA  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+  +  LGPTFIKVGQ+LSTRPD+I
Sbjct  64   IELRNLLTRLGPTFIKVGQALSTRPDLI  91



>ref|WP_041429582.1| hypothetical protein [Thermosynechococcus sp. NK55a]
Length=565

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP+ +A Y+   P  V +R + +  +F +  ++ Q    L    ++  R   +     
Sbjct  11   RYDPEAIARYYWRHPWQVIWRFVHISVSFLTFWLLLQWDKWLGQQESQRPRRAMQ-----  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ ++ LGPTFIKVGQ+LSTRPD+I  +   + T  Q
Sbjct  66   -LRKLLIRLGPTFIKVGQALSTRPDLICPDYLDELTLLQ  103



>ref|WP_041934048.1| hypothetical protein [Cyanothece sp. PCC 7822]
Length=569

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            + YDP+ +A Y++ RP +  +R + +   F     IF           +++R  ++Y   
Sbjct  19   KSYDPEAIARYYRSRPWLFIWRTISIIWFFG----IFLFHLKWDQWTGQVER--NKYKRA  72

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              ++ T+  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  73   SEIRTTLTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  112



>gb|AHB88308.1| ABC1 family kinase-like protein [Thermosynechococcus sp. NK55a]
Length=569

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP+ +A Y+   P  V +R + +  +F +  ++ Q    L    ++  R   +     
Sbjct  15   RYDPEAIARYYWRHPWQVIWRFVHISVSFLTFWLLLQWDKWLGQQESQRPRRAMQ-----  69

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L++ ++ LGPTFIKVGQ+LSTRPD+I  +   + T  Q
Sbjct  70   -LRKLLIRLGPTFIKVGQALSTRPDLICPDYLDELTLLQ  107



>ref|WP_028083060.1| hypothetical protein [Dolichospermum circinale]
Length=558

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P+ +A YF+ RP +V  RLL +  +FA      +          +I+    +    
Sbjct  10   KQYNPEAIARYFRYRPWLVWGRLLSIIWSFAGFVFSLK----WDEWQEQIEENQGQR--A  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+  +  LGPTFIKVGQ+LSTRPD+I
Sbjct  64   IELRNLLTRLGPTFIKVGQALSTRPDLI  91



>ref|WP_015955656.1| hypothetical protein [Cyanothece sp. PCC 7424]
 gb|ACK72063.1| ABC-1 domain protein [Cyanothece sp. PCC 7424]
Length=670

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +YDP  +  Y+  RP  V  RLL +   FAS  I     ++ G+   +   I R      
Sbjct  45   RYDPDRIYAYYGNRPLKVLGRLLTILVPFASFAIGLWWDKVQGL--QVKNSIKR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L+E +  LGPT+IK+GQ+LSTRPD++  E  ++  + Q
Sbjct  97   -AIQLREMLTHLGPTYIKIGQALSTRPDLVPPEYLEELATLQ  137



>gb|ADN17360.1| ABC-1 domain protein [Cyanothece sp. PCC 7822]
Length=592

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            + YDP+ +A Y++ RP +  +R + +   F     IF           +++R  ++Y   
Sbjct  42   KSYDPEAIARYYRSRPWLFIWRTISIIWFFG----IFLFHLKWDQWTGQVER--NKYKRA  95

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              ++ T+  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  96   SEIRTTLTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  135



>ref|WP_041431644.1| hypothetical protein, partial [Synechococcus sp. PCC 6312]
Length=554

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIV---AFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            KYDPQ +  Y+  RP +     FR++ +FT F       + F            E +  +
Sbjct  4    KYDPQSLNRYYGFRPWLTFGRLFRIIALFTLFWCKLRWDEWFN---------QTEENLPI  54

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L++ ++ LGPTFIKVGQ+LSTRPD+I      + T  Q
Sbjct  55   RAMQLRQLLIKLGPTFIKVGQALSTRPDLINRNYLDELTLLQ  96



>ref|WP_002797231.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI25068.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=663

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRRRPLDVVGRLIEIALPVLSFVIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L+E +  LGPT+IK+GQ+LSTRPD++     ++ T+ Q
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLVPPLYLEELTTLQ  137



>ref|WP_002780928.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI14886.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=663

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRRRPLDVVGRLIEIALPVLSFVIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREILTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_006634777.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK85359.1| ABC-1 domain-containing protein [Microcoleus vaginatus FGP-2]
Length=558

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL-PTMNTEIDRETSRYVFG  642
            +YDPQ +A Y++ RP    +R + V  +FA       + G+L  +   E+          
Sbjct  11   RYDPQAIAQYYRNRPWKAIWRAITVIWSFAGF-----VLGMLWDSWQHEVAAHQPER--A  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  64   AHLRQILTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



>ref|WP_015166729.1| ABC-1 domain-containing protein [Pseudanabaena sp. PCC 7367]
 gb|AFY71775.1| ABC-1 domain-containing protein [Pseudanabaena sp. PCC 7367]
Length=566

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            +KYD + +A ++  RP +  +RL+++   F    +  Q+       + ++ R  ++    
Sbjct  10   KKYDAKAIAQHYNQRPLLAVWRLIQIVYMFVGLFVGLQLDKWSGQEDAKLPRRAAQ----  65

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L+  +  LGPT+IKVGQ+LSTRPD++  +   + T  Q
Sbjct  66   --LRRIITKLGPTYIKVGQALSTRPDLVRKDFLDELTKLQ  103



>emb|CEF97545.1| Aminoglycoside phosphotransferase [Ostreococcus tauri]
Length=854

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 9/100 (9%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            ++D  ++  +F+ RP  VA RL         ATII     ++     +   +      G 
Sbjct  163  EFDKPKLLRFFRRRPLQVAGRL---------ATIIRVGRRVIRQWKAQESWDPEERTRGA  213

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQQ  765
            +L+E M  LGP F+K+GQ+LS RPD+IG E + +    QQ
Sbjct  214  ILREAMTRLGPVFVKIGQTLSQRPDLIGEEAADELKLLQQ  253



>ref|WP_017654602.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=574

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (54%), Gaps = 6/102 (6%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            L  +Y+P ++A +++ RP  +  RLL +  +FA   +  +          ++++   +  
Sbjct  8    LLRRYNPDDIARHYRYRPWQIWGRLLRIIWSFAGFILSLK----FDEWQNQVEQNKKQR-  62

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  63   -ATQLRELLTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



>dbj|GAL94053.1| ubiquinone biosynthesis monooxygenase UbiB [Microcystis aeruginosa 
NIES-44]
Length=659

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  41   RYNPQVINDYYRRRPLEVVGRLIEIALPVLSFVIGIWWDKLRGKSP--KNEIRR------  92

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L+E +  LGPT+IK+GQ+LSTRPD++     ++ T+ Q
Sbjct  93   -AVQLREMLTKLGPTYIKIGQALSTRPDLVPPLYLEELTTLQ  133



>gb|AIU50296.1| ABC1-like kinase, partial [Acorus calamus]
Length=616

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y P  ++  +  RP  V FR +E+ TA  +    F +  ++     +IDR   +      
Sbjct  10   YSPDFLSREYGSRPFKVTFRTVEILTALGT----FALKLLVDQRTGQIDRRKRQR--AVE  63

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L+ + +SLGPTF+K+GQ LSTRPDI   E  ++    Q
Sbjct  64   LRRSFISLGPTFVKIGQGLSTRPDICPPEYLEELAELQ  101



>ref|WP_036481104.1| hypothetical protein [Myxosarcina sp. GI1]
Length=563

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 53/95 (56%), Gaps = 12/95 (13%)
 Frame = +1

Query  451  GPLPEKYDPQEVADYFKLRPHIV---AFRLLEVFTAFASATIIFQIFGILPTMNTEIDRE  621
             P   +YD + ++ Y++ RP  V   AF ++ +F  F    ++ + FG      TEI+R 
Sbjct  8    APQSLRYDAKAISSYYRYRPWQVIGRAFSIVWLFGGFIIRILLDRWFG-----KTEINRP  62

Query  622  TSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                     +++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  63   KR----ATEIRKILTKLGPTFIKVGQALSTRPDLI  93



>ref|WP_009785293.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW36206.1| ABC-1 [Lyngbya sp. PCC 8106]
Length=559

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 54/104 (52%), Gaps = 18/104 (17%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL------PTMNTEIDRETSR  630
            YDP+ +A Y++ RP    +R + V   FA       ++G+       P +    +R T  
Sbjct  12   YDPRAIAQYYRRRPWQAIWRAITVVWFFAGF-----VWGLFWDRWRRPEVEHTPERATQ-  65

Query  631  YVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                  L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++ T  Q
Sbjct  66   ------LREILTYLGPTFIKVGQALSTRPDLIRKDFLEELTRLQ  103



>ref|WP_015228271.1| protein kinase [Dactylococcopsis salina]
 gb|AFZ49258.1| putative unusual protein kinase [Dactylococcopsis salina PCC 
8305]
Length=658

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVF---TAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            +YDP+ + +Y+K RP  V  RL+ +    TAF    +  ++ G +         E  R  
Sbjct  40   RYDPERINNYYKNRPLAVIRRLIALIFPGTAFGVRLLFDKLTGQIAK------NEQKR--  91

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  92   -AIELREILTELGPTYIKIGQALSTRPDLV  120



>ref|WP_002788784.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI18752.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9807]
Length=663

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  +  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRRRPLDIVGRLIEIALPVLSFVIGIWSDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREVLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_015189201.1| ABC-1 domain-containing protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ31329.1| ABC-1 domain-containing protein [Gloeocapsa sp. PCC 7428]
Length=676

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 57/114 (50%), Gaps = 11/114 (10%)
 Frame = +1

Query  391  DLRALEAYSNYFYCLVKLWTGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATII  570
            DL  +E   +Y   L  +   P   +YDP E+A+YF+ RP  V  R+  V     S    
Sbjct  23   DLTVVEERPSYHTVLPSV-VEPETLRYDPVEIAEYFRHRPLEVLGRIFRVIFPILSFA--  79

Query  571  FQIFGIL--PTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
               FG+      N  ++ +  R      L+E +  LGP +IK+GQ+LSTRPD++
Sbjct  80   ---FGLWWDRQRNRAVENQQRR---AIQLRELLTRLGPAYIKIGQALSTRPDLV  127



>gb|EPS72803.1| hypothetical protein M569_01954, partial [Genlisea aurea]
Length=431

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 18/96 (19%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTM-----NTEI-DR  618
            LP  YDP  +A Y++ RP  VA R++++ +            G L  +     N++I + 
Sbjct  156  LPLVYDPDSIAAYWRKRPRAVATRIVQLLSVAG---------GFLSRLSWDLINSKIKEN  206

Query  619  ETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            E SR +    L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  207  EVSRAI---ELREIVTSLGPAYIKLGQALSIRPDIL  239



>ref|WP_015219663.1| ABC-1 domain-containing protein [Cyanobacterium aponinum]
 gb|AFZ53936.1| ABC-1 domain-containing protein [Cyanobacterium aponinum PCC 
10605]
Length=562

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPT-MNTEIDRETSRYVFG  642
            +Y P  +A Y+  RP +  +R L++ T F     IF I  IL    N E   E ++    
Sbjct  18   RYSPDAIAQYYNRRPWLAIWRGLKIITYFG----IFIIQLILDKWFNLE---EKNKLKRA  70

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              +++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  71   EQIRKILTKLGPTFIKVGQALSTRPDLI  98



>ref|WP_026785272.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=553

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 54/104 (52%), Gaps = 16/104 (15%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEV---FTAFASATIIFQIFGIL--PTMNTEIDRETSR  630
            +YDP+E+A Y   RP +   R + V   FT F        I G+L     + +++    R
Sbjct  11   RYDPEEIARYHSRRPWLAIGRTIMVIWYFTGF--------ILGLLWDKWQHGDVEHTPQR  62

Query  631  YVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                  L+  +  LGPT+IKVGQ+LSTRPD+I  +  ++ T  Q
Sbjct  63   ---ATHLRHVLTDLGPTYIKVGQALSTRPDLIRKDFLEELTKLQ  103



>ref|WP_007305524.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM50774.1| ABC-1 [Crocosphaera watsonii WH 8501]
 gb|EHJ12728.1| Ubiquinone biosynthesis monooxygenase UbiB [Crocosphaera watsonii 
WH 0003]
 emb|CCQ54079.1| Ubiquinone biosynthesis monooxygenase UbiB [Crocosphaera watsonii 
WH 0005]
 emb|CCQ68279.1| Ubiquinone biosynthesis monooxygenase UbiB [Crocosphaera watsonii 
WH 0402]
Length=664

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y P+ + DY++ R   V  RL+ VF  FAS  +     +I G  P        E  R +
Sbjct  45   QYSPETINDYYRKRLLQVIRRLINVFLLFASFALGLWWDKIRGKNPK------EERKRAI  98

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IKVGQ+LSTRPD++
Sbjct  99   H---LREMLTELGPTYIKVGQALSTRPDLV  125



>ref|WP_021830591.1| Ubiquinone biosynthesis monooxygenase UbiB [Crocosphaera watsonii]
 emb|CCQ51203.1| Ubiquinone biosynthesis monooxygenase UbiB [Crocosphaera watsonii 
WH 8502]
Length=664

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y P+ + DY++ R   V  RL+ VF  FAS  +     +I G  P        E  R +
Sbjct  45   QYSPETINDYYRKRLLQVIRRLINVFLLFASFALGLWWDKIRGKNPK------EERKRAI  98

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IKVGQ+LSTRPD++
Sbjct  99   H---LREMLTELGPTYIKVGQALSTRPDLV  125



>emb|CCQ61264.1| Ubiquinone biosynthesis monooxygenase UbiB [Crocosphaera watsonii 
WH 0401]
Length=664

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y P+ + DY++ R   V  RL+ VF  FAS  +     +I G  P        E  R +
Sbjct  45   QYSPETINDYYRKRLLQVIRRLINVFLLFASFALGLWWDKIRGKNPK------EERKRAI  98

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IKVGQ+LSTRPD++
Sbjct  99   H---LREMLTELGPTYIKVGQALSTRPDLV  125



>ref|WP_002803392.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI37736.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=663

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRGRPLDVVGRLIEIALPVLSFVIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L+E +  LGPT+IK+GQ+LSTRPD++     ++ T+ Q
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLVPPLYLEELTTLQ  137



>ref|WP_023064752.1| ABC1 family protein [Lyngbya aestuarii]
 gb|ERT09208.1| ABC1 family protein [Lyngbya aestuarii BL J]
Length=558

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 54/104 (52%), Gaps = 18/104 (17%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL------PTMNTEIDRETSR  630
            YDP+ +A Y++ RP    +R + V   FA       ++G+       P +    +R T  
Sbjct  12   YDPKVIAQYYRRRPWQAIWRAITVVWFFAGF-----VWGLFWDRWRRPEVEHTPERATQ-  65

Query  631  YVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                  L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++ T  Q
Sbjct  66   ------LREILTYLGPTFIKVGQALSTRPDLIRKDFLEELTRLQ  103



>ref|WP_010994768.1| hypothetical protein [Nostoc sp. PCC 7120]
 dbj|BAB72550.1| all0592 [Nostoc sp. PCC 7120]
Length=572

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P  +A Y++ RP +   RL ++  +FA    +F +         ++++   +    
Sbjct  10   KRYNPDAIARYYRFRPWLAWGRLFKITWSFA----MFVLGLKWDEWQNQVEQNKGKR--A  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  64   TQLRELLTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



>ref|WP_002776339.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI06747.1| conserved hypothetical protein [Microcystis aeruginosa PCC 7941]
Length=663

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>gb|KIJ82026.1| hypothetical protein SD80_22760 [Scytonema tolypothrichoides 
VB-61278]
Length=564

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP  +A Y++ RP +   R +++   FA   +       L     +   E +++    
Sbjct  13   RYDPMAIARYYRYRPWLAWMRAIKIIWFFAVFILS------LKWDQWQNQDEQNKFKRAT  66

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  67   QLRQLLTRLGPTFIKVGQALSTRPDLI  93



>ref|WP_024969577.1| hypothetical protein [Microcystis aeruginosa]
Length=663

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_026102916.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=565

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
             YDPQ +A  ++ RP  V +R L V   F +   I  +F    T   EI++         
Sbjct  13   HYDPQVIASQYRFRPWQVIWRSLAVIWLFGN--FILHLFWDKWTNREEINQPKR----AR  66

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L++ +  LGPT+IKVGQ+LSTRPD+I
Sbjct  67   ELRQILTKLGPTYIKVGQALSTRPDLI  93



>ref|WP_002790785.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI27103.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=663

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_002750390.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH92365.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
Length=663

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_016514450.1| Aminoglycoside acetyltransferase regulator [Microcystis aeruginosa]
 gb|EPF23897.1| Aminoglycoside acetyltransferase regulator [Microcystis aeruginosa 
SPC777]
 gb|EPF24696.1| Aminoglycoside acetyltransferase regulator [Microcystis aeruginosa 
SPC777]
Length=663

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_036400978.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO90870.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
Length=663

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_026734382.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=570

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP+ +A Y++ RP +   R L++  +FA    +F +         ++  E ++     
Sbjct  12   RYDPKAIARYYRYRPWLAWGRALKIIWSFA----VFILSLKWDEWQNQV--EQNKLKRAA  65

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L++ +  LGPTFIKVGQ+LSTRPD++
Sbjct  66   ELRQLLTRLGPTFIKVGQALSTRPDLV  92



>gb|ELS47755.1| putative aarF domain-containing protein [Microcystis aeruginosa 
DIANCHI905]
Length=659

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  41   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  92

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  93   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  121



>gb|ELP53295.1| hypothetical protein O53_2099 [Microcystis aeruginosa TAIHU98]
Length=659

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  41   RYNPQVINDYYRGRPLDVVGRLIEITLPVLSFLIGIWWDKLRGKSP--KNEIRR------  92

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  93   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  121



>ref|WP_002760159.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH97558.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=663

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRRRPLDVLGRLIEIALPVLSFLIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_023072928.1| abc-1 domain-containing protein [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36241.1| abc-1 domain-containing protein [Leptolyngbya sp. Heron Island 
J]
Length=641

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (55%), Gaps = 16/91 (18%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            YDP  +A Y++ RP  +  RL+E         +++   G   +++   DR+T R     V
Sbjct  27   YDPAAIAHYYRSRPLQIFLRLVE---------LVWTFLGF--SLDLLWDRQTGRQASNEV  75

Query  649  -----LKETMLSLGPTFIKVGQSLSTRPDII  726
                 L+E +  LGP +IK+GQ+LSTRPD++
Sbjct  76   KRAIQLREVLTKLGPAYIKIGQALSTRPDLV  106



>ref|WP_017969651.1| hypothetical protein [alpha proteobacterium SCGC AAA280-P20]
Length=522

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = +1

Query  532  LEVFTAF----ASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
            L +F  F     S  ++ +IFG      T  ++++S    G  LK   L+LGP FIK+GQ
Sbjct  21   LSIFEEFYKPPLSIKVLIKIFGF-----TTFNKDSSNKSAGERLKNAFLTLGPAFIKLGQ  75

Query  700  SLSTRPDIIGSEISKKSTSXQ  762
             L+TRPDI+G E +K+    Q
Sbjct  76   FLATRPDIVGEEFAKELQQLQ  96



>ref|XP_004238478.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Solanum lycopersicum]
Length=714

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y P  ++  +  RP  V  R L++F    S    F +   L  +N E+DR+    +    
Sbjct  101  YSPDMLSSKYGTRPIKVLRRALQIFNGLGS----FALKVWLDQLNGELDRKMR--LRAIE  154

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++T   LGPTF+K+GQ LSTRPD+   E  ++ +  Q
Sbjct  155  LRQTFTRLGPTFVKIGQGLSTRPDLCPPEYLEELSELQ  192



>ref|WP_012953844.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 gb|ADB95179.1| Ubiquinone biosynthesis monooxygenase UbiB [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=560

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 7/88 (8%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            +KYD  E+A Y++ RP  V  R + +  +F    I  Q        N++  R        
Sbjct  19   KKYDAHEIALYYRSRPWRVIKRTISIVWSFGWFFINIQWDKFTHKKNSKKKRSIQ-----  73

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L++ + +LGPTFIKVGQ+LSTRPD+I
Sbjct  74   --LRQILTNLGPTFIKVGQALSTRPDLI  99



>ref|XP_006342209.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Solanum tuberosum]
Length=714

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y P  +++ +  RP  V  R L++F    S    F +   L  +N E+DR+    +    
Sbjct  101  YSPDLLSNKYGSRPIKVLRRALQIFNGLGS----FALKVWLDQLNGELDRKMR--LRAIE  154

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++T   LGPTF+K+GQ LSTRPD+   E  ++ +  Q
Sbjct  155  LRQTFTRLGPTFVKIGQGLSTRPDLCPPEYLEELSELQ  192



>gb|AIU50339.1| ABC1-like kinase, partial [Trachycarpus fortunei]
Length=615

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 54/99 (55%), Gaps = 8/99 (8%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEID-RETSRYVFGC  645
            Y PQ +A  +  +P  V  R LEV TA +  T  F++F  L     E++ R+  R V   
Sbjct  10   YSPQLLATKYGSQPLKVVLRTLEVLTALS--TFAFKLF--LDNRRGELNLRKRQRAV---  62

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+ET   LG TF+K+GQ LSTRPDI   E  ++ +  Q
Sbjct  63   ELRETFTRLGATFVKIGQGLSTRPDICPPEYLEELSELQ  101



>ref|WP_029634227.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=569

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y+P  +A Y+ LRP +   R +++   FA       I G L       + E +++     
Sbjct  12   YNPNAIARYYSLRPWLAIARAIKIVWFFAGF-----ILG-LKWDEWRGEVEQNKFKRAIQ  65

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L+E +  LGPTFIKVGQ+LSTRPD+I  +   +    Q
Sbjct  66   LREILTRLGPTFIKVGQALSTRPDLIRKDFLNELVKLQ  103



>ref|WP_007260247.1| ABC transporter [Natronolimnobius innermongolicus]
 gb|ELY53326.1| ABC transporter [Natronolimnobius innermongolicus JCM 12255]
Length=569

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = +1

Query  514  IVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKV  693
            +VA++ L +  AFA     F +FG    ++ E  RE +      VL E++L+LGPTFIK+
Sbjct  2    LVAWQFLPLLVAFARDRRRFLLFGRPRQVDAETHRERAE-----VLLESLLTLGPTFIKL  56

Query  694  GQSLSTRPDII  726
            GQ LSTRPD++
Sbjct  57   GQLLSTRPDVL  67



>gb|AIU50327.1| ABC1-like kinase, partial [Solanum lycopersicum]
Length=616

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y P  ++  +  RP  V  R L++F    S    F +   L  +N E+DR+    +    
Sbjct  10   YSPDMLSSKYGTRPIKVLRRALQIFNGLGS----FALKVWLDQLNGELDRKMR--LRAIE  63

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++T   LGPTF+K+GQ LSTRPD+   E  ++ +  Q
Sbjct  64   LRQTFTRLGPTFVKIGQGLSTRPDLCPPEYLEELSELQ  101



>gb|AIU50318.1| ABC1-like kinase, partial [Solanum tuberosum]
Length=607

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y P  +++ +  RP  V  R L++F    S    F +   L  +N E+DR+    +    
Sbjct  10   YSPDLLSNKYGSRPIKVLRRALQIFNGLGS----FALKVWLDQLNGELDRKMR--LRAIE  63

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++T   LGPTF+K+GQ LSTRPD+   E  ++ +  Q
Sbjct  64   LRQTFTRLGPTFVKIGQGLSTRPDLCPPEYLEELSELQ  101



>gb|ABD02043.1| ABC1 domain protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=590

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 12/103 (12%)
 Frame = +1

Query  463  EKYDPQEVADYFKLR-PHIV--AFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRY  633
            E YDPQ +  Y++ R P ++  A  +L  F  F       Q++G         DR   R 
Sbjct  12   EVYDPQLICRYYRWRLPQVIGRALAILWPFLWFVLCLRWDQLWG-------HTDRNVGRR  64

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                 L++ +  LGPTFIKVGQ+LSTRPD++  +  ++ T  Q
Sbjct  65   --SVQLRKLLTDLGPTFIKVGQALSTRPDLVRKDYLEELTQLQ  105



>ref|XP_005535949.1| unknown kinase with aarF domain [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79663.1| unknown kinase with aarF domain [Cyanidioschyzon merolae strain 
10D]
Length=768

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 12/96 (13%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNT-----EIDRE  621
            LP  YD   +A Y+  RP  VA RL E+    +S  I F +      M+T     + D E
Sbjct  108  LPLTYDEDAIAAYWSRRPTEVARRLSEI----SSLLIPFLVSTATSRMSTASGAAKADLE  163

Query  622  TSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDIIG  729
             +R      L+E +  LGPTFIK+GQ L+ RPD++G
Sbjct  164  VAR---AARLREILTELGPTFIKIGQWLAVRPDLVG  196



>ref|WP_011144395.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_927358.1| hypothetical protein gll4412 [Gloeobacter violaceus PCC 7421]
 dbj|BAC92353.1| gll4412 [Gloeobacter violaceus PCC 7421]
Length=562

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 55/98 (56%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            YDPQ +  Y++ RP ++  R L V  +FA      Q++G    ++  I+R  +R      
Sbjct  15   YDPQLIGAYYRRRPLVILRRALAV--SFAFLIFGLQLWG--DKLSGSIER--NRRKRASQ  68

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++ +  LGP  IKVGQ+LSTRPD++  +  ++ T  Q
Sbjct  69   LRQLLTDLGPGSIKVGQALSTRPDLLPKDYMEEMTRLQ  106



>gb|AIU50335.1| ABC1-like kinase, partial [Ginkgo biloba]
Length=616

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y P ++ + +  RP +V  R LE+F A  S    F +  +L   +  +D+  ++ +    
Sbjct  10   YSPAKLTEKYGRRPAMVFRRTLEIFLALGS----FALSLLLDQRSGRLDK--NKRLRATE  63

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++    LGPTF+KVGQ LSTRPD+   E  ++ T  Q
Sbjct  64   LRKIFTRLGPTFVKVGQGLSTRPDLCPPEYLEELTELQ  101



>ref|WP_015171439.1| ABC-1 domain-containing protein [Geitlerinema sp. PCC 7407]
 gb|AFY65872.1| ABC-1 domain-containing protein [Geitlerinema sp. PCC 7407]
Length=684

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR-ETSRYVFG  642
            +YDPQ +A Y++ RP  V +R+L +   F +       FG+    +    R + +     
Sbjct  62   RYDPQVIAAYYRRRPLQVWWRMLSIIWPFLT-------FGVAIWWDKRTRRVKANERKRA  114

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+E + +LGP +IKVGQ+LSTRPD++
Sbjct  115  VRLREMLTTLGPAYIKVGQALSTRPDLV  142



>ref|WP_017715729.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=696

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +YDP  +A Y++ RP  V  RL+ +   F S          FG L        +E  R  
Sbjct  63   RYDPVAIAQYYRQRPLQVWGRLMSIVGLFVSFRFSLWWDDKFGRL--------KENQRRR  114

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E + SLGP FIKVGQ+LSTRPD++
Sbjct  115  -AARLREILTSLGPAFIKVGQALSTRPDLV  143



>ref|WP_035798350.1| hypothetical protein [Cyanothece sp. CCY0110]
Length=660

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 52/96 (54%), Gaps = 12/96 (13%)
 Frame = +1

Query  448  TGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDR  618
            T P   +Y+P  + +Y++ R   V  RL+ VF  FA   I     +I G  P       +
Sbjct  39   TSPESWQYNPDVINEYYRQRLPQVVGRLITVFVLFARFAIGLWWDKIRGKNPK------Q  92

Query  619  ETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            E  R +    L+E +  LGPT+IKVGQ+LSTRPD++
Sbjct  93   ERKRAIH---LREMLTELGPTYIKVGQALSTRPDLV  125



>ref|WP_036007296.1| hypothetical protein, partial [Leptolyngbya sp. JSC-1]
Length=550

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTE---IDRETSRYV  636
            +YDPQ +  Y++ RP    +R L         TII+   G + ++  +      E ++  
Sbjct  3    RYDPQAIRQYYRYRPWQAIWRAL---------TIIWLFSGFILSLKWDEWFNQVEANKLK  53

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L++ +  LGPT+IKVGQ+LSTRPD++  +   + T  Q
Sbjct  54   RATQLRQLLTHLGPTYIKVGQALSTRPDLVRKDFLNELTKLQ  95



>ref|WP_041437189.1| hypothetical protein, partial [Synechococcus sp. JA-2-3B'a(2-13)]
Length=528

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 12/103 (12%)
 Frame = +1

Query  463  EKYDPQEVADYFKLR-PHIV--AFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRY  633
            E YDPQ +  Y++ R P ++  A  +L  F  F       Q++G         DR   R 
Sbjct  5    EVYDPQLICRYYRWRLPQVIGRALAILWPFLWFVLCLRWDQLWG-------HTDRNVGRR  57

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                 L++ +  LGPTFIKVGQ+LSTRPD++  +  ++ T  Q
Sbjct  58   --SVQLRKLLTDLGPTFIKVGQALSTRPDLVRKDYLEELTQLQ  98



>gb|EAZ93001.1| ABC1-like protein [Cyanothece sp. CCY0110]
Length=682

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 52/96 (54%), Gaps = 12/96 (13%)
 Frame = +1

Query  448  TGPLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDR  618
            T P   +Y+P  + +Y++ R   V  RL+ VF  FA   I     +I G  P       +
Sbjct  61   TSPESWQYNPDVINEYYRQRLPQVVGRLITVFVLFARFAIGLWWDKIRGKNPK------Q  114

Query  619  ETSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            E  R +    L+E +  LGPT+IKVGQ+LSTRPD++
Sbjct  115  ERKRAIH---LREMLTELGPTYIKVGQALSTRPDLV  147



>ref|WP_040054215.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 gb|KFF42060.1| putative unusual protein kinase [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=644

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIF-GILPTMNTEIDRETSRYVFG  642
            +Y P E+  Y++     VA RL+ +F+ F+S   IF+++   L   N + D   + +   
Sbjct  42   QYSPNEINKYYRKHIFKVANRLIRIFSCFSS--FIFKLWWSRLIGKNIKEDANQAIH---  96

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L++ +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   --LRKILTELGPTYIKIGQALSTRPDLV  122



>ref|WP_041619779.1| hypothetical protein [Stanieria cyanosphaera]
Length=563

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            KYDPQ +A+Y++ RP +V +R +++   F       Q          ++++   R     
Sbjct  11   KYDPQAIAEYYRYRPWLVFWRGIKIIWFFGIFFFHLQ----WDKWTKQVEKNKLRR--AT  64

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  65   ELRQLLTKLGPTFIKVGQALSTRPDLI  91



>gb|AHJ26841.1| Ubiquinone biosynthesis monooxygenase UbiB [Nodularia spumigena 
CCY9414]
Length=675

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL--PTMNTEIDRETSRYVFG  642
            YDPQE+  Y++ RP     ++L+   A    TI F +FG+         + +E  R V  
Sbjct  54   YDPQEIGAYYRKRP----LKVLQRIFAVLGPTISF-VFGLWWDSRRGIVVKKERRRAV--  106

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+E +  LGP +IK+GQ+LSTRPD++
Sbjct  107  -QLRELLTKLGPAYIKIGQALSTRPDLV  133



>ref|WP_016873798.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=571

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 14/103 (14%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEV---FTAFASATIIFQIFGILPTMNTEIDR-ETSRY  633
            +YDP  +A Y++ RP +   R L +   FT F        IFG+    +  +++ E ++ 
Sbjct  12   RYDPDAIARYYRYRPWLAFARALVIIWNFTGF--------IFGL--KWDEWLNQVEQNKL  61

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                 L++ +  LGPTFIKVGQ+LSTRPD++  +  ++    Q
Sbjct  62   KRAVQLRQMLTRLGPTFIKVGQALSTRPDLVRKDFLEELVKLQ  104



>ref|WP_017803762.1| hypothetical protein [Nodularia spumigena]
Length=671

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL--PTMNTEIDRETSRYVFG  642
            YDPQE+  Y++ RP     ++L+   A    TI F +FG+         + +E  R V  
Sbjct  50   YDPQEIGAYYRKRP----LKVLQRIFAVLGPTISF-VFGLWWDSRRGIVVKKERRRAV--  102

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+E +  LGP +IK+GQ+LSTRPD++
Sbjct  103  -QLRELLTKLGPAYIKIGQALSTRPDLV  129



>ref|WP_008232439.1| Ubiquinone biosynthesis monooxygenase UbiB [Richelia intracellularis]
 emb|CCH66679.1| Ubiquinone biosynthesis monooxygenase UbiB [Richelia intracellularis 
HH01]
Length=661

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +Y+ +E+A Y++ RP  V  R++ + T     TI F +FG+       I  E  R+    
Sbjct  49   RYNSEEIAAYYQRRPLKVLQRIVRILTP----TITF-VFGLWWDNKWGISVENERH-HAV  102

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L+E +  LGP ++K+GQ+LSTRPD++
Sbjct  103  RLRELLTKLGPAYVKIGQALSTRPDLV  129



>ref|WP_041032877.1| hypothetical protein [Tolypothrix campylonemoides]
 gb|KIJ78705.1| hypothetical protein SD81_05130 [Tolypothrix campylonemoides 
VB511288]
Length=565

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YDP+ +A Y+  RP +   R ++V   FA   +       L         E +++    
Sbjct  13   RYDPKAIARYYGYRPWLAWARAIKVIWFFAVFILS------LKWDEWRNQEEQNKFKRAV  66

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L++ ++ LGPTFIKVGQ+LSTRPD+I
Sbjct  67   QLRQLLIRLGPTFIKVGQALSTRPDLI  93



>ref|WP_041269011.1| hypothetical protein [Geitlerinema sp. PCC 7407]
Length=561

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 12/91 (13%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR---ETSRY  633
            ++YD   +A Y++ RP  +  R L         TIIF     L  +  +  R   E +++
Sbjct  2    QRYDAAAIARYYRSRPWEIIGRAL---------TIIFSFLNFLAGIQWDKWRHQEEANKF  52

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                 L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  53   KRASQLRQILTRLGPTFIKVGQALSTRPDLI  83



>ref|WP_009768695.1| putative unusual protein kinase [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ67902.1| putative unusual protein kinase [Oscillatoriales cyanobacterium 
JSC-12]
Length=678

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 54/95 (57%), Gaps = 10/95 (11%)
 Frame = +1

Query  454  PLPE----KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRE  621
            P PE    +YDP+ ++ Y++ RP  V  R++++F  F   T  F  +      N+ +  +
Sbjct  51   PTPEIEGLRYDPEIISAYYQRRPLQVWVRIVQIF--FPLLTFGFSWWW---RRNSAVSEQ  105

Query  622  TSRYVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
              R      L+ET+  LGP FIKVGQ+LSTRPD++
Sbjct  106  RQRRQ-AIRLRETLTRLGPAFIKVGQALSTRPDLV  139



>gb|AFZ34679.1| ABC-1 domain-containing protein [Stanieria cyanosphaera PCC 7437]
Length=612

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            KYDPQ +A+Y++ RP +V +R +++   F       Q          ++++   R     
Sbjct  60   KYDPQAIAEYYRYRPWLVFWRGIKIIWFFGIFFFHLQ----WDKWTKQVEKNKLRR--AT  113

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
             L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  114  ELRQLLTKLGPTFIKVGQALSTRPDLI  140



>gb|AFY66942.1| ABC-1 domain-containing protein [Geitlerinema sp. PCC 7407]
Length=579

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 12/91 (13%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR---ETSRY  633
            ++YD   +A Y++ RP  +  R L         TIIF     L  +  +  R   E +++
Sbjct  20   QRYDAAAIARYYRSRPWEIIGRAL---------TIIFSFLNFLAGIQWDKWRHQEEANKF  70

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                 L++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  71   KRASQLRQILTRLGPTFIKVGQALSTRPDLI  101



>ref|WP_002770082.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI03807.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=663

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+P+ + DY++ RP  V  RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPEVINDYYRRRPLDVLGRLIEIALPVLSFVIGIWSDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLV  125



>ref|WP_042203081.1| hypothetical protein, partial [Nodularia spumigena]
Length=458

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL--PTMNTEIDRETSRYVFG  642
            YDPQE+  Y++ RP     ++L+   A    TI F +FG+         + +E  R V  
Sbjct  50   YDPQEIGAYYRKRP----LKVLQRIFAVLGPTISF-VFGLWWDSRRGIVVKKERRRAV--  102

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+E +  LGP +IK+GQ+LSTRPD++
Sbjct  103  -QLRELLTKLGPAYIKIGQALSTRPDLV  129



>ref|WP_006089855.1| ABC transporter [Natronorubrum tibetense]
 gb|ELY41038.1| ABC transporter [Natronorubrum tibetense GA33]
Length=571

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = +1

Query  514  IVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKV  693
            +VA++ L +  AFA     F +FG     +  +D ET R+    VL E++L+LGPTFIK+
Sbjct  2    LVAWQFLPLLVAFARDRRRFLLFG----RSRRVDPETHRH-RAEVLLESLLTLGPTFIKL  56

Query  694  GQSLSTRPDII  726
            GQ LSTRPD++
Sbjct  57   GQLLSTRPDVL  67



>ref|XP_010921140.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Elaeis guineensis]
Length=701

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (53%), Gaps = 8/99 (8%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEID-RETSRYVFGC  645
            Y PQ +A  +  +P  V  R LEV TA    T  F++F  L    +E+D R+  R     
Sbjct  88   YSPQLLATKYGSQPLKVVLRTLEVLTALG--TFGFKLF--LDDRRSELDLRKRQR---AA  140

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E    LG TF+K+GQ LSTRPDI   E  ++ +  Q
Sbjct  141  ELREIFTRLGATFVKIGQGLSTRPDICPPEYLEELSQLQ  179



>gb|EAW42854.1| ABC-1 [Nodularia spumigena CCY9414]
Length=462

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL--PTMNTEIDRETSRYVFG  642
            YDPQE+  Y++ RP     ++L+   A    TI F +FG+         + +E  R V  
Sbjct  54   YDPQEIGAYYRKRP----LKVLQRIFAVLGPTISF-VFGLWWDSRRGIVVKKERRRAV--  106

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDII  726
              L+E +  LGP +IK+GQ+LSTRPD++
Sbjct  107  -QLRELLTKLGPAYIKIGQALSTRPDLV  133



>ref|XP_006854268.1| hypothetical protein AMTR_s00039p00053980 [Amborella trichopoda]
 gb|ERN15735.1| hypothetical protein AMTR_s00039p00053980 [Amborella trichopoda]
Length=751

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 55/92 (60%), Gaps = 10/92 (11%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGIL-PTMNTEI-DRETSR  630
            LP  YDP  ++ Y+  RPH VA R++++ +          + G+L   +N ++ + E +R
Sbjct  138  LPLVYDPVVISSYWGKRPHAVATRIVQLLSVAGGF-----LSGLLWDVINKKVKENEVAR  192

Query  631  YVFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
             +    L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  193  AI---ELREIVTSLGPAYIKLGQALSIRPDIL  221



>ref|XP_009414258.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=715

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            YDPQ +A  +  +P  V  R LE+FTA  +    F +  +      ++D+   +      
Sbjct  102  YDPQLLAAKYAAQPLKVLSRTLEIFTALGT----FALKLVADQRRGQLDQRKRQR--AAE  155

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L +T   LGPTF+K+GQ LSTRPD+   E  ++ +  Q
Sbjct  156  LTKTFTRLGPTFVKIGQGLSTRPDVCPPEYLEELSELQ  193



>emb|CBJ31164.1| ABC1-like [Ectocarpus siliculosus]
Length=988

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 6/91 (7%)
 Frame = +1

Query  454  PLPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRY  633
            PLP +YD  ++  Y++ +P +VA R +EV  + AS   +  +   + T N     + +  
Sbjct  152  PLPTEYDLDQLDAYYRRKPLVVAVRFVEVSASLAS--FLLNVLADVLTNNW----DKNMA  205

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            V    ++E   S GP FIKVGQ  S RPDI+
Sbjct  206  VRAVQMREFTSSNGPAFIKVGQGASIRPDIL  236



>ref|WP_041456584.1| hypothetical protein [Anabaena variabilis]
Length=572

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P  +A Y++ RP +   RL ++  +FA    +F +         ++++   +    
Sbjct  10   KRYNPDAIARYYRFRPWLAWGRLFKITWSFA----MFVLGLKWDEWQNQVEQNKGKR--A  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  64   TQLRQLLTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



>gb|EYU31735.1| hypothetical protein MIMGU_mgv1a001580mg [Erythranthe guttata]
Length=791

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 6/90 (7%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            LP  YDP  +A Y+  RP  VA R++++ T+ A   +   ++ ++   N +I     R  
Sbjct  134  LPMVYDPDTIASYWGKRPRAVATRIVQL-TSVAGGFLSRLVWDLI---NNKIKENEVRR-  188

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  189  -AIELREIVTSLGPAYIKLGQALSIRPDIL  217



>ref|WP_040054212.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 gb|KFF42056.1| putative unusual protein kinase [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=560

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 7/91 (8%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            +KYD  E+A Y+  RP  V  R + +  +F    I  Q        N   D +  R    
Sbjct  19   KKYDANEIALYYSSRPWQVVKRAIFIVWSFGWFFIHIQ----WDRFNNRRDSKKRR---S  71

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSE  735
              L++ + +LGPTFIKVGQ+LSTRPD+I  E
Sbjct  72   IELRQILTNLGPTFIKVGQALSTRPDLIHPE  102



>gb|ABA19944.1| ABC-1 [Anabaena variabilis ATCC 29413]
Length=592

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++Y+P  +A Y++ RP +   RL ++  +FA    +F +         ++++   +    
Sbjct  30   KRYNPDAIARYYRFRPWLAWGRLFKITWSFA----MFVLGLKWDEWQNQVEQNKGKR--A  83

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L++ +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  84   TQLRQLLTRLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  123



>ref|WP_024546110.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=654

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATI-IFQIFGILPTMNTEIDRETSRYVFG  642
            +Y+P+ +   +K  P  V  RLL + T+F+S  I I+    I    N +  ++ +     
Sbjct  24   RYNPEAIEARYKNEPFAVLGRLLTIITSFSSLLINIWWAKAIGTNKNPKTQKQQADQ---  80

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              LK  +  LGPT+IK+GQ+LSTRPD++      + TS Q
Sbjct  81   --LKRILTKLGPTYIKIGQALSTRPDLVPPVYLSELTSLQ  118



>ref|WP_011933445.1| hypothetical protein [Synechococcus sp. WH 7803]
 emb|CAK23968.1| Predicted protein kinase [Synechococcus sp. WH 7803]
Length=548

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 7/87 (8%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +Y+P   A +  LRP I   R+L++  A +   +   I G   + ++++ +  +R     
Sbjct  2    RYNPGRDARWLLLRPWIAVPRILQIVWALSGLVLSLLIRG--NSSDSKVQKNLAR-----  54

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDII  726
            +L  T+ +LGP FIKVGQ+LSTRPD+I
Sbjct  55   MLLRTLTNLGPCFIKVGQALSTRPDLI  81



>ref|WP_017971415.1| hypothetical protein [alpha proteobacterium SCGC AAA027-L15]
Length=522

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = +1

Query  532  LEVFTAF----ASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
            L +F  F     S  ++ +IFG      T  +++++    G  LK   L+LGP FIK+GQ
Sbjct  21   LSIFEEFYKPPLSIKVLIKIFGF-----TTFNKDSANKSAGERLKNAFLTLGPAFIKLGQ  75

Query  700  SLSTRPDIIGSEISKKSTSXQ  762
             L+TRPDI+G E +K+    Q
Sbjct  76   FLATRPDIVGEEFAKELQQLQ  96



>ref|XP_001418122.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96415.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=788

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 51/90 (57%), Gaps = 6/90 (7%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            LP  YDP+ +A+Y+  RP  VA R+ ++ T   S      I GI+    T+   E +   
Sbjct  162  LPLYYDPELIANYWSRRPAAVAQRVAQLSTIGGSF-----ITGIISDFVTKSVEENA-VK  215

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  216  RAIQLREIVTSLGPAYIKLGQALSIRPDIL  245



>gb|AIU50325.1| ABC1-like kinase, partial [Yucca filamentosa]
Length=615

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            Y PQ +A  +  RP  VA R LE+FT   +    F +  +L      +D+   +      
Sbjct  10   YSPQLLAQKYGSRPIKVALRTLEIFTGLGT----FALKLLLDDRQGLLDQRKRQR--AAE  63

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L+     LGPTF+K+GQ LSTRPDI   E  ++ +  Q
Sbjct  64   LRGIFTRLGPTFVKIGQGLSTRPDICPPEYIEELSELQ  101



>ref|WP_017943311.1| hypothetical protein [alpha proteobacterium SCGC AAA027-C06]
Length=522

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = +1

Query  532  LEVFTAF----ASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKETMLSLGPTFIKVGQ  699
            L +F  F     S  ++ +IFG      T  +++++    G  LK   L+LGP FIK+GQ
Sbjct  21   LSIFEEFYKTPLSIKVLIKIFGF-----TTFNKDSANKSAGERLKNAFLTLGPAFIKLGQ  75

Query  700  SLSTRPDIIGSEISKKSTSXQ  762
             L+TRPDI+G E +K+    Q
Sbjct  76   FLATRPDIVGEEFAKELQQLQ  96



>ref|WP_012161966.1| hypothetical protein [Acaryochloris marina]
 gb|ABW26434.1| ABC-1 family protein [Acaryochloris marina MBIC11017]
Length=571

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 53/89 (60%), Gaps = 8/89 (9%)
 Frame = +1

Query  463  EKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFG  642
            ++YD +++A Y++ RP    +RL+ + + F        I+G+L    T     T+ Y   
Sbjct  17   QRYDARKIASYYRWRPWKALWRLIYIISLFNGF-----IWGLLWDRWTHT--STAHYPQR  69

Query  643  CV-LKETMLSLGPTFIKVGQSLSTRPDII  726
             + +++ +  LGPTFIKVGQ+LSTRPD+I
Sbjct  70   AIQIRKILTQLGPTFIKVGQALSTRPDLI  98



>ref|XP_003516441.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006573417.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Glycine max]
 gb|KHN47909.1| Putative aarF domain-containing protein kinase, chloroplastic 
[Glycine soja]
Length=726

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 12/101 (12%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTA---FASATIIFQIFGILPTMNTEIDRETSRYVF  639
            Y PQ VA  +  +P  V  R L+V +A   F    ++ Q  G+L         + ++ + 
Sbjct  114  YTPQLVASKYGSQPIKVVGRALQVLSAVGLFGLKLLLDQKSGVL---------DQNKRIR  164

Query  640  GCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
               L++T   LGPTF+K+GQ LSTRPDI  +E  ++ T  Q
Sbjct  165  AIELRDTFTRLGPTFVKLGQGLSTRPDICPAEYLEELTELQ  205



>ref|XP_010241145.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Nelumbo nucifera]
Length=793

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEI-DRETSRY  633
            LP  YDP  ++ Y+  RP  VA R++++ +        F    +L  +N ++ + E +R 
Sbjct  139  LPLVYDPVSISSYWGKRPRAVATRIVQLLSVAGG----FLSRLLLDVINNKVKENEVARA  194

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            +    L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  195  I---ELREIVTSLGPAYIKLGQALSIRPDIL  222



>ref|XP_007508517.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20134.1| predicted protein [Bathycoccus prasinos]
Length=767

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 51/95 (54%), Gaps = 7/95 (7%)
 Frame = +1

Query  481  EVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCVLKET  660
            ++  +FK  P  +A R  EV   F+S   +  I+     M+  +++ T        L++ 
Sbjct  69   KINQFFKSNPLELAARCGEVIAQFSS---VLAIWKYEDAMDIPLEKRTR----AGKLRDV  121

Query  661  MLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQQ  765
            +  LGP F+K+ Q+LSTRPDIIG E++    + QQ
Sbjct  122  VAKLGPVFVKLAQTLSTRPDIIGEEVADALMTLQQ  156



>ref|WP_015225890.1| ABC-1 domain-containing protein [Halothece sp. PCC 7418]
 gb|AFZ44015.1| ABC-1 domain-containing protein [Halothece sp. PCC 7418]
Length=668

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVF---TAFASATIIFQIFGILPTMNTEIDRETSRYV  636
            +YDP+ + +Y++ RP  V  RL+ +    TAF    +  ++ G +         E  R  
Sbjct  48   RYDPERINNYYRNRPLSVFRRLIALIFPGTAFGVRLLFDKLTGRIAK------NEQKR--  99

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
                L+E +  LGPT+IK+GQ+LSTRPD++
Sbjct  100  -AIELREILTELGPTYIKIGQALSTRPDLV  128



>gb|KFK39723.1| hypothetical protein AALP_AA3G280000 [Arabis alpina]
Length=786

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEI-DRETSRY  633
            LP  YDP  ++ Y+  RP  VA R++++ +   +   + +I G    +N ++ + E SR 
Sbjct  131  LPLVYDPDTISAYWGKRPRAVATRVIQLLSV--AGGFLSRIAG--DVINKKVKENEVSRA  186

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            +    L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  187  I---ELREIVTSLGPAYIKLGQALSIRPDIL  214



>dbj|BAD80505.1| hypothetical protein [Synechococcus elongatus PCC 6301]
Length=622

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            YDP+ +A Y+  RP  V  R LE+     S      IFG+     T   R          
Sbjct  22   YDPEAIARYYLNRPFAVWSRFLEILWPLFSF-----IFGLWFDARTGASRRNQNQR-AVQ  75

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++ +  LGP FIKVGQ+LSTRPD++     ++ T  Q
Sbjct  76   LRDLLTELGPAFIKVGQALSTRPDLVPPAYLEELTRLQ  113



>gb|KFK39722.1| hypothetical protein AALP_AA3G280000 [Arabis alpina]
Length=778

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEI-DRETSRY  633
            LP  YDP  ++ Y+  RP  VA R++++ +   +   + +I G    +N ++ + E SR 
Sbjct  123  LPLVYDPDTISAYWGKRPRAVATRVIQLLSV--AGGFLSRIAG--DVINKKVKENEVSRA  178

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            +    L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  179  I---ELREIVTSLGPAYIKLGQALSIRPDIL  206



>ref|WP_012267363.1| hypothetical protein [Microcystis aeruginosa]
 dbj|BAG04706.1| hypothetical protein MAE_48840 [Microcystis aeruginosa NIES-843]
Length=663

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 12/102 (12%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIF---QIFGILPTMNTEIDRETSRYV  636
            +Y+PQ + DY++ RP     RL+E+     S  I     ++ G  P    EI R      
Sbjct  45   RYNPQVINDYYRRRPLDFLGRLIEIALPVLSFVIGIWWDKLRGKSP--KNEIRR------  96

Query  637  FGCVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
                L+E +  LGPT+IK+GQ+LSTRPD++     ++ T+ Q
Sbjct  97   -AVQLREMLTKLGPTYIKIGQALSTRPDLVPPLYLEELTTLQ  137



>ref|XP_002518128.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis]
 gb|EEF44261.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis]
Length=804

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 8/91 (9%)
 Frame = +1

Query  457  LPEKYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEI-DRETSRY  633
            LP  YDP  +A Y+  RP  VA R++++ +        F     L  +N ++ + E +R 
Sbjct  153  LPLVYDPASIASYWGNRPRAVATRIVQLLSVAGG----FLSRIALDVINKKVKENEVARA  208

Query  634  VFGCVLKETMLSLGPTFIKVGQSLSTRPDII  726
            +    L+E + SLGP +IK+GQ+LS RPDI+
Sbjct  209  I---ELREIVTSLGPAYIKLGQALSIRPDIL  236



>ref|WP_011378187.1| MULTISPECIES: hypothetical protein [Synechococcus]
 gb|ABB57808.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD57707.1| hypothetical protein M744_07590 [Synechococcus sp. UTEX 2973]
Length=619

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = +1

Query  469  YDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGCV  648
            YDP+ +A Y+  RP  V  R LE+     S      IFG+     T   R          
Sbjct  19   YDPEAIARYYLNRPFAVWSRFLEILWPLFSF-----IFGLWFDARTGASRRNQNQR-AVQ  72

Query  649  LKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
            L++ +  LGP FIKVGQ+LSTRPD++     ++ T  Q
Sbjct  73   LRDLLTELGPAFIKVGQALSTRPDLVPPAYLEELTRLQ  110



>ref|WP_040932777.1| hypothetical protein [Prochloron didemni]
Length=572

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDRETSRYVFGC  645
            +YD + +A +++ RP  V +R L V   FA+  +       L         E  ++    
Sbjct  20   RYDAEAIARHYRYRPWQVIWRTLTVIGFFATFMLHLLWDKWLKQ------EEEKKFQRAR  73

Query  646  VLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
             L+E +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  74   ELRELLTKLGPTFIKVGQALSTRPDLIRQDFLEELIKLQ  112



>ref|WP_019497415.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=571

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 8/100 (8%)
 Frame = +1

Query  466  KYDPQEVADYFKLRPHIVAFRLLEVFTAFASATIIFQIFGILPTMNTEIDR-ETSRYVFG  642
            +Y P  VA Y++ RP  V  R +++   FA       I G+    +   DR E ++    
Sbjct  11   RYSPDAVASYYRFRPWRVWARAIKIIWNFAGF-----ILGL--KSDEWFDRVEQNKLKRA  63

Query  643  CVLKETMLSLGPTFIKVGQSLSTRPDIIGSEISKKSTSXQ  762
              L+  +  LGPTFIKVGQ+LSTRPD+I  +  ++    Q
Sbjct  64   TQLRMMLTKLGPTFIKVGQALSTRPDLIRKDFLEELIKLQ  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570