BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043I04

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...    199   5e-55   Nicotiana tomentosiformis
ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...    194   2e-53   Nicotiana sylvestris
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...    194   3e-53   Nicotiana tomentosiformis
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...    193   7e-53   Solanum lycopersicum
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...    193   8e-53   Solanum lycopersicum
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...    190   7e-52   Nicotiana tomentosiformis
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...    190   9e-52   Nicotiana tomentosiformis
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...    189   1e-51   Nicotiana sylvestris
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like             189   1e-51   Solanum tuberosum [potatoes]
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like               187   1e-50   Solanum tuberosum [potatoes]
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306    187   1e-50   Nicotiana sylvestris
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...    182   6e-49   
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...    182   6e-49   Sesamum indicum [beniseed]
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351    180   3e-48   Solanum lycopersicum
ref|XP_002519742.1|  conserved hypothetical protein                     180   3e-48   Ricinus communis
emb|CBI30819.3|  unnamed protein product                                179   4e-48   Vitis vinifera
ref|XP_010655630.1|  PREDICTED: protein lingerer-like                   179   8e-48   Vitis vinifera
ref|XP_006369885.1|  hypothetical protein POPTR_0001s34440g             176   9e-47   
gb|KDO78065.1|  hypothetical protein CISIN_1g0026402mg                  172   3e-46   Citrus sinensis [apfelsine]
gb|KDO78063.1|  hypothetical protein CISIN_1g0026402mg                  172   3e-46   Citrus sinensis [apfelsine]
gb|KDO78068.1|  hypothetical protein CISIN_1g0026402mg                  172   4e-46   Citrus sinensis [apfelsine]
ref|XP_011005847.1|  PREDICTED: uncharacterized protein LOC105112...    174   4e-46   Populus euphratica
ref|XP_011005848.1|  PREDICTED: uncharacterized protein LOC105112...    174   5e-46   Populus euphratica
gb|KHG18569.1|  Protein translocase subunit SecA                        174   5e-46   Gossypium arboreum [tree cotton]
gb|KDO78064.1|  hypothetical protein CISIN_1g0026402mg                  172   8e-46   Citrus sinensis [apfelsine]
ref|XP_011045308.1|  PREDICTED: uncharacterized protein LOC105140...    174   8e-46   Populus euphratica
ref|XP_011045309.1|  PREDICTED: uncharacterized protein LOC105140...    174   9e-46   Populus euphratica
gb|KJB57295.1|  hypothetical protein B456_009G157400                    173   1e-45   Gossypium raimondii
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...    172   3e-45   Citrus sinensis [apfelsine]
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...    172   3e-45   
ref|XP_007025176.1|  Uncharacterized protein TCM_029557                 171   8e-45   
ref|XP_011045310.1|  PREDICTED: uncharacterized protein LOC105140...    169   3e-44   Populus euphratica
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg             169   5e-44   Citrus clementina [clementine]
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg             169   5e-44   
gb|KHF99174.1|  hypothetical protein F383_17166                         168   7e-44   Gossypium arboreum [tree cotton]
gb|KHF99173.1|  hypothetical protein F383_17166                         168   8e-44   Gossypium arboreum [tree cotton]
gb|KJB69764.1|  hypothetical protein B456_011G041100                    165   3e-43   Gossypium raimondii
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549    167   3e-43   
gb|KJB69767.1|  hypothetical protein B456_011G041100                    165   3e-43   Gossypium raimondii
gb|KJB69766.1|  hypothetical protein B456_011G041100                    164   7e-43   Gossypium raimondii
ref|XP_011005846.1|  PREDICTED: uncharacterized protein LOC105112...    165   1e-42   Populus euphratica
ref|XP_011005845.1|  PREDICTED: uncharacterized protein LOC105112...    165   1e-42   Populus euphratica
gb|KJB69763.1|  hypothetical protein B456_011G041100                    164   2e-42   Gossypium raimondii
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g             164   2e-42   
gb|KJB69765.1|  hypothetical protein B456_011G041100                    164   2e-42   Gossypium raimondii
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...    164   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002317304.2|  kinase-related family protein                      164   3e-42   
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...    163   4e-42   
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...    162   6e-42   
emb|CDP17325.1|  unnamed protein product                                162   1e-41   Coffea canephora [robusta coffee]
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g             161   2e-41   Phaseolus vulgaris [French bean]
ref|XP_009353842.1|  PREDICTED: uncharacterized protein LOC103945...    161   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...    161   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009353840.1|  PREDICTED: uncharacterized protein LOC103945...    161   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_009353841.1|  PREDICTED: uncharacterized protein LOC103945...    161   3e-41   
ref|XP_009353839.1|  PREDICTED: uncharacterized protein LOC103945...    161   3e-41   
ref|XP_009353838.1|  PREDICTED: uncharacterized protein LOC103945...    161   3e-41   
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...    161   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...    160   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...    160   8e-41   Cicer arietinum [garbanzo]
ref|XP_008366008.1|  PREDICTED: protein lingerer-like                   159   2e-40   
ref|XP_008364176.1|  PREDICTED: uncharacterized protein LOC103427...    157   1e-39   
ref|XP_008364175.1|  PREDICTED: uncharacterized protein LOC103427...    156   1e-39   
ref|XP_008364174.1|  PREDICTED: uncharacterized protein LOC103427...    156   1e-39   
gb|KHN48057.1|  hypothetical protein glysoja_015527                     155   2e-39   Glycine soja [wild soybean]
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...    155   4e-39   Glycine max [soybeans]
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...    152   4e-38   Glycine max [soybeans]
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...    152   4e-38   Glycine max [soybeans]
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g             152   5e-38   Phaseolus vulgaris [French bean]
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg                152   6e-38   Erythranthe guttata [common monkey flower]
ref|XP_007214618.1|  hypothetical protein PRUPE_ppa001304mg             151   7e-38   Prunus persica
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593    151   1e-37   Elaeis guineensis
ref|XP_010549430.1|  PREDICTED: uncharacterized protein LOC104820614    150   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...    150   1e-37   Phoenix dactylifera
ref|XP_010540528.1|  PREDICTED: uncharacterized protein LOC104814266    150   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_008225366.1|  PREDICTED: dentin sialophosphoprotein isofor...    150   3e-37   Prunus mume [ume]
ref|XP_008225365.1|  PREDICTED: dentin sialophosphoprotein isofor...    150   3e-37   Prunus mume [ume]
gb|AFK38455.1|  unknown                                                 146   3e-37   Medicago truncatula
ref|XP_011460396.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    149   7e-37   Fragaria vesca subsp. vesca
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...    148   8e-37   Cucumis melo [Oriental melon]
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...    148   1e-36   Cicer arietinum [garbanzo]
gb|KHN22963.1|  hypothetical protein glysoja_030633                     148   1e-36   Glycine soja [wild soybean]
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                  148   1e-36   Medicago truncatula
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like               147   2e-36   Elaeis guineensis
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211388    147   3e-36   Cucumis sativus [cucumbers]
ref|XP_010056862.1|  PREDICTED: uncharacterized protein LOC104444...    145   7e-36   Eucalyptus grandis [rose gum]
ref|XP_010056860.1|  PREDICTED: uncharacterized protein LOC104444...    145   8e-36   Eucalyptus grandis [rose gum]
ref|XP_010056861.1|  PREDICTED: uncharacterized protein LOC104444...    145   8e-36   Eucalyptus grandis [rose gum]
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...    145   1e-35   Cucumis melo [Oriental melon]
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...    144   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_004162612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   3e-35   
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   4e-35   
ref|XP_009395691.1|  PREDICTED: mucin-17-like                           143   7e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730          142   1e-34   
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...    142   1e-34   
gb|KGN49366.1|  hypothetical protein Csa_6G522110                       142   1e-34   Cucumis sativus [cucumbers]
gb|KDP21205.1|  hypothetical protein JCGZ_21676                         142   2e-34   Jatropha curcas
gb|KHN14369.1|  hypothetical protein glysoja_012407                     141   2e-34   Glycine soja [wild soybean]
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...    141   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009115248.1|  PREDICTED: putative uncharacterized protein ...    140   7e-34   
emb|CDY48333.1|  BnaA09g26880D                                          139   2e-33   Brassica napus [oilseed rape]
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...    139   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...    139   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...    138   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538220.1|  PREDICTED: uncharacterized protein LOC104812...    138   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_010538221.1|  PREDICTED: uncharacterized protein LOC104812...    138   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...    138   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006415581.1|  hypothetical protein EUTSA_v10006794mg             138   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...    138   4e-33   Setaria italica
ref|XP_006415582.1|  hypothetical protein EUTSA_v10006794mg             138   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010559257.1|  PREDICTED: uncharacterized protein LOC104827...    137   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_010559258.1|  PREDICTED: uncharacterized protein LOC104827...    137   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_010559260.1|  PREDICTED: uncharacterized protein LOC104827...    137   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_010559259.1|  PREDICTED: uncharacterized protein LOC104827...    137   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like             137   5e-33   
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...    137   6e-33   
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...    137   7e-33   
emb|CDX94662.1|  BnaC07g09960D                                          137   7e-33   
emb|CDY15632.1|  BnaA07g08030D                                          136   1e-32   Brassica napus [oilseed rape]
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...    136   1e-32   Setaria italica
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...    136   1e-32   
ref|XP_003567874.1|  PREDICTED: uncharacterized protein LOC100840916    134   8e-32   Brachypodium distachyon [annual false brome]
ref|XP_004969440.1|  PREDICTED: putative GPI-anchored protein PB1...    134   9e-32   Setaria italica
ref|NP_174230.2|  Kinase-related protein                                133   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306765.1|  hypothetical protein CARUB_v10008305mg             132   3e-31   Capsella rubella
ref|XP_006306766.1|  hypothetical protein CARUB_v10008305mg             132   3e-31   Capsella rubella
ref|XP_010478296.1|  PREDICTED: probable serine/threonine-protein...    132   4e-31   
ref|XP_009102862.1|  PREDICTED: uncharacterized protein LOC103828...    132   5e-31   Brassica rapa
ref|XP_009102861.1|  PREDICTED: uncharacterized protein LOC103828...    132   5e-31   Brassica rapa
ref|XP_004969439.1|  PREDICTED: putative GPI-anchored protein PB1...    132   5e-31   Setaria italica
gb|EEC79711.1|  hypothetical protein OsI_21014                          131   8e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001056347.1|  Os05g0566900                                       131   8e-31   
ref|XP_010460715.1|  PREDICTED: putative uncharacterized protein ...    130   1e-30   
ref|XP_010460714.1|  PREDICTED: putative uncharacterized protein ...    130   1e-30   Camelina sativa [gold-of-pleasure]
gb|AFW83477.1|  putative DUF1296 domain containing family protein       127   1e-30   
ref|XP_006827353.1|  hypothetical protein AMTR_s00011p00072820          130   1e-30   Amborella trichopoda
dbj|BAJ85689.1|  predicted protein                                      130   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92311.1|  predicted protein                                      130   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY43334.1|  BnaC03g59060D                                          129   3e-30   Brassica napus [oilseed rape]
gb|AAL58943.1|AF462857_1  At1g29350/F15D2_27                            129   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174229.2|  uncharacterized protein                               129   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AFW83478.1|  putative DUF1296 domain containing family protein       127   1e-29   
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756    128   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010499452.1|  PREDICTED: RNA polymerase II degradation fac...    127   1e-29   
emb|CDJ26391.1|  unnamed protein product                                127   2e-29   Triticum aestivum [Canadian hard winter wheat]
emb|CDX90188.1|  BnaA08g17960D                                          127   3e-29   
ref|XP_010666705.1|  PREDICTED: uncharacterized protein LOC104883...    127   3e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666704.1|  PREDICTED: uncharacterized protein LOC104883...    127   3e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002893558.1|  hypothetical protein ARALYDRAFT_473146             126   5e-29   
ref|XP_008656717.1|  PREDICTED: uncharacterized protein LOC103636139    125   7e-29   
emb|CDX84653.1|  BnaA03g15770D                                          125   8e-29   
ref|NP_001043788.1|  Os01g0663800                                       125   1e-28   
ref|XP_006410568.1|  hypothetical protein EUTSA_v10016218mg             124   2e-28   
ref|XP_006410567.1|  hypothetical protein EUTSA_v10016218mg             124   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_006410569.1|  hypothetical protein EUTSA_v10016218mg             124   3e-28   
ref|XP_009109669.1|  PREDICTED: RNA polymerase II degradation fac...    123   4e-28   Brassica rapa
ref|XP_009109668.1|  PREDICTED: RNA polymerase II degradation fac...    123   4e-28   Brassica rapa
ref|XP_003569505.1|  PREDICTED: uncharacterized protein LOC100846...    121   2e-27   Brachypodium distachyon [annual false brome]
emb|CDY61669.1|  BnaC01g40800D                                          120   5e-27   Brassica napus [oilseed rape]
ref|XP_002881327.1|  hypothetical protein ARALYDRAFT_321144             119   8e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010232108.1|  PREDICTED: uncharacterized protein LOC100846...    119   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...    119   1e-26   Fragaria vesca subsp. vesca
ref|XP_009141365.1|  PREDICTED: RNA polymerase II degradation fac...    118   3e-26   Brassica rapa
gb|AAG51735.1|AC068667_14  unknown protein; 25451-20507                 118   3e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43685.1|  BnaA04g20060D                                          117   4e-26   Brassica napus [oilseed rape]
ref|XP_009132981.1|  PREDICTED: uncharacterized protein LOC103857526    117   4e-26   Brassica rapa
ref|XP_009131438.1|  PREDICTED: flocculation protein FLO11              117   5e-26   Brassica rapa
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...    116   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...    116   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010413764.1|  PREDICTED: probable serine/threonine-protein...    116   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010413763.1|  PREDICTED: alpha-protein kinase 1-like isofo...    116   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...    115   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...    115   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010434571.1|  PREDICTED: probable serine/threonine-protein...    114   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010434569.1|  PREDICTED: probable serine/threonine-protein...    114   4e-25   Camelina sativa [gold-of-pleasure]
gb|AAG51729.1|AC068667_8  unknown protein; 16040-11188                  114   8e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28493.1|  hypothetical protein AALP_AA7G003100                    112   2e-24   Arabis alpina [alpine rockcress]
gb|KFK28492.1|  hypothetical protein AALP_AA7G003100                    112   2e-24   Arabis alpina [alpine rockcress]
ref|XP_002870069.1|  predicted protein                                  112   4e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_009377414.1|  PREDICTED: uncharacterized protein LOC103966021    110   8e-24   Pyrus x bretschneideri [bai li]
ref|XP_006484855.1|  PREDICTED: uncharacterized protein LOC102628...    109   2e-23   
ref|XP_006484854.1|  PREDICTED: uncharacterized protein LOC102628...    109   2e-23   Citrus sinensis [apfelsine]
gb|KFK36320.1|  hypothetical protein AALP_AA4G107400                    109   3e-23   Arabis alpina [alpine rockcress]
ref|XP_006414144.1|  hypothetical protein EUTSA_v10027504mg             108   5e-23   
ref|XP_009356619.1|  PREDICTED: uncharacterized protein LOC103947...    108   7e-23   Pyrus x bretschneideri [bai li]
ref|XP_010102151.1|  hypothetical protein L484_021385                   108   7e-23   Morus notabilis
ref|XP_009356618.1|  PREDICTED: uncharacterized protein LOC103947...    108   8e-23   Pyrus x bretschneideri [bai li]
ref|XP_009356617.1|  PREDICTED: uncharacterized protein LOC103947...    108   8e-23   Pyrus x bretschneideri [bai li]
ref|XP_006437175.1|  hypothetical protein CICLE_v10033869mg             107   9e-23   
ref|NP_193549.5|  uncharacterized protein                               107   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007048866.1|  Uncharacterized protein TCM_001879                 108   9e-23   
ref|XP_010469381.1|  PREDICTED: uncharacterized protein LOC104749...    102   1e-22   
ref|XP_010469383.1|  PREDICTED: uncharacterized protein LOC104749...    101   2e-22   
gb|AAT44198.1|  unknown protein                                         105   6e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAB53656.1|  hypothetical protein                                   105   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01632.1|  Segment polarity dishevelled DVL-3                      103   3e-21   Gossypium arboreum [tree cotton]
gb|KDP46910.1|  hypothetical protein JCGZ_10401                         103   3e-21   Jatropha curcas
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like             103   3e-21   Prunus mume [ume]
ref|XP_009614043.1|  PREDICTED: uncharacterized protein LOC104107...  98.6    7e-21   Nicotiana tomentosiformis
ref|NP_001056433.1|  Os05g0581800                                       100   4e-20   
ref|XP_004961107.1|  PREDICTED: uncharacterized protein LOC101764...  99.8    5e-20   Setaria italica
ref|NP_001141689.1|  uncharacterized protein LOC100273818             99.0    1e-19   Zea mays [maize]
ref|XP_009614044.1|  PREDICTED: uncharacterized protein LOC104107...  98.6    1e-19   Nicotiana tomentosiformis
gb|KJB75412.1|  hypothetical protein B456_012G040900                  98.6    1e-19   Gossypium raimondii
ref|XP_004961106.1|  PREDICTED: uncharacterized protein LOC101764...  97.8    2e-19   Setaria italica
ref|XP_010230981.1|  PREDICTED: uncharacterized protein LOC100825...  97.1    4e-19   
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...  96.7    6e-19   Zea mays [maize]
ref|XP_003567822.1|  PREDICTED: uncharacterized protein LOC100825...  96.3    7e-19   
dbj|BAJ94362.1|  predicted protein                                    95.9    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001756751.1|  predicted protein                                87.4    2e-18   
ref|XP_007214926.1|  hypothetical protein PRUPE_ppa001246mg           95.1    2e-18   Prunus persica
ref|XP_008229782.1|  PREDICTED: putative GPI-anchored protein PB1...  95.1    2e-18   Prunus mume [ume]
ref|XP_008342251.1|  PREDICTED: chitinase-like protein PB1E7.04c ...  95.1    2e-18   
ref|XP_008229781.1|  PREDICTED: cell wall protein AWA1 isoform X1     95.1    2e-18   Prunus mume [ume]
ref|XP_008342252.1|  PREDICTED: flocculation protein FLO11-like i...  95.1    2e-18   
ref|XP_010323918.1|  PREDICTED: melanoma-associated antigen C1 is...  94.7    3e-18   Solanum lycopersicum
ref|XP_010323917.1|  PREDICTED: melanoma-associated antigen C1 is...  94.7    3e-18   Solanum lycopersicum
ref|XP_010323919.1|  PREDICTED: melanoma-associated antigen C1 is...  94.7    3e-18   Solanum lycopersicum
ref|XP_010323920.1|  PREDICTED: melanoma-associated antigen C1 is...  94.7    3e-18   Solanum lycopersicum
ref|XP_011467308.1|  PREDICTED: endochitinase A isoform X1            94.7    3e-18   Fragaria vesca subsp. vesca
ref|XP_011467310.1|  PREDICTED: endochitinase A isoform X3            94.7    3e-18   Fragaria vesca subsp. vesca
ref|XP_011467309.1|  PREDICTED: endochitinase A isoform X2            94.7    3e-18   Fragaria vesca subsp. vesca
ref|XP_006357673.1|  PREDICTED: flocculation protein FLO11-like i...  94.7    3e-18   
ref|XP_006357672.1|  PREDICTED: flocculation protein FLO11-like i...  94.7    3e-18   
ref|XP_006357671.1|  PREDICTED: flocculation protein FLO11-like i...  94.7    3e-18   
ref|XP_006447832.1|  hypothetical protein CICLE_v10014215mg           94.0    4e-18   Citrus clementina [clementine]
ref|XP_006447831.1|  hypothetical protein CICLE_v10014215mg           94.0    5e-18   Citrus clementina [clementine]
gb|KDO50974.1|  hypothetical protein CISIN_1g006896mg                 93.6    5e-18   Citrus sinensis [apfelsine]
gb|AFW81250.1|  putative DUF1296 domain containing family protein     94.0    5e-18   
gb|AFW81251.1|  putative DUF1296 domain containing family protein     94.0    5e-18   
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...  94.0    5e-18   Zea mays [maize]
ref|XP_009785963.1|  PREDICTED: uncharacterized protein LOC104234...  93.6    5e-18   Nicotiana sylvestris
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg           93.6    6e-18   
emb|CDX78828.1|  BnaA01g08950D                                        93.2    8e-18   
ref|XP_008342489.1|  PREDICTED: uncharacterized protein LOC103405294  93.2    9e-18   
ref|XP_008362365.1|  PREDICTED: uncharacterized protein LOC103426056  93.2    9e-18   
ref|XP_011026252.1|  PREDICTED: uncharacterized protein LOC105126...  93.2    9e-18   Populus euphratica
ref|XP_011026251.1|  PREDICTED: uncharacterized protein LOC105126...  93.2    1e-17   Populus euphratica
ref|XP_011026250.1|  PREDICTED: uncharacterized protein LOC105126...  93.2    1e-17   Populus euphratica
ref|XP_002320531.2|  hypothetical protein POPTR_0014s16780g           92.8    1e-17   
ref|XP_006654800.1|  PREDICTED: uncharacterized protein LOC102700994  92.8    1e-17   Oryza brachyantha
ref|XP_011008079.1|  PREDICTED: flocculation protein FLO11            92.8    1e-17   Populus euphratica
ref|XP_006857739.1|  hypothetical protein AMTR_s00061p00187940        92.8    1e-17   Amborella trichopoda
ref|XP_009361529.1|  PREDICTED: uncharacterized protein LOC103951...  92.4    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_009361530.1|  PREDICTED: mucin-12 isoform X2                   92.4    2e-17   
ref|XP_002300878.1|  hypothetical protein POPTR_0002s06020g           92.0    2e-17   
ref|XP_008654854.1|  PREDICTED: uncharacterized protein LOC100280...  91.7    2e-17   Zea mays [maize]
ref|XP_010464402.1|  PREDICTED: uncharacterized protein LOC104744...  91.7    2e-17   Camelina sativa [gold-of-pleasure]
gb|KDO60962.1|  hypothetical protein CISIN_1g0031901mg                84.3    3e-17   Citrus sinensis [apfelsine]
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...  91.7    3e-17   Zea mays [maize]
ref|XP_009108639.1|  PREDICTED: uncharacterized protein LOC103834315  88.2    3e-17   
gb|AFW81248.1|  putative DUF1296 domain containing family protein     91.3    3e-17   
ref|XP_011007012.1|  PREDICTED: uncharacterized protein LOC105112...  91.7    3e-17   Populus euphratica
ref|XP_008654851.1|  PREDICTED: uncharacterized protein LOC100280...  91.3    3e-17   Zea mays [maize]
ref|XP_006296980.1|  hypothetical protein CARUB_v10012975mg           91.3    3e-17   Capsella rubella
ref|XP_011007010.1|  PREDICTED: uncharacterized protein LOC105112...  91.3    3e-17   Populus euphratica
gb|KDP29958.1|  hypothetical protein JCGZ_18527                       91.3    4e-17   Jatropha curcas
ref|XP_010547195.1|  PREDICTED: uncharacterized protein LOC104819...  91.3    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_010547194.1|  PREDICTED: uncharacterized protein LOC104819...  90.9    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_010547193.1|  PREDICTED: uncharacterized protein LOC104819...  90.9    5e-17   Tarenaya hassleriana [spider flower]
ref|XP_008380021.1|  PREDICTED: flocculation protein FLO11-like i...  90.9    5e-17   
ref|XP_008380020.1|  PREDICTED: flocculation protein FLO11-like i...  90.9    5e-17   
ref|XP_006407810.1|  hypothetical protein EUTSA_v10020055mg           90.5    6e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010486335.1|  PREDICTED: uncharacterized protein LOC104764492  90.5    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004502111.1|  PREDICTED: flocculation protein FLO11-like       90.5    7e-17   Cicer arietinum [garbanzo]
ref|XP_010456509.1|  PREDICTED: uncharacterized protein LOC104737938  90.5    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009391914.1|  PREDICTED: uncharacterized protein LOC103977...  90.5    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391913.1|  PREDICTED: uncharacterized protein LOC103977...  90.5    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407930.1|  PREDICTED: uncharacterized protein LOC103990491  90.5    8e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146586.1|  uncharacterized protein LOC100280182             89.7    1e-16   Zea mays [maize]
ref|XP_002884662.1|  hypothetical protein ARALYDRAFT_896937           89.7    1e-16   Arabidopsis lyrata subsp. lyrata
gb|KJB42722.1|  hypothetical protein B456_007G165200                  89.7    1e-16   Gossypium raimondii
ref|XP_010273948.1|  PREDICTED: uncharacterized protein LOC104609...  89.7    1e-16   Nelumbo nucifera [Indian lotus]
gb|KJB42721.1|  hypothetical protein B456_007G165200                  89.7    1e-16   Gossypium raimondii
ref|XP_006361347.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_010273947.1|  PREDICTED: uncharacterized protein LOC104609...  89.4    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006361345.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_006361346.1|  PREDICTED: dentin sialophosphoprotein-like i...  89.4    1e-16   Solanum tuberosum [potatoes]
ref|XP_002301574.2|  hypothetical protein POPTR_0002s22320g           89.4    2e-16   
ref|XP_004516933.1|  PREDICTED: serine-rich adhesin for platelets...  89.0    2e-16   
ref|XP_009757818.1|  PREDICTED: uncharacterized protein LOC104210...  89.0    2e-16   
ref|XP_009757816.1|  PREDICTED: uncharacterized protein LOC104210...  89.0    2e-16   
ref|XP_009757817.1|  PREDICTED: uncharacterized protein LOC104210...  89.0    2e-16   
gb|KFK38227.1|  hypothetical protein AALP_AA3G085200                  89.0    2e-16   
ref|XP_010088349.1|  hypothetical protein L484_004857                 88.6    2e-16   
ref|XP_009599554.1|  PREDICTED: uncharacterized protein LOC104095...  89.0    2e-16   
ref|XP_009599553.1|  PREDICTED: uncharacterized protein LOC104095...  89.0    2e-16   
ref|XP_009599552.1|  PREDICTED: uncharacterized protein LOC104095...  89.0    2e-16   
ref|XP_008797741.1|  PREDICTED: uncharacterized protein LOC103712...  88.6    3e-16   
ref|XP_008797743.1|  PREDICTED: uncharacterized protein LOC103712...  88.6    3e-16   
ref|XP_008797739.1|  PREDICTED: uncharacterized protein LOC103712...  88.6    3e-16   
ref|XP_008797742.1|  PREDICTED: uncharacterized protein LOC103712...  88.6    3e-16   
gb|AES70123.2|  DUF1296 family protein                                88.2    3e-16   
ref|XP_009765586.1|  PREDICTED: mucin-5AC-like                        87.4    3e-16   
ref|XP_008797740.1|  PREDICTED: uncharacterized protein LOC103712...  88.6    3e-16   
emb|CDY61561.1|  BnaCnng37960D                                        80.9    3e-16   
ref|XP_008783017.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
emb|CDP14411.1|  unnamed protein product                              88.2    4e-16   
ref|XP_008783016.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_008783015.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_008783018.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_008783013.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_008783014.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_008783012.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_008783011.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_008783009.1|  PREDICTED: uncharacterized protein LOC103702...  88.2    4e-16   
ref|XP_002304144.2|  hypothetical protein POPTR_0003s06200g           88.2    4e-16   
gb|KJB06118.1|  hypothetical protein B456_001G0984002                 87.8    5e-16   
ref|XP_009610068.1|  PREDICTED: uncharacterized protein LOC104103...  87.8    5e-16   
ref|XP_009610069.1|  PREDICTED: uncharacterized protein LOC104103...  87.8    5e-16   
gb|KJB06119.1|  hypothetical protein B456_001G0984002                 87.8    5e-16   
ref|XP_009610070.1|  PREDICTED: uncharacterized protein LOC104103...  87.8    5e-16   
ref|XP_009610071.1|  PREDICTED: uncharacterized protein LOC104103...  87.8    5e-16   
gb|KEH18456.1|  plant/MDC16-11 protein                                87.8    5e-16   
ref|XP_007049405.1|  Cell wall protein AWA1 isoform 3                 87.8    6e-16   
ref|XP_007049403.1|  Cell wall protein AWA1 isoform 1                 87.8    6e-16   
ref|XP_010942569.1|  PREDICTED: uncharacterized protein LOC105060...  87.4    8e-16   
ref|XP_010942576.1|  PREDICTED: uncharacterized protein LOC105060...  87.4    8e-16   
ref|XP_010942570.1|  PREDICTED: uncharacterized protein LOC105060...  87.4    8e-16   
ref|XP_010942572.1|  PREDICTED: uncharacterized protein LOC105060...  87.4    8e-16   
ref|XP_010942571.1|  PREDICTED: uncharacterized protein LOC105060...  87.4    8e-16   
ref|XP_010942574.1|  PREDICTED: uncharacterized protein LOC105060...  87.4    8e-16   
ref|XP_010942575.1|  PREDICTED: uncharacterized protein LOC105060...  87.4    8e-16   
ref|XP_003544279.1|  PREDICTED: cell wall protein AWA1-like           86.7    1e-15   
ref|XP_010036125.1|  PREDICTED: uncharacterized protein LOC104425...  86.7    1e-15   
ref|XP_010036126.1|  PREDICTED: uncharacterized protein LOC104425...  86.7    1e-15   
ref|XP_008462126.1|  PREDICTED: flocculation protein FLO11            86.7    1e-15   
ref|XP_010657492.1|  PREDICTED: uncharacterized protein LOC100245...  86.7    1e-15   
ref|XP_010261966.1|  PREDICTED: uncharacterized protein LOC104600...  86.7    1e-15   
ref|XP_010261965.1|  PREDICTED: uncharacterized protein LOC104600...  86.7    1e-15   
ref|XP_010657491.1|  PREDICTED: uncharacterized protein LOC100245...  86.7    1e-15   
ref|XP_004510436.1|  PREDICTED: flocculation protein FLO11-like       86.7    1e-15   
ref|XP_002267265.1|  PREDICTED: uncharacterized protein LOC100245...  86.7    1e-15   
ref|XP_010929036.1|  PREDICTED: uncharacterized protein LOC105050...  86.7    1e-15   
ref|XP_010929038.1|  PREDICTED: uncharacterized protein LOC105050...  86.3    1e-15   
ref|XP_010929035.1|  PREDICTED: uncharacterized protein LOC105050...  86.3    1e-15   
ref|XP_010929039.1|  PREDICTED: uncharacterized protein LOC105050...  86.3    1e-15   
ref|XP_010524628.1|  PREDICTED: uncharacterized protein LOC104802632  86.3    2e-15   
ref|XP_006296970.1|  hypothetical protein CARUB_v10012965mg           86.3    2e-15   
ref|XP_004162890.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  86.3    2e-15   
gb|EPS69388.1|  hypothetical protein M569_05379                       81.6    2e-15   
ref|XP_004144622.1|  PREDICTED: uncharacterized protein LOC101212400  86.3    2e-15   
ref|NP_187423.2|  uncharacterized protein                             85.9    2e-15   
ref|XP_010252823.1|  PREDICTED: uncharacterized protein LOC104594...  85.9    2e-15   
ref|XP_002521347.1|  conserved hypothetical protein                   85.9    2e-15   
ref|XP_009412058.1|  PREDICTED: uncharacterized protein LOC103993639  85.9    2e-15   
ref|XP_008228216.1|  PREDICTED: probable secreted beta-glucosidas...  85.9    2e-15   
ref|XP_008228221.1|  PREDICTED: probable GPI-anchored adhesin-lik...  85.9    2e-15   
ref|XP_010252822.1|  PREDICTED: uncharacterized protein LOC104594...  85.9    2e-15   
ref|XP_008228219.1|  PREDICTED: probable secreted beta-glucosidas...  85.9    2e-15   
ref|XP_008228217.1|  PREDICTED: probable secreted beta-glucosidas...  85.9    2e-15   
ref|XP_010252821.1|  PREDICTED: uncharacterized protein LOC104594...  85.9    2e-15   
ref|XP_010252820.1|  PREDICTED: uncharacterized protein LOC104594...  85.9    2e-15   
ref|XP_006575395.1|  PREDICTED: cell wall protein AWA1-like           85.9    2e-15   
ref|XP_008228218.1|  PREDICTED: probable GPI-anchored adhesin-lik...  85.9    2e-15   
ref|XP_008228220.1|  PREDICTED: probable secreted beta-glucosidas...  85.9    2e-15   
gb|KHN46209.1|  hypothetical protein glysoja_039933                   85.9    3e-15   
ref|XP_006282355.1|  hypothetical protein CARUB_v10028652mg           85.1    3e-15   
emb|CDY22126.1|  BnaC01g39750D                                        85.5    3e-15   
ref|XP_009124224.1|  PREDICTED: uncharacterized protein LOC103849165  85.5    3e-15   
ref|XP_010245042.1|  PREDICTED: RNA polymerase II degradation fac...  85.5    3e-15   
ref|XP_010062690.1|  PREDICTED: uncharacterized protein LOC104450...  85.5    3e-15   
ref|XP_010062689.1|  PREDICTED: uncharacterized protein LOC104450...  85.5    3e-15   
ref|XP_006405898.1|  hypothetical protein EUTSA_v10028089mg           85.1    3e-15   
ref|XP_010245040.1|  PREDICTED: uncharacterized protein LOC104588...  85.5    4e-15   
ref|XP_009372373.1|  PREDICTED: uncharacterized protein LOC103961...  85.1    4e-15   
ref|XP_010245043.1|  PREDICTED: uncharacterized protein LOC104588...  85.1    4e-15   
ref|XP_010245041.1|  PREDICTED: uncharacterized protein LOC104588...  85.1    4e-15   
ref|XP_009372374.1|  PREDICTED: uncharacterized protein LOC103961...  85.1    4e-15   
ref|XP_008338695.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.1    4e-15   
ref|XP_008338694.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.1    4e-15   
ref|XP_008338696.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.1    4e-15   
ref|XP_008391371.1|  PREDICTED: dentin sialophosphoprotein-like i...  85.1    4e-15   
gb|KDP40717.1|  hypothetical protein JCGZ_24716                       85.1    4e-15   
ref|XP_008391372.1|  PREDICTED: chitinase-like protein PB1E7.04c ...  85.1    4e-15   
ref|XP_010942880.1|  PREDICTED: uncharacterized protein LOC105060...  85.1    4e-15   
ref|XP_009589263.1|  PREDICTED: protein PRRC2B-like isoform X5        85.1    4e-15   
ref|XP_006353099.1|  PREDICTED: putative GPI-anchored protein PB1...  85.1    5e-15   
ref|XP_009589264.1|  PREDICTED: protein PRRC2B-like isoform X6        85.1    5e-15   
ref|XP_010942881.1|  PREDICTED: uncharacterized protein LOC105060...  85.1    5e-15   
ref|XP_009589260.1|  PREDICTED: uncharacterized protein LOC104086...  85.1    5e-15   
ref|XP_009589259.1|  PREDICTED: protein PRRC2B-like isoform X1        85.1    5e-15   
ref|XP_009589261.1|  PREDICTED: protein PRRC2B-like isoform X3        84.7    5e-15   
gb|EPS69701.1|  hypothetical protein M569_05071                       79.3    5e-15   
ref|NP_199450.1|  uncharacterized protein                             84.3    5e-15   
ref|XP_009589262.1|  PREDICTED: uncharacterized protein LOC104086...  84.7    5e-15   
ref|XP_006353098.1|  PREDICTED: putative GPI-anchored protein PB1...  84.7    5e-15   
ref|XP_009782967.1|  PREDICTED: uncharacterized protein LOC104231...  84.7    5e-15   
ref|XP_009782966.1|  PREDICTED: uncharacterized protein LOC104231...  84.7    5e-15   
ref|XP_009782965.1|  PREDICTED: uncharacterized protein LOC104231...  84.7    5e-15   
ref|XP_009782968.1|  PREDICTED: uncharacterized protein LOC104231...  84.7    5e-15   
ref|XP_011100583.1|  PREDICTED: uncharacterized protein LOC105178745  84.7    6e-15   
ref|XP_010087685.1|  hypothetical protein L484_013447                 84.7    6e-15   
ref|XP_006405899.1|  hypothetical protein EUTSA_v10028301mg           84.0    7e-15   
ref|XP_006849609.1|  hypothetical protein AMTR_s00024p00205340        79.7    7e-15   
gb|AFW61910.1|  putative DUF1296 domain containing family protein     84.0    8e-15   
ref|XP_008678497.1|  PREDICTED: uncharacterized protein LOC103653...  84.0    8e-15   
ref|XP_010314323.1|  PREDICTED: uncharacterized protein LOC101258...  84.3    8e-15   
ref|XP_008678495.1|  PREDICTED: probable GPI-anchored adhesin-lik...  84.0    8e-15   
ref|XP_004252392.1|  PREDICTED: uncharacterized protein LOC101258...  84.0    8e-15   
ref|XP_010314322.1|  PREDICTED: uncharacterized protein LOC101258...  84.0    8e-15   
ref|XP_010644610.1|  PREDICTED: RNA polymerase II degradation fac...  84.0    8e-15   
gb|AFW61911.1|  putative DUF1296 domain containing family protein     84.0    8e-15   
ref|XP_010644609.1|  PREDICTED: RNA polymerase II degradation fac...  84.0    8e-15   
ref|XP_008678494.1|  PREDICTED: probable GPI-anchored adhesin-lik...  84.0    9e-15   
ref|XP_008678496.1|  PREDICTED: uncharacterized protein LOC103653...  84.0    9e-15   
ref|XP_008678498.1|  PREDICTED: probable GPI-anchored adhesin-lik...  84.0    9e-15   
emb|CBI35892.3|  unnamed protein product                              84.0    9e-15   
ref|XP_010644611.1|  PREDICTED: RNA polymerase II degradation fac...  84.0    9e-15   
ref|XP_010551966.1|  PREDICTED: uncharacterized protein LOC104822439  84.0    9e-15   
ref|XP_009391448.1|  PREDICTED: uncharacterized protein LOC103977608  84.0    1e-14   
ref|XP_004490553.1|  PREDICTED: flocculation protein FLO11-like       84.0    1e-14   
gb|KHN39644.1|  hypothetical protein glysoja_020722                   84.0    1e-14   
ref|XP_010654468.1|  PREDICTED: uncharacterized protein LOC100248...  84.0    1e-14   
ref|XP_006598817.1|  PREDICTED: putative uncharacterized protein ...  84.0    1e-14   
ref|XP_010654470.1|  PREDICTED: uncharacterized protein LOC100248...  84.0    1e-14   
ref|XP_008464007.1|  PREDICTED: uncharacterized protein LOC103501...  83.6    1e-14   
ref|XP_008464006.1|  PREDICTED: uncharacterized protein LOC103501...  83.6    1e-14   
ref|XP_003528451.1|  PREDICTED: dentin sialophosphoprotein-like i...  83.6    1e-14   
ref|XP_010654471.1|  PREDICTED: uncharacterized protein LOC100248...  83.6    1e-14   
ref|XP_010917133.1|  PREDICTED: uncharacterized protein LOC105041...  83.6    1e-14   
ref|XP_010917132.1|  PREDICTED: uncharacterized protein LOC105041...  83.6    1e-14   
ref|XP_004141213.1|  PREDICTED: uncharacterized protein LOC101203238  83.6    1e-14   
ref|XP_006583148.1|  PREDICTED: dentin sialophosphoprotein-like i...  83.6    1e-14   
ref|XP_006583149.1|  PREDICTED: dentin sialophosphoprotein-like i...  83.6    1e-14   
ref|XP_004163891.1|  PREDICTED: uncharacterized protein LOC101226902  83.6    1e-14   
gb|KGN59790.1|  hypothetical protein Csa_3G846060                     83.6    1e-14   
ref|XP_006660473.1|  PREDICTED: flocculation protein FLO11-like       83.2    1e-14   
ref|XP_010654469.1|  PREDICTED: uncharacterized protein LOC100248...  83.2    1e-14   
ref|XP_006389698.1|  hypothetical protein EUTSA_v10027613mg           83.2    2e-14   
ref|XP_010936970.1|  PREDICTED: uncharacterized protein LOC105056...  83.2    2e-14   
ref|XP_009339824.1|  PREDICTED: uncharacterized protein LOC103932...  82.8    2e-14   
ref|XP_009339833.1|  PREDICTED: uncharacterized protein LOC103932...  82.8    2e-14   
ref|XP_010936968.1|  PREDICTED: uncharacterized protein LOC105056...  82.8    2e-14   
ref|XP_009339841.1|  PREDICTED: uncharacterized protein LOC103932...  82.8    2e-14   
ref|XP_002445374.1|  hypothetical protein SORBIDRAFT_07g013800        75.9    2e-14   
gb|AGT17314.1|  Protein of unknown function DUF1296                   82.8    2e-14   
ref|XP_002967632.1|  hypothetical protein SELMODRAFT_440086           82.8    2e-14   
ref|XP_011072651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  82.8    2e-14   
ref|XP_007135474.1|  hypothetical protein PHAVU_010G132600g           82.8    2e-14   
ref|XP_011467415.1|  PREDICTED: uncharacterized protein LOC101293...  82.8    3e-14   
ref|XP_004303676.1|  PREDICTED: uncharacterized protein LOC101293...  82.8    3e-14   
ref|XP_002964401.1|  hypothetical protein SELMODRAFT_438753           82.4    3e-14   
ref|XP_010465276.1|  PREDICTED: uncharacterized protein LOC104745...  82.0    4e-14   
ref|XP_010465278.1|  PREDICTED: uncharacterized protein LOC104745...  82.0    4e-14   
ref|XP_010465277.1|  PREDICTED: uncharacterized protein LOC104745...  82.0    4e-14   
ref|XP_010501500.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    4e-14   
ref|XP_008784271.1|  PREDICTED: uncharacterized protein LOC103703...  82.0    4e-14   
ref|XP_010487182.1|  PREDICTED: uncharacterized protein LOC104765...  82.0    4e-14   
ref|XP_010501517.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    4e-14   
ref|XP_010501510.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    4e-14   
ref|XP_010501505.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    4e-14   
ref|XP_007146345.1|  hypothetical protein PHAVU_006G032700g           81.6    4e-14   
ref|XP_010501523.1|  PREDICTED: uncharacterized protein LOC104778...  82.0    4e-14   
ref|XP_010487183.1|  PREDICTED: uncharacterized protein LOC104765...  81.6    4e-14   
ref|XP_006282485.1|  hypothetical protein CARUB_v10006235mg           81.6    5e-14   
ref|XP_004973209.1|  PREDICTED: flocculation protein FLO11-like       81.6    5e-14   
gb|EYU21338.1|  hypothetical protein MIMGU_mgv1a001286mg              81.6    5e-14   
ref|XP_010685331.1|  PREDICTED: uncharacterized protein LOC104899...  81.6    5e-14   
ref|XP_010685332.1|  PREDICTED: uncharacterized protein LOC104899...  81.6    5e-14   
gb|EEC80202.1|  hypothetical protein OsI_22088                        81.6    6e-14   
gb|EEE65290.1|  hypothetical protein OsJ_20522                        81.6    6e-14   
ref|NP_001057094.1|  Os06g0206100                                     81.6    6e-14   
ref|XP_010685333.1|  PREDICTED: uncharacterized protein LOC104899...  81.3    6e-14   
ref|XP_010321076.1|  PREDICTED: uncharacterized protein LOC101250...  81.3    7e-14   
ref|XP_010321075.1|  PREDICTED: uncharacterized protein LOC101250...  81.3    8e-14   
ref|XP_010534929.1|  PREDICTED: uncharacterized protein LOC104810...  80.5    1e-13   
ref|XP_002885002.1|  hypothetical protein ARALYDRAFT_478805           80.5    1e-13   
ref|XP_002863403.1|  hypothetical protein ARALYDRAFT_356363           80.5    1e-13   
emb|CDX97535.1|  BnaA05g25440D                                        80.5    1e-13   
ref|XP_003599872.1|  hypothetical protein MTR_3g048270                80.1    1e-13   
ref|XP_006656745.1|  PREDICTED: uncharacterized protein LOC102709938  80.5    1e-13   
ref|XP_010932459.1|  PREDICTED: RNA polymerase II degradation fac...  79.7    2e-13   
gb|KHN41482.1|  hypothetical protein glysoja_036276                   72.4    4e-13   
gb|AES98495.2|  MLP3.11 protein                                       79.0    4e-13   
ref|NP_188015.2|  kinase-related protein                              79.0    4e-13   
ref|NP_001078149.1|  kinase-related protein                           78.6    4e-13   
ref|XP_008229801.1|  PREDICTED: uncharacterized protein LOC103329149  78.2    5e-13   
ref|XP_007024587.1|  Uncharacterized protein isoform 4                78.6    5e-13   
ref|XP_007024585.1|  Uncharacterized protein isoform 2                78.6    5e-13   
ref|XP_007024589.1|  Uncharacterized protein isoform 6                78.6    5e-13   
ref|XP_003615537.1|  hypothetical protein MTR_5g069290                78.6    5e-13   
ref|XP_007024588.1|  Uncharacterized protein isoform 5                78.6    5e-13   
dbj|BAB02329.1|  unnamed protein product                              78.6    5e-13   
ref|XP_007024584.1|  Uncharacterized protein isoform 1                78.6    6e-13   
emb|CDY28028.1|  BnaC05g44300D                                        78.2    6e-13   
ref|XP_010676081.1|  PREDICTED: uncharacterized protein LOC104891...  77.8    7e-13   
emb|CDY35953.1|  BnaA05g29970D                                        78.2    7e-13   
ref|XP_006465941.1|  PREDICTED: dentin sialophosphoprotein-like       78.2    7e-13   
emb|CAN73914.1|  hypothetical protein VITISV_035233                   78.2    7e-13   
ref|XP_006426626.1|  hypothetical protein CICLE_v10024871mg           78.2    7e-13   
ref|XP_006426627.1|  hypothetical protein CICLE_v10024871mg           78.2    7e-13   
gb|KDO65081.1|  hypothetical protein CISIN_1g040475mg                 78.2    8e-13   
ref|XP_010676080.1|  PREDICTED: uncharacterized protein LOC104891...  77.8    8e-13   
ref|XP_009147044.1|  PREDICTED: uncharacterized protein LOC103870...  77.8    9e-13   
ref|XP_009147045.1|  PREDICTED: uncharacterized protein LOC103870...  77.8    9e-13   
gb|ACG43075.1|  hypothetical protein                                  72.0    9e-13   
ref|XP_009146423.1|  PREDICTED: uncharacterized protein LOC103870...  77.4    1e-12   
ref|XP_009146425.1|  PREDICTED: uncharacterized protein LOC103870...  77.4    1e-12   
ref|XP_009146424.1|  PREDICTED: uncharacterized protein LOC103870...  77.4    1e-12   



>ref|XP_009614041.1| PREDICTED: uncharacterized protein LOC104107048 isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 140/190 (74%), Gaps = 11/190 (6%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  383  RKENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAY-KENG-YTN--TK  544
            RKE+KDTTESRPRG+ S+ G         Y GRGGSE    K T  Y KENG YT+  T 
Sbjct  71   RKESKDTTESRPRGSVSNSGRGSRGGAEWYVGRGGSEPT--KPTPGYKKENGSYTSYLTS  128

Query  545  STRTAGSTTNRWLPTISDAAGTENQK--LVDGVSAATQHSSGYQSAWVGVPGQVSMADIV  718
            +   +GS  +R + TISDAA  E++K   VDGVS+ +QHSSGYQ  W GVPGQVSMADIV
Sbjct  129  TPEVSGSNVSRRVATISDAAANESKKPAAVDGVSSVSQHSSGYQPTWGGVPGQVSMADIV  188

Query  719  KMGKPHGKAP  748
            KMGKP  K P
Sbjct  189  KMGKPQSKVP  198



>ref|XP_009785957.1| PREDICTED: uncharacterized protein LOC104234138 isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 141/192 (73%), Gaps = 13/192 (7%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGGSESLHGKSTYAY-KENG-YT-NTKS  547
            RKE+KDTTESRPRG+ ++ G      A+RY GRGGSE    K T  Y KENG YT N  S
Sbjct  71   RKESKDTTESRPRGSVNNSGRGSRGGAERYVGRGGSEPT--KPTPGYKKENGSYTSNLAS  128

Query  548  TR-TAGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHSSGYQSAWVGVPGQVSMAD  712
            T   +GS  +R   TISDAA  E ++     VDGVS+ +QHSSGYQ  W GVPGQVSMAD
Sbjct  129  TPGVSGSNISRRAATISDAAANETKRPASAAVDGVSSVSQHSSGYQHTWGGVPGQVSMAD  188

Query  713  IVKMGKPHGKAP  748
            IVKMGKP  K P
Sbjct  189  IVKMGKPQSKVP  200



>ref|XP_009614040.1| PREDICTED: uncharacterized protein LOC104107048 isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 140/192 (73%), Gaps = 13/192 (7%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  383  RKE--NKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAY-KENG-YTN--  538
            RKE  +KDTTESRPRG+ S+ G         Y GRGGSE    K T  Y KENG YT+  
Sbjct  71   RKEVQSKDTTESRPRGSVSNSGRGSRGGAEWYVGRGGSEPT--KPTPGYKKENGSYTSYL  128

Query  539  TKSTRTAGSTTNRWLPTISDAAGTENQK--LVDGVSAATQHSSGYQSAWVGVPGQVSMAD  712
            T +   +GS  +R + TISDAA  E++K   VDGVS+ +QHSSGYQ  W GVPGQVSMAD
Sbjct  129  TSTPEVSGSNVSRRVATISDAAANESKKPAAVDGVSSVSQHSSGYQPTWGGVPGQVSMAD  188

Query  713  IVKMGKPHGKAP  748
            IVKMGKP  K P
Sbjct  189  IVKMGKPQSKVP  200



>ref|XP_010317412.1| PREDICTED: uncharacterized protein LOC101266097 isoform X2 [Solanum 
lycopersicum]
Length=822

 Score =   193 bits (490),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 134/190 (71%), Gaps = 9/190 (5%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP GSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  18   VQSIPPGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLTQDPFHEVKSKREK  76

Query  383  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTR-  553
            RKE KD TESR     ++ SRG +   DRY GRGGSES      Y  +    TN  S+  
Sbjct  77   RKEIKDPTESRSWITSSTPSRGSRAGGDRYVGRGGSESTKPAPAYRKESGSQTNNFSSTP  136

Query  554  -TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQVSMADIV  718
              AG  T+R    ISDAAG ++++L    VDG SAA+Q SSGYQ  W GVPGQVSMADIV
Sbjct  137  LIAGGNTDRRPTAISDAAGNDSKRLAPAAVDGHSAASQPSSGYQPTWGGVPGQVSMADIV  196

Query  719  KMGKPHGKAP  748
            KMG+P  K P
Sbjct  197  KMGRPQSKVP  206



>ref|XP_004234052.1| PREDICTED: uncharacterized protein LOC101266097 isoform X1 [Solanum 
lycopersicum]
Length=843

 Score =   193 bits (490),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 134/190 (71%), Gaps = 9/190 (5%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP GSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  18   VQSIPPGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLTQDPFHEVKSKREK  76

Query  383  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTR-  553
            RKE KD TESR     ++ SRG +   DRY GRGGSES      Y  +    TN  S+  
Sbjct  77   RKEIKDPTESRSWITSSTPSRGSRAGGDRYVGRGGSESTKPAPAYRKESGSQTNNFSSTP  136

Query  554  -TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQVSMADIV  718
              AG  T+R    ISDAAG ++++L    VDG SAA+Q SSGYQ  W GVPGQVSMADIV
Sbjct  137  LIAGGNTDRRPTAISDAAGNDSKRLAPAAVDGHSAASQPSSGYQPTWGGVPGQVSMADIV  196

Query  719  KMGKPHGKAP  748
            KMG+P  K P
Sbjct  197  KMGRPQSKVP  206



>ref|XP_009618328.1| PREDICTED: uncharacterized protein LOC104110515 isoform X2 [Nicotiana 
tomentosiformis]
Length=845

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 130/189 (69%), Gaps = 8/189 (4%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            ++IP GS+K+V+SLKEIV    E+EIYA LK+CNMDPNEAVN+LLSQD FHEVKSKR+KR
Sbjct  21   SIIPGGSKKMVQSLKEIVNFCTEAEIYAVLKDCNMDPNEAVNKLLSQDTFHEVKSKREKR  80

Query  386  KENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAYKENGYTNTKSTR--  553
            KENKDTTESR   +SS+           Y GRGGSES      Y  +   +TN  S+   
Sbjct  81   KENKDTTESRSWVSSSTSSRGSRTGAERYVGRGGSESTKPAPAYRKESGSHTNNFSSTPG  140

Query  554  TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQVSMADIVK  721
              GS  +R    +SDAAG E++KL    VDG SAA+Q SSGYQ  W GVPGQVSMADIVK
Sbjct  141  VVGSNIDRRPTAVSDAAGNESKKLTPAAVDGHSAASQLSSGYQPTWGGVPGQVSMADIVK  200

Query  722  MGKPHGKAP  748
            MG+P  K P
Sbjct  201  MGRPQSKVP  209



>ref|XP_009618326.1| PREDICTED: uncharacterized protein LOC104110515 isoform X1 [Nicotiana 
tomentosiformis]
Length=852

 Score =   190 bits (483),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 130/189 (69%), Gaps = 8/189 (4%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            ++IP GS+K+V+SLKEIV    E+EIYA LK+CNMDPNEAVN+LLSQD FHEVKSKR+KR
Sbjct  21   SIIPGGSKKMVQSLKEIVNFCTEAEIYAVLKDCNMDPNEAVNKLLSQDTFHEVKSKREKR  80

Query  386  KENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAYKENGYTNTKSTR--  553
            KENKDTTESR   +SS+           Y GRGGSES      Y  +   +TN  S+   
Sbjct  81   KENKDTTESRSWVSSSTSSRGSRTGAERYVGRGGSESTKPAPAYRKESGSHTNNFSSTPG  140

Query  554  TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQVSMADIVK  721
              GS  +R    +SDAAG E++KL    VDG SAA+Q SSGYQ  W GVPGQVSMADIVK
Sbjct  141  VVGSNIDRRPTAVSDAAGNESKKLTPAAVDGHSAASQLSSGYQPTWGGVPGQVSMADIVK  200

Query  722  MGKPHGKAP  748
            MG+P  K P
Sbjct  201  MGRPQSKVP  209



>ref|XP_009785950.1| PREDICTED: uncharacterized protein LOC104234138 isoform X1 [Nicotiana 
sylvestris]
Length=843

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 141/194 (73%), Gaps = 15/194 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  12   VQAIPAGSRKVVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  70

Query  383  RKE--NKDTTEsrprgasssrggkgs--adrYAGRGGSESLHGKSTYAY-KENG-YT-NT  541
            RKE  +KDTTESRPRG+ ++ G      A+RY GRGGSE    K T  Y KENG YT N 
Sbjct  71   RKEVQSKDTTESRPRGSVNNSGRGSRGGAERYVGRGGSEPT--KPTPGYKKENGSYTSNL  128

Query  542  KSTR-TAGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHSSGYQSAWVGVPGQVSM  706
             ST   +GS  +R   TISDAA  E ++     VDGVS+ +QHSSGYQ  W GVPGQVSM
Sbjct  129  ASTPGVSGSNISRRAATISDAAANETKRPASAAVDGVSSVSQHSSGYQHTWGGVPGQVSM  188

Query  707  ADIVKMGKPHGKAP  748
            ADIVKMGKP  K P
Sbjct  189  ADIVKMGKPQSKVP  202



>ref|XP_006356118.1| PREDICTED: cell wall protein AWA1-like [Solanum tuberosum]
Length=845

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 137/192 (71%), Gaps = 13/192 (7%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP GSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  18   VQSIPPGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLTQDPFHEVKSKREK  76

Query  383  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAY-KENGYTNTKSTR  553
            RKE KD TESR     ++ SRG +   +RY GRGGSES   K T AY KE+G      + 
Sbjct  77   RKEIKDPTESRSWITSSTPSRGSRAGGERYVGRGGSEST--KPTPAYRKESGSQTNNFSS  134

Query  554  T---AGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQVSMAD  712
            T   AGS T+R    IS A G ++++L    VDG SAA+Q SSGYQ  W GVPGQVSMAD
Sbjct  135  TPLIAGSNTDRRPTAISYATGNDSKRLAPAAVDGHSAASQPSSGYQPTWGGVPGQVSMAD  194

Query  713  IVKMGKPHGKAP  748
            IVKMG+P  K P
Sbjct  195  IVKMGRPQSKVP  206



>ref|XP_006355598.1| PREDICTED: signaling mucin HKR1-like [Solanum tuberosum]
Length=836

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 137/191 (72%), Gaps = 11/191 (6%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  11   VQSIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  69

Query  383  RKENKDTTEsrp--rgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRT  556
            RKE+KDTTESRP    +SS RG +G A+RY GRGGSES      Y  KENG   +  T T
Sbjct  70   RKESKDTTESRPRGAISSSGRGSRGGAERYVGRGGSESTRPIPGYR-KENGSNTSNLTST  128

Query  557  ---AGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHSSGYQSAWVGVPGQVSMADI  715
               +GS  +R   TISD A  E++K     VDGVS+  + SSGYQ  W GVPGQVSMADI
Sbjct  129  LGVSGSNISRRATTISDIAANESKKSAPTAVDGVSSVCETSSGYQPTWGGVPGQVSMADI  188

Query  716  VKMGKPHGKAP  748
            VKMG+P  K P
Sbjct  189  VKMGRPQSKVP  199



>ref|XP_009790935.1| PREDICTED: uncharacterized protein LOC104238306 [Nicotiana sylvestris]
Length=852

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 128/189 (68%), Gaps = 8/189 (4%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            ++IP GS+K+V+SLKEIV    E+EIYA LK+CNMDPNEAVN+LLSQD FHEVKSKR+KR
Sbjct  21   SIIPGGSKKMVQSLKEIVNFCTEAEIYAVLKDCNMDPNEAVNKLLSQDTFHEVKSKREKR  80

Query  386  KENKDTTEsrprgasssrggkgsadr--YAGRGGSESLHGKSTYAYKENGYTNTKSTR--  553
            KENKDTTESR   +SS+           Y GR GSES      Y  +   +TN  S+   
Sbjct  81   KENKDTTESRSWVSSSTSSRGSRTGAERYVGRTGSESTKPAPAYRKESGSHTNNFSSTPG  140

Query  554  TAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQVSMADIVK  721
              GS  +R    +SDAAG E +KL    VDG SAA+Q SSGYQ  W GVPGQVSMADIVK
Sbjct  141  VLGSNIDRRPTAVSDAAGNERKKLAPAAVDGNSAASQPSSGYQPTWGGVPGQVSMADIVK  200

Query  722  MGKPHGKAP  748
            MG+P  K P
Sbjct  201  MGRPQSKVP  209



>ref|XP_011096498.1| PREDICTED: uncharacterized protein LOC105175670 isoform X2 [Sesamum 
indicum]
Length=842

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 139/199 (70%), Gaps = 18/199 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N  E+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  15   VQAIPAGSRKMVQSLKEIV-NCSEAEIYATLKDCNMDPNEAVNRLLSQDPFHEVKSKREK  73

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRGG-------SESLHGKSTYAYKENGYT  535
            +KE KDTTE+R R A+++     K  ADRY GRGG       S SL G+S+Y  KENG T
Sbjct  74   KKEGKDTTETRSRSANNNSSRGGKIGADRYHGRGGSTPYSSESASLPGRSSYK-KENGST  132

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVS  703
               S  ++G+  +R     SD A +EN+     + D + +  Q +SGYQSAWV VPGQVS
Sbjct  133  PNASYLSSGNNRSRGPAGPSDGASSENKVSSLSMADAMPSGVQPTSGYQSAWVSVPGQVS  192

Query  704  MADIVKMGKPHGK---APN  751
            MADIVKMG+P  K   APN
Sbjct  193  MADIVKMGRPQNKVASAPN  211



>ref|XP_011096496.1| PREDICTED: uncharacterized protein LOC105175670 isoform X1 [Sesamum 
indicum]
Length=843

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 139/199 (70%), Gaps = 18/199 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N  E+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  15   VQAIPAGSRKMVQSLKEIV-NCSEAEIYATLKDCNMDPNEAVNRLLSQDPFHEVKSKREK  73

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRGG-------SESLHGKSTYAYKENGYT  535
            +KE KDTTE+R R A+++     K  ADRY GRGG       S SL G+S+Y  KENG T
Sbjct  74   KKEGKDTTETRSRSANNNSSRGGKIGADRYHGRGGSTPYSSESASLPGRSSYK-KENGST  132

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVS  703
               S  ++G+  +R     SD A +EN+     + D + +  Q +SGYQSAWV VPGQVS
Sbjct  133  PNASYLSSGNNRSRGPAGPSDGASSENKVSSLSMADAMPSGVQPTSGYQSAWVSVPGQVS  192

Query  704  MADIVKMGKPHGK---APN  751
            MADIVKMG+P  K   APN
Sbjct  193  MADIVKMGRPQNKVASAPN  211



>ref|XP_004232971.1| PREDICTED: uncharacterized protein LOC101252351 [Solanum lycopersicum]
Length=833

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 137/192 (71%), Gaps = 12/192 (6%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLL+QD FHEVKSKR+K
Sbjct  11   VQSIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLTQDTFHEVKSKREK  69

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGGS-ESLHGKSTYAYKENGYTNTKSTR  553
            RKE+KDTTESRPRGA S+ G      A+RY GRGGS ES      Y  K+NG   +  T 
Sbjct  70   RKESKDTTESRPRGAISNSGRGSRGGAERYVGRGGSAESTKLIPGYR-KDNGSKTSNLTS  128

Query  554  TAG-STTNRWLPTISDAAGTENQK----LVDGVSAATQH--SSGYQSAWVGVPGQVSMAD  712
            T G S  +R   TISD A  E++K     VDGVS+ +QH  SSGYQ  W GVPGQVSMAD
Sbjct  129  TLGVSGISRRATTISDIAANESKKSAPAAVDGVSSVSQHETSSGYQPTWGGVPGQVSMAD  188

Query  713  IVKMGKPHGKAP  748
            IVKMG+P  K P
Sbjct  189  IVKMGRPQSKVP  200



>ref|XP_002519742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42715.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 132/199 (66%), Gaps = 21/199 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  16   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKREK  74

Query  383  RKENKDTTEsrprgasssrggk-gsadrYAGRGGSESL--------HGKSTYAYKENGYT  535
            +KE KDTTE R R A+++            GRGGS           HGK  Y  KENG T
Sbjct  75   KKETKDTTEPRSRVANNATHRAGRVGADRYGRGGSSQFSSNDPGVSHGKPAYK-KENG-T  132

Query  536  N-----TKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV  688
            N     + +   AG+  NR     SD    EN+ L     DGVS ++Q ++G+QS WVGV
Sbjct  133  NASAGSSSAPSMAGTNINRRPILNSDLVAAENKLLTVGASDGVSLSSQPTAGFQSPWVGV  192

Query  689  PGQVSMADIVKMGKPHGKA  745
            PGQVSMADIVKMG+PH KA
Sbjct  193  PGQVSMADIVKMGRPHNKA  211



>emb|CBI30819.3| unnamed protein product [Vitis vinifera]
Length=799

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 134/197 (68%), Gaps = 18/197 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SL+E+V N  E EIYA LKECNMDPN+AV+RLLS DPFHEVKSK+DK
Sbjct  22   ISTIPAASRKMVQSLREVV-NCSEQEIYAMLKECNMDPNDAVHRLLSLDPFHEVKSKKDK  80

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGGSESL--------HGKSTYAYKENG-  529
            RKE+KDTTESR R  +S+         DR+AGR  S           HGKS Y  KENG 
Sbjct  81   RKESKDTTESRSRSVNSTSTRGSRGGTDRFAGRSSSNQFSSTDSGTSHGKSAYK-KENGT  139

Query  530  --YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVGVPG  694
              YT   +   AG++ N   PT S+   TE    +   DG+++++Q SSG+QSAW+GVPG
Sbjct  140  NAYTTYPAVGVAGNSMNWRPPTTSETVATEKILTIGTSDGITSSSQPSSGFQSAWLGVPG  199

Query  695  QVSMADIVKMGKPHGKA  745
             VSMADIVK G+PHGKA
Sbjct  200  HVSMADIVKKGRPHGKA  216



>ref|XP_010655630.1| PREDICTED: protein lingerer-like [Vitis vinifera]
Length=886

 Score =   179 bits (455),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 134/197 (68%), Gaps = 18/197 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SL+E+V N  E EIYA LKECNMDPN+AV+RLLS DPFHEVKSK+DK
Sbjct  37   ISTIPAASRKMVQSLREVV-NCSEQEIYAMLKECNMDPNDAVHRLLSLDPFHEVKSKKDK  95

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGGSESL--------HGKSTYAYKENG-  529
            RKE+KDTTESR R  +S+         DR+AGR  S           HGKS Y  KENG 
Sbjct  96   RKESKDTTESRSRSVNSTSTRGSRGGTDRFAGRSSSNQFSSTDSGTSHGKSAYK-KENGT  154

Query  530  --YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVGVPG  694
              YT   +   AG++ N   PT S+   TE    +   DG+++++Q SSG+QSAW+GVPG
Sbjct  155  NAYTTYPAVGVAGNSMNWRPPTTSETVATEKILTIGTSDGITSSSQPSSGFQSAWLGVPG  214

Query  695  QVSMADIVKMGKPHGKA  745
             VSMADIVK G+PHGKA
Sbjct  215  HVSMADIVKKGRPHGKA  231



>ref|XP_006369885.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
 gb|ERP66454.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
Length=867

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 133/202 (66%), Gaps = 23/202 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV + PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  18   ISGIPAASRKMVQSLKEIV-SCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  76

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGG-----------SESLHGKSTYAYKEN  526
            +KENKD+T+SR R   + S  G        GRGG           S +LHGK +Y  KEN
Sbjct  77   KKENKDSTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNDSSTLHGKPSYK-KEN  135

Query  527  GYT-----NTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAW  679
            G       +  ++  AG+  N   P  SD+   EN+       DGVS++ Q + GYQSAW
Sbjct  136  GANAYAGPSPSASSMAGNNINWQPPYHSDSVAIENKMTTVGAGDGVSSSAQPTPGYQSAW  195

Query  680  VGVPGQVSMADIVKMGKPHGKA  745
            +GVPGQVSMADIVKMG+P  KA
Sbjct  196  MGVPGQVSMADIVKMGRPQNKA  217



>gb|KDO78065.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
 gb|KDO78066.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
 gb|KDO78067.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
Length=565

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 140/207 (68%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+ L     DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTLEVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>gb|KDO78063.1| hypothetical protein CISIN_1g0026402mg [Citrus sinensis]
Length=567

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 140/207 (68%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+ L     DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTLEVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>gb|KDO78068.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
Length=550

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 140/207 (68%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+ L     DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTLEVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>ref|XP_011005847.1| PREDICTED: uncharacterized protein LOC105112008 isoform X3 [Populus 
euphratica]
Length=869

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 133/202 (66%), Gaps = 23/202 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  77

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGG-----------SESLHGKSTYAYKEN  526
            +KENKD T+SR R   + S  G        GRGG           S +LHGK +Y  KEN
Sbjct  78   KKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPSYK-KEN  136

Query  527  GYT-----NTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAW  679
            G       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S GYQSAW
Sbjct  137  GANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPSPGYQSAW  196

Query  680  VGVPGQVSMADIVKMGKPHGKA  745
            +G+ GQVS+ADIVKMG+P  KA
Sbjct  197  MGLSGQVSLADIVKMGRPQNKA  218



>ref|XP_011005848.1| PREDICTED: uncharacterized protein LOC105112008 isoform X4 [Populus 
euphratica]
Length=868

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 133/202 (66%), Gaps = 23/202 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  77

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGG-----------SESLHGKSTYAYKEN  526
            +KENKD T+SR R   + S  G        GRGG           S +LHGK +Y  KEN
Sbjct  78   KKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPSYK-KEN  136

Query  527  GYT-----NTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAW  679
            G       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S GYQSAW
Sbjct  137  GANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPSPGYQSAW  196

Query  680  VGVPGQVSMADIVKMGKPHGKA  745
            +G+ GQVS+ADIVKMG+P  KA
Sbjct  197  MGLSGQVSLADIVKMGRPQNKA  218



>gb|KHG18569.1| Protein translocase subunit SecA [Gossypium arboreum]
Length=851

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 139/200 (70%), Gaps = 22/200 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  20   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  78

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRGGSES--------LHGKSTYAYKENG-  529
            +KE+KDT +SR RGA++      +  +DRY GRGGS +         HGK     +ENG 
Sbjct  79   KKESKDTVDSRSRGANNLGSRGGRSGSDRYMGRGGSSNYSSNESGPFHGKPAQK-RENGT  137

Query  530  ----YTNTKSTRTAGSTTNRWLPTISDAA----GTENQKLVDGVSAATQHSSGYQSAWVG  685
                 +++ ++   G+  N  LP+ S+A      T    LVDG+S+++Q  SGYQSAW+G
Sbjct  138  HAYAGSSSSASGVQGNNMNWRLPSHSEAVISGHKTTTAGLVDGISSSSQ-PSGYQSAWLG  196

Query  686  VPGQVSMADIVKMGKPHGKA  745
             PGQVSMADIVKMG+P  KA
Sbjct  197  APGQVSMADIVKMGRPQNKA  216



>gb|KDO78064.1| hypothetical protein CISIN_1g0026402mg, partial [Citrus sinensis]
Length=593

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 140/207 (68%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+ L     DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTLEVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>ref|XP_011045308.1| PREDICTED: uncharacterized protein LOC105140253 isoform X1 [Populus 
euphratica]
Length=872

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 131/203 (65%), Gaps = 25/203 (12%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGG-----------SESLHGKSTYAYKEN  526
            +KENKD+T+SR     + S  G        GRGG           S + H K TY  KEN
Sbjct  80   KKENKDSTDSRSHGAGNISNRGGRGGADRYGRGGPGRSAYFNSNESSTFHSKPTYK-KEN  138

Query  527  GYTNT------KSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSA  676
            G TN        ++  AG+  N   P+ SD+   EN+       DGVS++ Q S  YQSA
Sbjct  139  G-TNAYVDPVPSASDIAGNNINWQPPSHSDSVAKENKMSAIGAGDGVSSSAQPSPVYQSA  197

Query  677  WVGVPGQVSMADIVKMGKPHGKA  745
            W+GVPGQVSMADIVKMG+P  KA
Sbjct  198  WMGVPGQVSMADIVKMGRPQNKA  220



>ref|XP_011045309.1| PREDICTED: uncharacterized protein LOC105140253 isoform X2 [Populus 
euphratica]
Length=871

 Score =   174 bits (440),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 131/203 (65%), Gaps = 25/203 (12%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGG-----------SESLHGKSTYAYKEN  526
            +KENKD+T+SR     + S  G        GRGG           S + H K TY  KEN
Sbjct  80   KKENKDSTDSRSHGAGNISNRGGRGGADRYGRGGPGRSAYFNSNESSTFHSKPTYK-KEN  138

Query  527  GYTNT------KSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSA  676
            G TN        ++  AG+  N   P+ SD+   EN+       DGVS++ Q S  YQSA
Sbjct  139  G-TNAYVDPVPSASDIAGNNINWQPPSHSDSVAKENKMSAIGAGDGVSSSAQPSPVYQSA  197

Query  677  WVGVPGQVSMADIVKMGKPHGKA  745
            W+GVPGQVSMADIVKMG+P  KA
Sbjct  198  WMGVPGQVSMADIVKMGRPQNKA  220



>gb|KJB57295.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57300.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=869

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 139/200 (70%), Gaps = 22/200 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  20   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  78

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRGGSE--------SLHGKSTYAYKENG-  529
            +KE+KDT +SR RGA++      +  +DRY GRGGS           HGK     +ENG 
Sbjct  79   KKESKDTVDSRSRGANNLGSRGGRSGSDRYMGRGGSSYYSSNESGPFHGKPAQK-RENGT  137

Query  530  ----YTNTKSTRTAGSTTNRWLPTISDA--AG--TENQKLVDGVSAATQHSSGYQSAWVG  685
                 +++ ++   G+  NR  P+ S+A  AG  T    LVDG+S+++Q   GYQSAW+G
Sbjct  138  HAYAGSSSSASGVQGNNMNRRPPSHSEAGIAGHKTTTAGLVDGISSSSQ-PCGYQSAWLG  196

Query  686  VPGQVSMADIVKMGKPHGKA  745
             PGQVSMADIVKMG+P  KA
Sbjct  197  APGQVSMADIVKMGRPQNKA  216



>ref|XP_006467530.1| PREDICTED: uncharacterized protein LOC102630898 isoform X1 [Citrus 
sinensis]
Length=869

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 140/207 (68%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+ L     DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTLEVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>ref|XP_006467531.1| PREDICTED: uncharacterized protein LOC102630898 isoform X2 [Citrus 
sinensis]
Length=854

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 140/207 (68%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE+KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKESKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFTSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+ L     DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTLEVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>ref|XP_007025176.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
 gb|EOY27798.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
Length=872

 Score =   171 bits (433),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 138/200 (69%), Gaps = 22/200 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V SLKEIV N PE EIY  LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  23   ISGIPAGSRKMVLSLKEIV-NCPEPEIYVMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  81

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENG-  529
            +KE+KDT +SR RGA++      +   DRY GRGGS           HGK+    +ENG 
Sbjct  82   KKESKDTVDSRSRGANNLGNRGGRSGPDRYIGRGGSTHYSAYESGPSHGKAAQK-RENGT  140

Query  530  ----YTNTKSTRTAGSTTNRWLPTISDAAGTENQK----LVDGVSAATQHSSGYQSAWVG  685
                 +++ ++   G+  NR  P+ S+A  TE++     L DG+S ++Q SSGYQSAW+G
Sbjct  141  HAYAGSSSSASGMPGNNLNRRPPSHSEAVATEHKMSTVGLGDGISLSSQ-SSGYQSAWLG  199

Query  686  VPGQVSMADIVKMGKPHGKA  745
            VPGQVSMADIVK G+P  KA
Sbjct  200  VPGQVSMADIVKKGRPQNKA  219



>ref|XP_011045310.1| PREDICTED: uncharacterized protein LOC105140253 isoform X3 [Populus 
euphratica]
Length=841

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 122/185 (66%), Gaps = 20/185 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAG  562
            +KENKD+T+SR  GA +            GRGG++         Y   G   +    + G
Sbjct  80   KKENKDSTDSRSHGAGNISNR-------GGRGGADR--------YGRGGPGRSAYFNSNG  124

Query  563  STTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGK  730
            +  N   P+ SD+   EN+       DGVS++ Q S  YQSAW+GVPGQVSMADIVKMG+
Sbjct  125  NNINWQPPSHSDSVAKENKMSAIGAGDGVSSSAQPSPVYQSAWMGVPGQVSMADIVKMGR  184

Query  731  PHGKA  745
            P  KA
Sbjct  185  PQNKA  189



>ref|XP_006449625.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62865.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=878

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 138/207 (67%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKEIKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFSSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+       DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTSAVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>ref|XP_006449624.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62864.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=863

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 138/207 (67%), Gaps = 33/207 (16%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRKIV+SLKEIV N PESEIYA LKECNMDPNEAVNRLLSQDPFHEVKSKRDK
Sbjct  17   ISSIPAGSRKIVQSLKEIV-NCPESEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKRDK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY---------------  517
            RKE KDTT+SR RGAS++           GRGG++    +S  AY               
Sbjct  76   RKEIKDTTDSRSRGASNTSNR-------GGRGGTDRYGVRSGAAYFSSNESGTLQSKPAY  128

Query  518  -KEN---GYTNTKSTR--TAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KEN   GY  + S+      +  N+  P  SD   TEN+       DG+S+++Q SSG+
Sbjct  129  KKENGTHGYAGSSSSAAGVVANNMNQRPPFYSDDMPTENKTSAVVSGDGISSSSQPSSGF  188

Query  668  QSAWVGVPGQVSMADIVKMGKPHGKAP  748
            QS+W+GVPGQVSMADIVKMG+PH KAP
Sbjct  189  QSSWLGVPGQVSMADIVKMGRPHNKAP  215



>gb|KHF99174.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=869

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 134/195 (69%), Gaps = 20/195 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENGYTNT  541
            +KD+ E+R RGA++      +  +DRYAGRGGS           HGK     +  G+   
Sbjct  83   SKDSVEARSRGANNLGSRGGRSGSDRYAGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  542  KSTRTA----GSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQ  697
              + +A    G+  NR   + S+ A +E++     L DGVS+++Q  +GYQSAW+GVPGQ
Sbjct  143  GFSSSASGMRGNNMNRGPQSHSEVAVSEHKISTVGLGDGVSSSSQ-PTGYQSAWLGVPGQ  201

Query  698  VSMADIVKMGKPHGK  742
            VSMADIVKMG+P  K
Sbjct  202  VSMADIVKMGRPQNK  216



>gb|KHF99173.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=891

 Score =   168 bits (426),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 134/195 (69%), Gaps = 20/195 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENGYTNT  541
            +KD+ E+R RGA++      +  +DRYAGRGGS           HGK     +  G+   
Sbjct  83   SKDSVEARSRGANNLGSRGGRSGSDRYAGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  542  KSTRTA----GSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQ  697
              + +A    G+  NR   + S+ A +E++     L DGVS+++Q  +GYQSAW+GVPGQ
Sbjct  143  GFSSSASGMRGNNMNRGPQSHSEVAVSEHKISTVGLGDGVSSSSQ-PTGYQSAWLGVPGQ  201

Query  698  VSMADIVKMGKPHGK  742
            VSMADIVKMG+P  K
Sbjct  202  VSMADIVKMGRPQNK  216



>gb|KJB69764.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=575

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 135/195 (69%), Gaps = 20/195 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENGY---  532
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK     +  G+   
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  533  -TNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQ  697
             +++ ++   G+  NR   + S+ A +E++     L DGVS+++Q  +GYQSAW+GVPGQ
Sbjct  143  GSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ-PTGYQSAWLGVPGQ  201

Query  698  VSMADIVKMGKPHGK  742
            VSMADIVKMG+P  K
Sbjct  202  VSMADIVKMGRPQNK  216



>ref|XP_011085623.1| PREDICTED: uncharacterized protein LOC105167549 [Sesamum indicum]
Length=848

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 134/198 (68%), Gaps = 19/198 (10%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+GS K+V+SLKEIV N  E+EIYA LKECNMDPNEAVNRLLSQDPF EVKSKR+K
Sbjct  25   VQPIPAGSWKVVQSLKEIV-NCSEAEIYATLKECNMDPNEAVNRLLSQDPFREVKSKREK  83

Query  383  RKENKDTTEsrprgasssr--------ggkgsadrYAGRGGSES-LHGKSTYAYKENGYT  535
            +KE KD ++SR RGA++S           + S   ++    SES LHGKS Y  KENG T
Sbjct  84   KKEGKDNSDSRSRGANNSSNRGGKSGADRRPSRSTFSPYSSSESPLHGKSAYK-KENGST  142

Query  536  NTKSTRTA----GSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVP  691
            +  S  +A    G+  +R  P +SD A  E++  +    DG+ +  Q +SG+QSAW  +P
Sbjct  143  HASSLSSAPGMTGNNRSRGPPGLSDGASAESKGFLLETSDGMPSVVQPASGHQSAWGALP  202

Query  692  GQVSMADIVKMGKPHGKA  745
            GQVSMADIV+MG+PH KA
Sbjct  203  GQVSMADIVRMGRPHNKA  220



>gb|KJB69767.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=641

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 135/195 (69%), Gaps = 20/195 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENGY---  532
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK     +  G+   
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQKRENGGHPVA  142

Query  533  -TNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQ  697
             +++ ++   G+  NR   + S+ A +E++     L DGVS+++Q  +GYQSAW+GVPGQ
Sbjct  143  GSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ-PTGYQSAWLGVPGQ  201

Query  698  VSMADIVKMGKPHGK  742
            VSMADIVKMG+P  K
Sbjct  202  VSMADIVKMGRPQNK  216



>gb|KJB69766.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=707

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 136/196 (69%), Gaps = 22/196 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENG----  529
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK     +ENG    
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQK-RENGGHPV  141

Query  530  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPG  694
              +++ ++   G+  NR   + S+ A +E++     L DGVS+++Q  +GYQSAW+GVPG
Sbjct  142  AGSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ-PTGYQSAWLGVPG  200

Query  695  QVSMADIVKMGKPHGK  742
            QVSMADIVKMG+P  K
Sbjct  201  QVSMADIVKMGRPQNK  216



>ref|XP_011005846.1| PREDICTED: uncharacterized protein LOC105112008 isoform X2 [Populus 
euphratica]
Length=874

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 134/208 (64%), Gaps = 29/208 (14%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ------DPFHEV  364
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQ       PFHEV
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQGFFPRNHPFHEV  77

Query  365  KSKRDKRKENKDTTEsrprgasssrggkgsa-drYAGRGG-----------SESLHGKST  508
            KSKR+K+KENKD T+SR RGA++     G       GRGG           S +LHGK +
Sbjct  78   KSKREKKKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPS  137

Query  509  YAYKENGYT-----NTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  661
            Y  KENG       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S 
Sbjct  138  YK-KENGANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPSP  196

Query  662  GYQSAWVGVPGQVSMADIVKMGKPHGKA  745
            GYQSAW+G+ GQVS+ADIVKMG+P  KA
Sbjct  197  GYQSAWMGLSGQVSLADIVKMGRPQNKA  224



>ref|XP_011005845.1| PREDICTED: uncharacterized protein LOC105112008 isoform X1 [Populus 
euphratica]
Length=875

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 134/208 (64%), Gaps = 29/208 (14%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ------DPFHEV  364
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQ       PFHEV
Sbjct  19   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQGFFPRNHPFHEV  77

Query  365  KSKRDKRKENKDTTEsrprgasssrggkgsa-drYAGRGG-----------SESLHGKST  508
            KSKR+K+KENKD T+SR RGA++     G       GRGG           S +LHGK +
Sbjct  78   KSKREKKKENKDPTDSRSRGANNMSNRGGRGGADRNGRGGPGRPAYFSSNESSTLHGKPS  137

Query  509  YAYKENGYT-----NTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSS  661
            Y  KENG       +  ++ T G+  N   P  SD+  TEN+       DGVS+++Q S 
Sbjct  138  YK-KENGANAYAGPSPSASGTVGNNINWQPPYHSDSVATENKMSTVGAGDGVSSSSQPSP  196

Query  662  GYQSAWVGVPGQVSMADIVKMGKPHGKA  745
            GYQSAW+G+ GQVS+ADIVKMG+P  KA
Sbjct  197  GYQSAWMGLSGQVSLADIVKMGRPQNKA  224



>gb|KJB69763.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=869

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 136/196 (69%), Gaps = 22/196 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENG----  529
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK     +ENG    
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQK-RENGGHPV  141

Query  530  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPG  694
              +++ ++   G+  NR   + S+ A +E++     L DGVS+++Q  +GYQSAW+GVPG
Sbjct  142  AGSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ-PTGYQSAWLGVPG  200

Query  695  QVSMADIVKMGKPHGK  742
            QVSMADIVKMG+P  K
Sbjct  201  QVSMADIVKMGRPQNK  216



>ref|XP_006377248.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
 gb|ERP55045.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
Length=894

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 131/222 (59%), Gaps = 44/222 (20%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  24   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  82

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGG--------------------------  481
            +KENKD+T+ R R  ++ S  G        GRGG                          
Sbjct  83   KKENKDSTDFRSRGASNISNRGGRGGADRYGRGGPGRSAYFNSNVNHLFSVQLMWTITNN  142

Query  482  ----SESLHGKSTYAYKENGYTNT------KSTRTAGSTTNRWLPTISDAAGTENQKLV-  628
                S + H K  Y  KENG TN        ++  AG+  N   P+ SD+   EN+    
Sbjct  143  FSPESSTFHSKPAYK-KENG-TNAYIDPFPSASGIAGNNINWQPPSHSDSVAAENKMSTI  200

Query  629  ---DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
               DGVS++ Q S  YQSAW+GVPGQVSMADIVKMG+P  KA
Sbjct  201  GAGDGVSSSPQPSPVYQSAWMGVPGQVSMADIVKMGRPQNKA  242



>gb|KJB69765.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=867

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 136/196 (69%), Gaps = 22/196 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRK+V+SLKEIV N PE EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSKRDK+KE
Sbjct  24   IPPGSRKMVQSLKEIV-NCPEPEIYAMLKDCNMDPNEAVNRLLSQDPFHEVKSKRDKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENG----  529
            +KD+ ++R RGA++      +  +DRY GRGGS           HGK     +ENG    
Sbjct  83   SKDSVDARSRGANNLGSRGGRSGSDRYTGRGGSSHYSSNESGPSHGKPAQK-RENGGHPV  141

Query  530  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPG  694
              +++ ++   G+  NR   + S+ A +E++     L DGVS+++Q  +GYQSAW+GVPG
Sbjct  142  AGSSSSASGMQGNNMNRRPQSHSEVAVSEHKISTVGLGDGVSSSSQ-PTGYQSAWLGVPG  200

Query  695  QVSMADIVKMGKPHGK  742
            QVSMADIVKMG+P  K
Sbjct  201  QVSMADIVKMGRPQNK  216



>ref|XP_010243690.1| PREDICTED: uncharacterized protein LOC104587685 isoform X2 [Nelumbo 
nucifera]
Length=855

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 128/188 (68%), Gaps = 21/188 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+ SRKIV+SLKEIV NYPE EIYA LKECNMDPN+ ++RLLSQDPFHEVKS+R+K
Sbjct  18   VPSIPAASRKIVQSLKEIV-NYPEHEIYAMLKECNMDPNDTIHRLLSQDPFHEVKSRREK  76

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRT--  556
            +KE+K+TTESR RG  S+          + RG   SL GK   AYK+    N   + +  
Sbjct  77   KKESKETTESRSRGLGST----------SNRGEPGSLRGKP--AYKKENEANAFPSSSSA  124

Query  557  ---AGSTTNRW---LPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIV  718
               AG++T+R    L ++S  +  ++    DG+S+A Q S G+Q AW+GVPGQVS+ADIV
Sbjct  125  SGMAGNSTSRRPTSLSSVSAESKIQSTSTCDGISSALQPSPGHQPAWLGVPGQVSLADIV  184

Query  719  KMGKPHGK  742
            +MG+P  K
Sbjct  185  RMGRPQNK  192



>ref|XP_002317304.2| kinase-related family protein [Populus trichocarpa]
 gb|EEE97916.2| kinase-related family protein [Populus trichocarpa]
Length=909

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 131/222 (59%), Gaps = 44/222 (20%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+ SRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  24   ISGIPAASRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  82

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGG--------------------------  481
            +KENKD+T+ R R  ++ S  G        GRGG                          
Sbjct  83   KKENKDSTDFRSRGASNISNRGGRGGADRYGRGGPGRSAYFNSNVNHLFSVQLMWTITNN  142

Query  482  ----SESLHGKSTYAYKENGYTNT------KSTRTAGSTTNRWLPTISDAAGTENQKLV-  628
                S + H K  Y  KENG TN        ++  AG+  N   P+ SD+   EN+    
Sbjct  143  FSPESSTFHSKPAYK-KENG-TNAYIDPFPSASGIAGNNINWQPPSHSDSVAAENKMSTI  200

Query  629  ---DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
               DGVS++ Q S  YQSAW+GVPGQVSMADIVKMG+P  KA
Sbjct  201  GAGDGVSSSPQPSPVYQSAWMGVPGQVSMADIVKMGRPQNKA  242



>ref|XP_006597650.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=800

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 130/199 (65%), Gaps = 22/199 (11%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  19   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  78

Query  386  KENKDTTEsrprgasssrggk-----gsadrYAGRGGSES-------LHGKSTYAYKENG  529
            KE KD T+SR RG+ ++            DRY GRGG+         L GK  Y  KENG
Sbjct  79   KEIKDPTDSRSRGSGTNNTSSRGGGRAGTDRYGGRGGANQFGSSDYGLQGKPVYK-KENG  137

Query  530  Y-TNTKSTRTA----GSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVG  685
              T   ST +A    G+ TN  LP+ SD+  TE        DG S+++Q  +G QSAW G
Sbjct  138  APTFGGSTSSAPSVLGNNTNTRLPSYSDSVVTEKTYAFGIGDGPSSSSQR-AGLQSAWTG  196

Query  686  VPGQVSMADIVKMGKPHGK  742
              GQVSMADIVKMG+P  +
Sbjct  197  NTGQVSMADIVKMGRPQAR  215



>ref|XP_006597649.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=832

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 130/199 (65%), Gaps = 22/199 (11%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  19   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  78

Query  386  KENKDTTEsrprgasssrggk-----gsadrYAGRGGSES-------LHGKSTYAYKENG  529
            KE KD T+SR RG+ ++            DRY GRGG+         L GK  Y  KENG
Sbjct  79   KEIKDPTDSRSRGSGTNNTSSRGGGRAGTDRYGGRGGANQFGSSDYGLQGKPVYK-KENG  137

Query  530  Y-TNTKSTRTA----GSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVG  685
              T   ST +A    G+ TN  LP+ SD+  TE        DG S+++Q  +G QSAW G
Sbjct  138  APTFGGSTSSAPSVLGNNTNTRLPSYSDSVVTEKTYAFGIGDGPSSSSQR-AGLQSAWTG  196

Query  686  VPGQVSMADIVKMGKPHGK  742
              GQVSMADIVKMG+P  +
Sbjct  197  NTGQVSMADIVKMGRPQAR  215



>emb|CDP17325.1| unnamed protein product [Coffea canephora]
Length=877

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 135/199 (68%), Gaps = 24/199 (12%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVN+LLSQDPFHEVKSKR+K+KE
Sbjct  39   IPSGSRKIVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNKLLSQDPFHEVKSKREKKKE  97

Query  392  NKDTTEsrpr-gasssrggkgsadrYAGRGGSE----SLHGKSTYAYKENG---YTNTKS  547
             KDT+ESRPR  +S+S  G+   DRY  RGGS     +LHG+  +  KENG   Y ++ S
Sbjct  98   GKDTSESRPRGTSSTSNRGRIGTDRYPSRGGSSAESGALHGRPAHK-KENGPNAYASSLS  156

Query  548  TRT--AGSTTNRWLPTISDAAGTENQK-----------LVDGVSAATQHSSGYQSAWVGV  688
            + +  AG++T+R   + S  A                 ++D  S  +Q  SGYQ  WVG 
Sbjct  157  STSAVAGNSTSRRPTSYSSDAAAAASATATEVKGPALGMLDSASLVSQ-PSGYQPTWVGA  215

Query  689  PGQVSMADIVKMGKPHGKA  745
            PGQ+SMADIVKMGKP  KA
Sbjct  216  PGQISMADIVKMGKPQSKA  234



>ref|XP_007159534.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
 gb|ESW31528.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
Length=847

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 131/198 (66%), Gaps = 28/198 (14%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP  SRK+V+SLKEIV N PE EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  13   IPPASRKMVQSLKEIVSNIPEHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  72

Query  392  NKDTTEsrprgasssrg------gkgsadrYAGRGGSES---------LHGKSTYAYKEN  526
             KDTT+SRPRG S++         + SADRY GRGG+           L GK     KEN
Sbjct  73   TKDTTDSRPRGLSNTSSRGSGGGARVSADRYVGRGGATQFSSSGDSGLLQGKPVLK-KEN  131

Query  527  GY-TNTKSTRTAGST----TNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVP  691
            G  T   ST +A S      NR LP+ SD+ G     + DG+S ++QH  G QSAW   P
Sbjct  132  GTPTYGGSTFSAHSALDNNANRQLPSYSDSVG-----VCDGLS-SSQH-GGLQSAWGASP  184

Query  692  GQVSMADIVKMGKPHGKA  745
            GQVSMADIV+MG+P  KA
Sbjct  185  GQVSMADIVRMGRPQTKA  202



>ref|XP_009353842.1| PREDICTED: uncharacterized protein LOC103945058 isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009360836.1| PREDICTED: uncharacterized protein LOC103951238 isoform X4 [Pyrus 
x bretschneideri]
Length=855

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 134/196 (68%), Gaps = 16/196 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYT  535
            +KE K+ T+SR R   ++S  G    DRY+ RGGS           HGK  Y  KENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  536  NTKSTRT--AGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQ  697
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+GYQSAWVGVPGQ
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSAGYQSAWVGVPGQ  197

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMG+P GKA
Sbjct  198  VSMADIVKMGRPQGKA  213



>ref|XP_010275810.1| PREDICTED: uncharacterized protein LOC104610735 isoform X2 [Nelumbo 
nucifera]
Length=889

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 124/194 (64%), Gaps = 16/194 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+ SRK+V+SLKEIV NYPE EIYA LKECNMDPN+ V+RLLSQDPFHEVKSKR+K
Sbjct  17   VPSIPAASRKMVQSLKEIV-NYPEHEIYAMLKECNMDPNDTVHRLLSQDPFHEVKSKREK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrY-AGRGGSES----LHGKSTYAYKENGYTNTKS  547
            +KE K T E R RG SS+            GRGG  S    L GK  Y  KENG     S
Sbjct  76   KKEIKVTAEPRSRGVSSTSNRGRGGTDRNVGRGGLTSETGGLRGKPAYK-KENGANAFPS  134

Query  548  TRTAG-----STTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQV  700
            + ++      +T NR   + SD    E++       DG+S A+Q S GYQ AW+GVPGQV
Sbjct  135  SSSSASGMVETTINRRPTSSSDLVAAESKTQTTSTGDGISLASQPSPGYQPAWLGVPGQV  194

Query  701  SMADIVKMGKPHGK  742
            SMADIVKMG+P  K
Sbjct  195  SMADIVKMGRPQNK  208



>ref|XP_009353840.1| PREDICTED: uncharacterized protein LOC103945058 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009360833.1| PREDICTED: uncharacterized protein LOC103951238 isoform X2 [Pyrus 
x bretschneideri]
Length=856

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 134/196 (68%), Gaps = 16/196 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYT  535
            +KE K+ T+SR R   ++S  G    DRY+ RGGS           HGK  Y  KENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  536  NTKSTRT--AGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQ  697
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+GYQSAWVGVPGQ
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSAGYQSAWVGVPGQ  197

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMG+P GKA
Sbjct  198  VSMADIVKMGRPQGKA  213



>ref|XP_009353841.1| PREDICTED: uncharacterized protein LOC103945058 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009360834.1| PREDICTED: uncharacterized protein LOC103951238 isoform X3 [Pyrus 
x bretschneideri]
Length=856

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 134/196 (68%), Gaps = 16/196 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYT  535
            +KE K+ T+SR R   ++S  G    DRY+ RGGS           HGK  Y  KENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  536  NTKSTRT--AGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQ  697
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+GYQSAWVGVPGQ
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSAGYQSAWVGVPGQ  197

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMG+P GKA
Sbjct  198  VSMADIVKMGRPQGKA  213



>ref|XP_009353839.1| PREDICTED: uncharacterized protein LOC103945058 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009360832.1| PREDICTED: uncharacterized protein LOC103951238 isoform X1 [Pyrus 
x bretschneideri]
Length=856

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 134/196 (68%), Gaps = 16/196 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYT  535
            +KE K+ T+SR R   ++S  G    DRY+ RGGS           HGK  Y  KENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  536  NTKSTRT--AGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQ  697
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+GYQSAWVGVPGQ
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSAGYQSAWVGVPGQ  197

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMG+P GKA
Sbjct  198  VSMADIVKMGRPQGKA  213



>ref|XP_009353838.1| PREDICTED: uncharacterized protein LOC103945058 isoform X1 [Pyrus 
x bretschneideri]
Length=857

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 134/196 (68%), Gaps = 16/196 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYT  535
            +KE K+ T+SR R   ++S  G    DRY+ RGGS           HGK  Y  KENG  
Sbjct  79   KKEGKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  536  NTKSTRT--AGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQ  697
                + +   G  T R   + SD+ G+EN+       DG+ +++Q S+GYQSAWVGVPGQ
Sbjct  138  AIPGSASGMVGHNTGRRPTSYSDSVGSENKIPTLSTDDGILSSSQPSAGYQSAWVGVPGQ  197

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMG+P GKA
Sbjct  198  VSMADIVKMGRPQGKA  213



>ref|XP_010275801.1| PREDICTED: uncharacterized protein LOC104610735 isoform X1 [Nelumbo 
nucifera]
Length=907

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 124/194 (64%), Gaps = 16/194 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+ SRK+V+SLKEIV NYPE EIYA LKECNMDPN+ V+RLLSQDPFHEVKSKR+K
Sbjct  17   VPSIPAASRKMVQSLKEIV-NYPEHEIYAMLKECNMDPNDTVHRLLSQDPFHEVKSKREK  75

Query  383  RKENKDTTEsrprgasssrggkgsadrY-AGRGGSES----LHGKSTYAYKENGYTNTKS  547
            +KE K T E R RG SS+            GRGG  S    L GK  Y  KENG     S
Sbjct  76   KKEIKVTAEPRSRGVSSTSNRGRGGTDRNVGRGGLTSETGGLRGKPAYK-KENGANAFPS  134

Query  548  TRTAG-----STTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQV  700
            + ++      +T NR   + SD    E++       DG+S A+Q S GYQ AW+GVPGQV
Sbjct  135  SSSSASGMVETTINRRPTSSSDLVAAESKTQTTSTGDGISLASQPSPGYQPAWLGVPGQV  194

Query  701  SMADIVKMGKPHGK  742
            SMADIVKMG+P  K
Sbjct  195  SMADIVKMGRPQNK  208



>ref|XP_010243689.1| PREDICTED: uncharacterized protein LOC104587685 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 133/198 (67%), Gaps = 21/198 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP+ SRKIV+SLKEIV NYPE EIYA LKECNMDPN+ ++RLLSQDPFHEVKS+R+K
Sbjct  18   VPSIPAASRKIVQSLKEIV-NYPEHEIYAMLKECNMDPNDTIHRLLSQDPFHEVKSRREK  76

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRGGSE--------SLHGKSTYAYKENGY  532
            +KE+K+TTESR RG  S+     KG  DR  GRGG          SL GK   AYK+   
Sbjct  77   KKESKETTESRSRGLGSTSNRGGKGGTDRNVGRGGPTQFSSAEPGSLRGKP--AYKKENE  134

Query  533  TNTKSTRT-----AGSTTNRW---LPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGV  688
             N   + +     AG++T+R    L ++S  +  ++    DG+S+A Q S G+Q AW+GV
Sbjct  135  ANAFPSSSSASGMAGNSTSRRPTSLSSVSAESKIQSTSTCDGISSALQPSPGHQPAWLGV  194

Query  689  PGQVSMADIVKMGKPHGK  742
            PGQVS+ADIV+MG+P  K
Sbjct  195  PGQVSLADIVRMGRPQNK  212



>ref|XP_004504230.1| PREDICTED: serine/threonine-protein kinase pakD-like [Cicer arietinum]
Length=861

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 124/202 (61%), Gaps = 31/202 (15%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V+SLKEIV N P++EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  16   IPAASRKMVQSLKEIVNNIPDNEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  75

Query  392  NKDTTEsrprgasssrgg-----kgsadrYAGRGGSESLH-GKSTYAY--------KENG  529
             KD TE R RG + +        +   DRY GRGG+ S     S Y +        KENG
Sbjct  76   GKDITEPRSRGTNYNTSSRVGGGRTGTDRYVGRGGASSTQFSNSDYGFPQVKPVYKKENG  135

Query  530  YTNTKSTRTAGSTT-----------NRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSA  676
                      G +T           NR LP+ SD+ G     + DG+S+++ H  G QSA
Sbjct  136  TPAYGGPAPYGGSTSYASSVMENNVNRQLPSYSDSVG-----VSDGLSSSSHH-GGLQSA  189

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W   PGQVSMADIVKMG+P  K
Sbjct  190  WTVSPGQVSMADIVKMGRPQIK  211



>ref|XP_008366008.1| PREDICTED: protein lingerer-like [Malus domestica]
Length=856

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 136/197 (69%), Gaps = 18/197 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEV+SKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVRSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENG--  529
            +KE+K+ T+SR R   ++S  G    DRY+ RGGS           HGK  Y  KENG  
Sbjct  79   KKESKEPTDSRSRGANNTSSYGARGGDRYSARGGSNHYSSNDSGFSHGKPAYK-KENGTH  137

Query  530  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPG  694
             Y  + S   AG  T R   + SD+ G+EN+       DG+ +++Q S+GYQSAWVGVPG
Sbjct  138  AYPGSASV-MAGHNTGRRPTSYSDSVGSENKIPALSTDDGILSSSQPSAGYQSAWVGVPG  196

Query  695  QVSMADIVKMGKPHGKA  745
            QVSMADIVKMG+P  KA
Sbjct  197  QVSMADIVKMGRPQAKA  213



>ref|XP_008364176.1| PREDICTED: uncharacterized protein LOC103427870 isoform X3 [Malus 
domestica]
Length=856

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 138/197 (70%), Gaps = 18/197 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENG--  529
            +KE+K+ T+SR R  +++S  G    DRY+ RGGS           HGKS Y  KENG  
Sbjct  79   KKESKEPTDSRSRGASNASSYGARGGDRYSARGGSNHFSSNDSGFSHGKSAYK-KENGTH  137

Query  530  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPG  694
             Y  + S   AG+ T R   + SD+ G+EN+       DG+S+ +Q SSGYQSAW GVPG
Sbjct  138  AYPGSASG-MAGNHTGRRPTSYSDSVGSENKMPTLSTDDGISSFSQPSSGYQSAWGGVPG  196

Query  695  QVSMADIVKMGKPHGKA  745
            QVSMADIVKMG+P  KA
Sbjct  197  QVSMADIVKMGRPQAKA  213



>ref|XP_008364175.1| PREDICTED: uncharacterized protein LOC103427870 isoform X2 [Malus 
domestica]
Length=857

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 138/197 (70%), Gaps = 18/197 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENG--  529
            +KE+K+ T+SR R  +++S  G    DRY+ RGGS           HGKS Y  KENG  
Sbjct  79   KKESKEPTDSRSRGASNASSYGARGGDRYSARGGSNHFSSNDSGFSHGKSAYK-KENGTH  137

Query  530  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPG  694
             Y  + S   AG+ T R   + SD+ G+EN+       DG+S+ +Q SSGYQSAW GVPG
Sbjct  138  AYPGSASG-MAGNHTGRRPTSYSDSVGSENKMPTLSTDDGISSFSQPSSGYQSAWGGVPG  196

Query  695  QVSMADIVKMGKPHGKA  745
            QVSMADIVKMG+P  KA
Sbjct  197  QVSMADIVKMGRPQAKA  213



>ref|XP_008364174.1| PREDICTED: uncharacterized protein LOC103427870 isoform X1 [Malus 
domestica]
Length=857

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 138/197 (70%), Gaps = 18/197 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  19   ISGIPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREK  78

Query  383  RKENKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENG--  529
            +KE+K+ T+SR R  +++S  G    DRY+ RGGS           HGKS Y  KENG  
Sbjct  79   KKESKEPTDSRSRGASNASSYGARGGDRYSARGGSNHFSSNDSGFSHGKSAYK-KENGTH  137

Query  530  -YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPG  694
             Y  + S   AG+ T R   + SD+ G+EN+       DG+S+ +Q SSGYQSAW GVPG
Sbjct  138  AYPGSASG-MAGNHTGRRPTSYSDSVGSENKMPTLSTDDGISSFSQPSSGYQSAWGGVPG  196

Query  695  QVSMADIVKMGKPHGKA  745
            QVSMADIVKMG+P  KA
Sbjct  197  QVSMADIVKMGRPQAKA  213



>gb|KHN48057.1| hypothetical protein glysoja_015527 [Glycine soja]
Length=817

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 123/182 (68%), Gaps = 20/182 (11%)
 Frame = +2

Query  233  IVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDTTEs  412
            +V+SL+EIV N PE EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE KDTT++
Sbjct  1    MVQSLREIVSNIPEHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKEGKDTTDT  60

Query  413  rprgasssrg-----gkgsadrYAGRGGSESLHGKSTYAYKEN------GYTNTKSTRTA  559
            R RG S++        +  +DRY GRG S  L GK  +  KEN      GYT   S+ + 
Sbjct  61   RSRGISNASSRGGGGARVGSDRYVGRGDSGLLQGKPVFK-KENGTPAYGGYTAPASS-SL  118

Query  560  GSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHG  739
             +  NR LP+ SD+      ++ DG+S ++QH  G QS W   PGQVSMADIV+MG+P  
Sbjct  119  DNNVNRQLPSYSDSV-----RVCDGLS-SSQH-GGLQSPWAANPGQVSMADIVRMGRPQA  171

Query  740  KA  745
            KA
Sbjct  172  KA  173



>ref|XP_006580202.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=845

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 123/196 (63%), Gaps = 26/196 (13%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP  SRK+V+SLKEIV N PE EIYA LK+CNMDPNEAV+RLLSQD FHEVKSKR+K+KE
Sbjct  13   IPPASRKMVQSLKEIVSNIPEHEIYATLKDCNMDPNEAVSRLLSQDTFHEVKSKREKKKE  72

Query  392  NKDTTEsrprgasssrg----gkgsadrYAGRGGSES---------LHGKSTYAYKENGY  532
             KDTT+SR R  S++       + SADRY GRGG+           L GK     KENG 
Sbjct  73   GKDTTDSRSRVVSNTSSRGGGARVSADRYVGRGGATQFSSGGDSGLLQGKPVLK-KENGT  131

Query  533  -----TNTKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQ  697
                     ++    +  NR LP+ SD+      ++ DG+S++     G QS WV  PGQ
Sbjct  132  PAYGGLTAPASSALDNNVNRQLPSYSDSV-----RVCDGLSSS--QYGGMQSPWVANPGQ  184

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIV+MG+P  KA
Sbjct  185  VSMADIVRMGRPQAKA  200



>ref|XP_003534759.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=838

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 127/199 (64%), Gaps = 22/199 (11%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  386  KENKDTTEsrprgasssrggk-----gsadrYAGRGGSES-------LHGKSTYAYKENG  529
            KE KD TESR RG+ ++            DR  GRGG+         L GK  Y  KENG
Sbjct  72   KEIKDPTESRSRGSGTNNTSSRGGGRAGTDRNGGRGGANQFGSSDYGLQGKPVYK-KENG  130

Query  530  Y-TNTKSTRTA----GSTTNRWLPTISDAAGTENQ---KLVDGVSAATQHSSGYQSAWVG  685
              T   ST +A    G+  N    + SD+  TE      + DG S+++Q  +G QSAW G
Sbjct  131  APTYGGSTSSAPSVLGNNANMRPASYSDSVVTEKTYAFSIGDGPSSSSQR-AGVQSAWAG  189

Query  686  VPGQVSMADIVKMGKPHGK  742
              GQVSMADIVKMG+P  +
Sbjct  190  NTGQVSMADIVKMGRPQAR  208



>ref|XP_006586817.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=837

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 127/199 (64%), Gaps = 22/199 (11%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  386  KENKDTTEsrprgasssrggk-----gsadrYAGRGGSES-------LHGKSTYAYKENG  529
            KE KD TESR RG+ ++            DR  GRGG+         L GK  Y  KENG
Sbjct  72   KEIKDPTESRSRGSGTNNTSSRGGGRAGTDRNGGRGGANQFGSSDYGLQGKPVYK-KENG  130

Query  530  Y-TNTKSTRTA----GSTTNRWLPTISDAAGTENQ---KLVDGVSAATQHSSGYQSAWVG  685
              T   ST +A    G+  N    + SD+  TE      + DG S+++Q  +G QSAW G
Sbjct  131  APTYGGSTSSAPSVLGNNANMRPASYSDSVVTEKTYAFSIGDGPSSSSQR-AGVQSAWAG  189

Query  686  VPGQVSMADIVKMGKPHGK  742
              GQVSMADIVKMG+P  +
Sbjct  190  NTGQVSMADIVKMGRPQAR  208



>ref|XP_007147529.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
 gb|ESW19523.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
Length=843

 Score =   152 bits (383),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 126/199 (63%), Gaps = 22/199 (11%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  19   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  78

Query  386  KENKDTTEsrprgasssrggk-----gsadrYAGRGGSES-------LHGKSTYAYKENG  529
            KE KD  +SR RG+ +S            DR+ GRG +         L GK  Y  KENG
Sbjct  79   KEIKDPIDSRSRGSGTSNTSSRGGGRAGTDRHGGRGSANQFGSSDSGLQGKPAYK-KENG  137

Query  530  Y-----TNTKSTRTAGSTTNRWLPTISDAAGTENQK---LVDGVSAATQHSSGYQSAWVG  685
                  + + ++   G+  NR   + SD+  TE      + DG S+++Q   G QSAW+G
Sbjct  138  APSYGGSTSSASSVLGNNANRRPVSYSDSVATEKTYALGISDGPSSSSQR-PGLQSAWMG  196

Query  686  VPGQVSMADIVKMGKPHGK  742
              GQVSMADIVKMG+P  +
Sbjct  197  NAGQVSMADIVKMGRPQAR  215



>gb|EYU28172.1| hypothetical protein MIMGU_mgv1a001362mg [Erythranthe guttata]
Length=833

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 125/211 (59%), Gaps = 29/211 (14%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V +IP+GSRK+V+SLKEIV    E+EIYAALK+CNMDPNEAVNRLL QDPFHEVKSKR+K
Sbjct  15   VQLIPAGSRKMVQSLKEIV-GCSEAEIYAALKDCNMDPNEAVNRLLCQDPFHEVKSKREK  73

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRGGSESLHGKSTY---------------  511
            +KE KDTTESR RGAS++     K  ADRY GRG   S     T                
Sbjct  74   KKEGKDTTESRSRGASNNSSRGGKSGADRYHGRGAPTSYTSSGTLQDIDRIYNILFRFSE  133

Query  512  ------AYKENGYTNTKSTR-----TAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHS  658
                  + KENG T   S+      TA +  +R    +SD    EN+   D + A    +
Sbjct  134  YSGRPSSKKENGSTPYASSSSSVPVTAANNRSRGPIGVSDGGVAENKGTADAIPAVVPPA  193

Query  659  SGYQSAWVGVPGQVSMADIVKMGKPHGKAPN  751
            +GYQ AWV  PGQVSM DIVK G P   APN
Sbjct  194  AGYQPAWVLAPGQVSMVDIVKKGIPRNNAPN  224



>ref|XP_007214618.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
 gb|EMJ15817.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
Length=859

 Score =   151 bits (382),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 133/193 (69%), Gaps = 18/193 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  21   IPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREKKKE  80

Query  392  NKDTTEsrpr-gasssrggkgsadrYAGRGGSES--------LHGKSTYAYKENG---YT  535
            NK+ TE R R   S+S  G    DRYA RGGS          LHGKS Y  KENG   Y 
Sbjct  81   NKEPTEPRSRGANSTSNHGGRGGDRYAARGGSNHFSSNESGFLHGKSAYK-KENGTHAYA  139

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVS  703
             + S   AG   +R   + SD+ GTEN+       D + +++Q S+GYQSAWVGVPGQVS
Sbjct  140  GSASG-MAGHNMSRRPTSYSDSVGTENKISTISTDDAIYSSSQPSTGYQSAWVGVPGQVS  198

Query  704  MADIVKMGKPHGK  742
            MADIVKMG+P  K
Sbjct  199  MADIVKMGRPQAK  211



>ref|XP_010926244.1| PREDICTED: uncharacterized protein LOC105048593 [Elaeis guineensis]
Length=886

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 122/195 (63%), Gaps = 21/195 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPS SRK+V+++KEIV N P+SEIY+ LKECNMDPNEAV+RLLSQD FHEVKSKRDK+KE
Sbjct  18   IPSMSRKLVQTVKEIV-NCPDSEIYSMLKECNMDPNEAVHRLLSQDTFHEVKSKRDKKKE  76

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY--------KENGYTNTKS  547
             K+T ESR R  +SS  G       AGR  S +    S Y          KENG     +
Sbjct  77   IKETPESRSRAVNSSGRGARGGTDRAGRNNS-TQSSSSDYGLTRGKPANKKENGTPTVPT  135

Query  548  TRTAGSTT-----NRWLPTI-SDAAGTENQK----LVDGVSAATQHSSGYQSAWVGVPGQ  697
            +   GS       NR  PTI SD+A  EN      L +G+   +Q SSG+Q  W+G PG 
Sbjct  136  SSILGSIIVTSNPNRR-PTIPSDSASMENTMQATGLSEGIRTPSQTSSGFQHNWLGKPGH  194

Query  698  VSMADIVKMGKPHGK  742
            VSMADIVKMG+P GK
Sbjct  195  VSMADIVKMGRPQGK  209



>ref|XP_010549430.1| PREDICTED: uncharacterized protein LOC104820614 [Tarenaya hassleriana]
Length=826

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 134/200 (67%), Gaps = 22/200 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V+ IPSGSRK+V+SLKEIV N+PE+EIYA LKECNMDPNEA+NRLLSQDPFHEVKSK+DK
Sbjct  21   VSNIPSGSRKMVQSLKEIV-NFPEAEIYAMLKECNMDPNEAINRLLSQDPFHEVKSKKDK  79

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGG--------SESLHGKSTYAYKEN--  526
            +KENKDTT+SR RGA+++        +DRYAGRGG        S +  GKST   KEN  
Sbjct  80   KKENKDTTDSRARGANNTYNRGVRGGSDRYAGRGGATHFSSNESRNFQGKSTNK-KENVT  138

Query  527  -GYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVP  691
             GY     T +A     R  P  SD    EN+     L DG+   +Q +SG Q+AW G  
Sbjct  139  QGY--AWPTSSASGVEGRHQPLHSDFVAMENKMLSVSLTDGIQ-PSQSASGRQTAWFGAA  195

Query  692  GQVSMADIVKMGKPHGKAPN  751
            GQ+SMADIVKMG+P  K  N
Sbjct  196  GQMSMADIVKMGRPQNKTTN  215



>ref|XP_008797516.1| PREDICTED: uncharacterized protein LOC103712704 isoform X1 [Phoenix 
dactylifera]
Length=893

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 122/195 (63%), Gaps = 19/195 (10%)
 Frame = +2

Query  209  MIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            +IP+ SRK+V+S+KEIV N P+ EIY+ LKECNMDPNEAV+RLLSQD FHEVKSKRDK+K
Sbjct  17   LIPAMSRKLVQSVKEIV-NCPDPEIYSMLKECNMDPNEAVHRLLSQDTFHEVKSKRDKKK  75

Query  389  ENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY-------KENGYTNTKS  547
            E K+T ESR R  ++S  G       AGR  S         A        KENG  +  +
Sbjct  76   EIKETPESRSRAVNNSGRGARGGTDRAGRNSSIQSSSSDYGAARGKPANKKENGTPSVPT  135

Query  548  TRTAGSTT-----NRWLPTI-SDAAGTENQK----LVDGVSAATQHSSGYQSAWVGVPGQ  697
            +   GS T     NR  PTI SD+A  EN      L DG+   +Q SSG+Q  W+G PG 
Sbjct  136  SSILGSGTVASNPNRR-PTIPSDSASMENTMQATGLSDGIPTPSQTSSGFQHNWLGKPGH  194

Query  698  VSMADIVKMGKPHGK  742
            VSMADIVKMG+P GK
Sbjct  195  VSMADIVKMGRPLGK  209



>ref|XP_010540528.1| PREDICTED: uncharacterized protein LOC104814266 [Tarenaya hassleriana]
Length=832

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 132/199 (66%), Gaps = 20/199 (10%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK+DK
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKDK  79

Query  383  RKENKDTTEsrp--rgasssrggkgsadrYAGRGG--------SESLHGKSTYAYKE--N  526
            +KENKDTT+ +      + +RG +  +DRYAGRGG        S +  GKST   ++   
Sbjct  80   KKENKDTTDYKSRGANNTYNRGARSGSDRYAGRGGATNFSSYESGNFQGKSTSKREDGTE  139

Query  527  GYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPG  694
            GY  T  T  A     R+ P+ SD    EN+     + DG+   +Q +SG+Q AW G  G
Sbjct  140  GYVGT--TSAASGVMGRYQPSHSDFVAMENKMSSVHVADGIQ-PSQSASGHQPAWFGAAG  196

Query  695  QVSMADIVKMGKPHGKAPN  751
            Q+SMADIVKMG+P  K  N
Sbjct  197  QMSMADIVKMGRPQNKTMN  215



>ref|XP_008225366.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Prunus mume]
Length=860

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 132/193 (68%), Gaps = 18/193 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  21   IPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREKKKE  80

Query  392  NKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENG---YT  535
            NK+ TE R R   ++S  G    DRYA RGGS           HGKS Y  KENG   Y 
Sbjct  81   NKEPTEPRSRGANNTSNHGGRGGDRYAARGGSNHFSSNESGFSHGKSAYK-KENGTHAYA  139

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVS  703
             + S   AG   +R   + SD+ GTEN+       D + +++Q S+GYQSAWVGVPGQVS
Sbjct  140  GSASG-MAGHNMSRRPTSYSDSVGTENKISTISTDDAIYSSSQPSTGYQSAWVGVPGQVS  198

Query  704  MADIVKMGKPHGK  742
            MADIVKMG+P  K
Sbjct  199  MADIVKMGRPQAK  211



>ref|XP_008225365.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Prunus mume]
Length=861

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 132/193 (68%), Gaps = 18/193 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+GSRK+V+SLKEIV N  E EIYA LK+CNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  21   IPAGSRKMVQSLKEIVNNCTEQEIYAMLKDCNMDPNEAVNRLLAQDPFHEVKSKREKKKE  80

Query  392  NKDTTEsrpr-gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENG---YT  535
            NK+ TE R R   ++S  G    DRYA RGGS           HGKS Y  KENG   Y 
Sbjct  81   NKEPTEPRSRGANNTSNHGGRGGDRYAARGGSNHFSSNESGFSHGKSAYK-KENGTHAYA  139

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVS  703
             + S   AG   +R   + SD+ GTEN+       D + +++Q S+GYQSAWVGVPGQVS
Sbjct  140  GSASG-MAGHNMSRRPTSYSDSVGTENKISTISTDDAIYSSSQPSTGYQSAWVGVPGQVS  198

Query  704  MADIVKMGKPHGK  742
            MADIVKMG+P  K
Sbjct  199  MADIVKMGRPQAK  211



>gb|AFK38455.1| unknown [Medicago truncatula]
Length=443

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 122/203 (60%), Gaps = 31/203 (15%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V+SLKEIV N P++EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  18   IPATSRKMVQSLKEIVSNIPDNEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  77

Query  392  NKDTTEsrpr------gasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST-  550
             KDTTE R R       +    GG+  +DRYAGRGG       + ++  + G   +K   
Sbjct  78   GKDTTEPRSRGSNYNIPSRGGGGGRTGSDRYAGRGGGGGGASSNQFSNNDYGVPQSKPVF  137

Query  551  ------------------RTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSA  676
                                  +  NR  P+ SD+ G       DG+S+++ H  G QSA
Sbjct  138  KKENGTPAYGSSSTSYASSVMDNNVNRQPPSWSDSVGVH-----DGLSSSSHH-GGLQSA  191

Query  677  WVGVPGQVSMADIVKMGKPHGKA  745
            W   PGQVSMADIVKMG+P  KA
Sbjct  192  WSASPGQVSMADIVKMGRPQAKA  214



>ref|XP_011460396.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101310004 
[Fragaria vesca subsp. vesca]
Length=841

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 137/195 (70%), Gaps = 17/195 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP GSRKIV+SLKEIV N  E EIYA LKECNMDPNEAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  20   IPGGSRKIVQSLKEIVNNCTEQEIYAMLKECNMDPNEAVNRLLAQDPFHEVKSKREKKKE  79

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSE--------SLHGKSTYAYKENG---YTN  538
            +K+ T+SR RGA+ S  G    DRYA RGGS         SLHG+  Y  KENG   Y  
Sbjct  80   SKEPTDSRSRGANFSNYGGRGGDRYASRGGSNHFGTNESGSLHGRPAYR-KENGTPAYAG  138

Query  539  TKSTR--TAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVGVPGQVS  703
            + ST   T G  ++R  PT SD+   EN+      DG+S+++Q SSGYQSAW GVPGQVS
Sbjct  139  SSSTAAGTTGYNSSRRPPTYSDSVAAENKVTSLADDGISSSSQPSSGYQSAWXGVPGQVS  198

Query  704  MADIVKMGKPHGKAP  748
            MADIVK G+P  KAP
Sbjct  199  MADIVKKGRPQAKAP  213



>ref|XP_008439673.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=846

 Score =   148 bits (374),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 124/196 (63%), Gaps = 19/196 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  18   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  77

Query  392  NKDTTEsrp--rgasssrggkgsadrYAGR------GGSESLHGKSTYAY-KENGYTNTK  544
            NKD  +SR       SSR  K   +RYAGR      G S++    S   Y KENG ++  
Sbjct  78   NKDPIDSRSRGSSIPSSRTSKSGTERYAGRSSSIQFGSSDTGLSPSKPVYKKENGASDHA  137

Query  545  STRTAGSTTNR----WLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPGQ  697
             + +    +        P+ S+   TEN KL      DG  +++Q S G+QSAW+G  GQ
Sbjct  138  GSSSVSGQSGNHSFYQYPSHSNNVATEN-KLSGLGAGDGAISSSQTSFGFQSAWLGAQGQ  196

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMGKP GK+
Sbjct  197  VSMADIVKMGKPQGKS  212



>ref|XP_004486425.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=831

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 120/202 (59%), Gaps = 22/202 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V  IP  S+KIV+SLKEI+ N+PE EIYA L++CNMDPNE VNRLLSQDPFHEVKSKR+K
Sbjct  13   VTTIPPSSKKIVQSLKEILTNFPEHEIYAMLRDCNMDPNETVNRLLSQDPFHEVKSKREK  72

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGS------------ESLHGKSTYAYKEN  526
            +KENKD T+ R  G+ +S        R                     L GK+ +  KEN
Sbjct  73   KKENKDPTDYRSYGSGTSSTTSRGGGRGGTDRHGGHGVTNHYSSIDSGLLGKTVHK-KEN  131

Query  527  GY-----TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWV  682
            G      + + ++   G   NR  P+ S +  TE    +   DG+S+++Q+  G QSAW 
Sbjct  132  GIPAYGGSLSSTSSVMGINENRQPPSHSSSEATEKTSTIGINDGLSSSSQYGGGPQSAWK  191

Query  683  G-VPGQVSMADIVKMGKPHGKA  745
            G V GQVSMADIVK G+P  KA
Sbjct  192  GNVVGQVSMADIVKRGRPQAKA  213



>gb|KHN22963.1| hypothetical protein glysoja_030633 [Glycine soja]
Length=980

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 115/187 (61%), Gaps = 30/187 (16%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  386  KENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGY-TNTKSTRTA-  559
            KE KD TES                    R      +GK  Y  KENG  T   ST +A 
Sbjct  72   KEIKDPTES--------------------RSRGSGTNGKPVYK-KENGAPTYGGSTSSAP  110

Query  560  ---GSTTNRWLPTISDAAGTENQ---KLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVK  721
               G+  N    + SD+  TE      + DG S+++Q  +G QSAW G  GQVSMADIVK
Sbjct  111  SVLGNNANMRPASYSDSVVTEKTYAFSIGDGPSSSSQR-AGVQSAWAGNTGQVSMADIVK  169

Query  722  MGKPHGK  742
            MG+P  +
Sbjct  170  MGRPQAR  176



>ref|XP_003629905.1| hypothetical protein MTR_8g088190 [Medicago truncatula]
 gb|AET04381.1| plant/F15D2-27 protein [Medicago truncatula]
Length=865

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 122/203 (60%), Gaps = 31/203 (15%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V+SLKEIV N P++EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+KE
Sbjct  18   IPAASRKMVQSLKEIVSNIPDNEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKKKE  77

Query  392  NKDTTEsrpr------gasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST-  550
             KDTTE R R       +    GG+  +DRYAGRGG       + ++  + G   +K   
Sbjct  78   GKDTTEPRSRGSNYNIPSRGGGGGRTGSDRYAGRGGGGGGASSNQFSNNDYGVPQSKPVF  137

Query  551  ------------------RTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSA  676
                                  +  NR  P+ SD+ G       DG+S+++ H  G QSA
Sbjct  138  KKENGTPAYGSSSTSYASSVMDNNVNRQPPSWSDSVGVH-----DGLSSSSHH-GGLQSA  191

Query  677  WVGVPGQVSMADIVKMGKPHGKA  745
            W   PGQVSMADIVKMG+P  KA
Sbjct  192  WSASPGQVSMADIVKMGRPQAKA  214



>ref|XP_010924304.1| PREDICTED: signaling mucin HKR1-like [Elaeis guineensis]
Length=887

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 119/197 (60%), Gaps = 19/197 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V+S+KEIV N PESEIY+ LKECNMDPNEAV+RLLSQD FHEV+SKRDK+KE
Sbjct  20   IPAMSRKLVQSVKEIV-NCPESEIYSMLKECNMDPNEAVHRLLSQDTFHEVRSKRDKKKE  78

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY-------KENGYTNTKST  550
             KDT ESR R  +SS  G        GR  S         A        KENG T+  + 
Sbjct  79   TKDTPESRSRAVNSSGRGARGGIDRTGRNSSTQSSSSDYGATRGKPLNKKENGTTSLPTP  138

Query  551  RTAG-----STTNRWLPTI-SDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQV  700
               G     S  NR  PTI SD+A  E+        +G+ A  Q  SG+Q +W G PG V
Sbjct  139  SILGSGILASNPNRR-PTISSDSASMESTMQGAGSSEGIPAPLQLPSGFQHSWFGKPGHV  197

Query  701  SMADIVKMGKPHGKAPN  751
            SMADIVKMG+P GK  N
Sbjct  198  SMADIVKMGRPQGKPSN  214



>ref|XP_004134562.1| PREDICTED: uncharacterized protein LOC101211388 [Cucumis sativus]
Length=845

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 124/196 (63%), Gaps = 19/196 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  17   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  76

Query  392  NKDTTEsrprgasssrggkgs--adrYAGR------GGSESLHGKSTYAY-KENGYTNTK  544
            NKD  +SR RG+S           DRYAGR      G S++    S   Y KENG ++  
Sbjct  77   NKDPIDSRSRGSSIPSSRTSKGGTDRYAGRSSSIQFGSSDTGLSSSKPVYKKENGASDHA  136

Query  545  STRTAGSTTNR----WLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPGQ  697
             + +A   +        P+ S+   TEN KL      DG  +++Q S G+QSAW+G  GQ
Sbjct  137  GSSSASGQSGNHSFYQFPSHSNNVATEN-KLSGLGAGDGAISSSQTSFGFQSAWLGAQGQ  195

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMGKP  K+
Sbjct  196  VSMADIVKMGKPQSKS  211



>ref|XP_010056862.1| PREDICTED: uncharacterized protein LOC104444809 isoform X3 [Eucalyptus 
grandis]
Length=833

 Score =   145 bits (367),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 135/195 (69%), Gaps = 17/195 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIY ALKEC+MDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  15   ISTIPTGSRKMVQSLKEIV-NCSELEIYTALKECSMDPNEAVNRLLTQDPFHEVKSKREK  73

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRG----GSESLHGKSTYAYKENG-YTNT  541
            +KE+KDTTE RPRG+ S+     +   +RYAGRG     S S  GK     KENG +  T
Sbjct  74   KKESKDTTEVRPRGSISTTTRGGRSGVERYAGRGRAIVPSSSEPGKQQPYKKENGSHVYT  133

Query  542  KSTRTA----GSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQ  697
             ST +A    G++ NR +   SDA+  EN+       D +S++ Q S G Q AW GVPGQ
Sbjct  134  GSTCSAYNMSGNSVNRQI-AHSDASAWENKVSAVGETDLISSSVQPSPGLQRAWAGVPGQ  192

Query  698  VSMADIVKMGKPHGK  742
            VSMADIVKMG+P GK
Sbjct  193  VSMADIVKMGRPQGK  207



>ref|XP_010056860.1| PREDICTED: uncharacterized protein LOC104444809 isoform X1 [Eucalyptus 
grandis]
 gb|KCW73755.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=859

 Score =   145 bits (367),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 135/196 (69%), Gaps = 17/196 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIY ALKEC+MDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  15   ISTIPTGSRKMVQSLKEIV-NCSELEIYTALKECSMDPNEAVNRLLTQDPFHEVKSKREK  73

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRG----GSESLHGKSTYAYKENG-YTNT  541
            +KE+KDTTE RPRG+ S+     +   +RYAGRG     S S  GK     KENG +  T
Sbjct  74   KKESKDTTEVRPRGSISTTTRGGRSGVERYAGRGRAIVPSSSEPGKQQPYKKENGSHVYT  133

Query  542  KSTRTA----GSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQ  697
             ST +A    G++ NR +   SDA+  EN+       D +S++ Q S G Q AW GVPGQ
Sbjct  134  GSTCSAYNMSGNSVNRQI-AHSDASAWENKVSAVGETDLISSSVQPSPGLQRAWAGVPGQ  192

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMG+P GK 
Sbjct  193  VSMADIVKMGRPQGKV  208



>ref|XP_010056861.1| PREDICTED: uncharacterized protein LOC104444809 isoform X2 [Eucalyptus 
grandis]
 gb|KCW73756.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=857

 Score =   145 bits (367),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 135/196 (69%), Gaps = 17/196 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N  E EIY ALKEC+MDPNEAVNRLL+QDPFHEVKSKR+K
Sbjct  15   ISTIPTGSRKMVQSLKEIV-NCSELEIYTALKECSMDPNEAVNRLLTQDPFHEVKSKREK  73

Query  383  RKENKDTTEsrprgasssrgg--kgsadrYAGRG----GSESLHGKSTYAYKENG-YTNT  541
            +KE+KDTTE RPRG+ S+     +   +RYAGRG     S S  GK     KENG +  T
Sbjct  74   KKESKDTTEVRPRGSISTTTRGGRSGVERYAGRGRAIVPSSSEPGKQQPYKKENGSHVYT  133

Query  542  KSTRTA----GSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQ  697
             ST +A    G++ NR +   SDA+  EN+       D +S++ Q S G Q AW GVPGQ
Sbjct  134  GSTCSAYNMSGNSVNRQI-AHSDASAWENKVSAVGETDLISSSVQPSPGLQRAWAGVPGQ  192

Query  698  VSMADIVKMGKPHGKA  745
            VSMADIVKMG+P GK 
Sbjct  193  VSMADIVKMGRPQGKV  208



>ref|XP_008439672.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Cucumis melo]
Length=847

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 126/197 (64%), Gaps = 20/197 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  18   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  77

Query  392  NKDTTEsrp--rgasssrggkgsadrYAGR------GGSESLHGKSTYAY-KENGYTN--  538
            NKD  +SR       SSR  K   +RYAGR      G S++    S   Y KENG ++  
Sbjct  78   NKDPIDSRSRGSSIPSSRTSKSGTERYAGRSSSIQFGSSDTGLSPSKPVYKKENGASDHA  137

Query  539  ---TKSTRTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPG  694
               + S ++   +  ++    S+   TEN KL      DG  +++Q S G+QSAW+G  G
Sbjct  138  GSSSVSGQSGNHSFYQYPSHSSNNVATEN-KLSGLGAGDGAISSSQTSFGFQSAWLGAQG  196

Query  695  QVSMADIVKMGKPHGKA  745
            QVSMADIVKMGKP GK+
Sbjct  197  QVSMADIVKMGKPQGKS  213



>ref|XP_010539204.1| PREDICTED: putative uncharacterized protein DDB_G0277255 [Tarenaya 
hassleriana]
Length=790

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 117/191 (61%), Gaps = 19/191 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+V SLKE+V N  E EIYA L EC+MDP+ AVNRLLSQD FHEVKSKRDK+KE
Sbjct  19   VPAASRKVVRSLKEVV-NCSEEEIYATLVECDMDPDAAVNRLLSQDSFHEVKSKRDKKKE  77

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRG----------GSESLHGKSTYAYKENGYT  535
             KDTTESR RGA S      + + D YAGRG          GS  + GK     +ENG  
Sbjct  78   TKDTTESRSRGAGSFLNRGGRSNGDNYAGRGGGQKFISNESGSVQVQGKPPNK-RENGTN  136

Query  536  N-TKSTRTAGSTTNRWLPTISDAAGTENQKL----VDGVSAATQHSSGYQSAWVGVPGQV  700
            N    + +  S   R   + SD  GTEN  L     D V +++Q SSG Q  W  VPGQ 
Sbjct  137  NHVAGSSSTSSVIGRQPLSNSDPKGTENTSLPVGTCDAVRSSSQASSGLQPVWFAVPGQR  196

Query  701  SMADIVKMGKP  733
            +MADIVKMG+P
Sbjct  197  TMADIVKMGRP  207



>ref|XP_004162612.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224560 
[Cucumis sativus]
Length=844

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 122/195 (63%), Gaps = 18/195 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  17   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  76

Query  392  NKDTTEsrprgasssrggkgs--adrYAGR------GGSESLHGKSTYAYKENGYTNTKS  547
            NKD  +SR RG+S           DRYAGR      G S++    S   YK+   ++   
Sbjct  77   NKDPIDSRSRGSSIPSSRTSKGGTDRYAGRSSSIQFGSSDTGLSSSKPVYKKKXASDHAG  136

Query  548  TRTAGSTTNR----WLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPGQV  700
            + +A   +        P+ S+   TEN KL      DG  +++Q S G+QSAW+G  GQV
Sbjct  137  SSSASGQSGNHSFYQFPSHSNNVATEN-KLSGLGAGDGAISSSQTSFGFQSAWLGAQGQV  195

Query  701  SMADIVKMGKPHGKA  745
            SMADIVKMGKP  K+
Sbjct  196  SMADIVKMGKPQSKS  210



>ref|XP_008800693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103714980 
[Phoenix dactylifera]
Length=885

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 117/194 (60%), Gaps = 19/194 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V+ +KEIV N PESEIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+KE
Sbjct  22   IPAMSRKLVQCVKEIV-NCPESEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKKKE  80

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSES--------LHGKSTYAYKENGYTNTKS  547
             K+  ESR R  +SS  G        GR  S            GK     KENG T+  +
Sbjct  81   IKEPPESRSRAVNSSGRGARGGIDRMGRNSSAQSSSSDYGVTRGKPVNK-KENGITSLPT  139

Query  548  TRTAGSTT-----NRWLPTISDAAGTENQKLVDGVS----AATQHSSGYQSAWVGVPGQV  700
            +   GS+      NR     SD+A  EN   V G+S       Q SSG+Q  W+G PG V
Sbjct  140  SSILGSSIVASNPNRRSTIPSDSASMENTIQVTGLSEEMPTPLQPSSGFQHNWLGKPGHV  199

Query  701  SMADIVKMGKPHGK  742
            SMADIVKMG+P GK
Sbjct  200  SMADIVKMGRPQGK  213



>ref|XP_009395691.1| PREDICTED: mucin-17-like [Musa acuminata subsp. malaccensis]
Length=910

 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 121/201 (60%), Gaps = 22/201 (11%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IPSGSRK+V+SLKEIV N PE EIYA L+EC+MDPNEA++RLLSQD FHEVKSKRDK+
Sbjct  22   APIPSGSRKLVQSLKEIV-NCPEPEIYAMLRECDMDPNEAIHRLLSQDTFHEVKSKRDKK  80

Query  386  KENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY----------KENGYT  535
            KE ++  ESR R  ++S      +     RGG  +    S+  +          KENG +
Sbjct  81   KEIREPPESRSRTLNNSSIRGARSS--TDRGGRTTSSQSSSVDHGTGKGRLMHKKENGTS  138

Query  536  NTKSTRTAGSTT-------NRWLPTISDAAGTENQ--KLVDGVSAATQHSSGYQSAWVGV  688
               ++    S+T          +P+ S + G   Q     DG+  + Q SSGY++ W G+
Sbjct  139  PVLTSSVPESSTVSSNPPRRPTVPSDSASVGITIQATSAADGICISMQSSSGYKNCWSGM  198

Query  689  PGQVSMADIVKMGKPHGKAPN  751
            PG VSMADIV+MG+P GK  N
Sbjct  199  PGHVSMADIVRMGRPQGKPSN  219



>ref|XP_002440264.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
 gb|EES18694.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
Length=856

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 119/181 (66%), Gaps = 11/181 (6%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P GSRK+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPPGSRKLVQSLKEIV-NRPEAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGG-SESLHGKSTYAYKENGYTNTKSTRTAGST  568
             K+  E+R R A+SS      +   A RGG S S+H  ST         +   T +  S+
Sbjct  74   IKEVPETRYRSANSSTNRGLRSG--ADRGGRSNSVHSSSTDNMTSRPPVSGSGTASVNSS  131

Query  569  TNRWLPTISDAAGTENQKLV-DGVSAATQHSSGYQ-SAWVGVPGQVSMADIVKMGKPHGK  742
              + +     A+ + N+ +V DG + + Q SSG+Q   W G PGQ+SMADIVKMG+P GK
Sbjct  132  QRQTM-----ASSSANKHMVTDGPAVSLQSSSGFQHGGWSGTPGQLSMADIVKMGRPQGK  186

Query  743  A  745
            A
Sbjct  187  A  187



>ref|XP_009410964.1| PREDICTED: uncharacterized protein LOC103992822 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=878

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 119/197 (60%), Gaps = 25/197 (13%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  386  KENKDTTEsrprgasssr--------------ggkgsadrYAGRGGSESLHGKSTYAYKE  523
            KE ++  ESR R  ++S                   S+    G G S+SLH       KE
Sbjct  74   KEIREPPESRSRTVNNSSGRGARGGLDRGVRSTSSQSSSIDYGAGKSKSLHK------KE  127

Query  524  NGYTNTKSTRTAGSTTNRWLPTISDAAGTEN----QKLVDGVSAATQHSSGYQSAWVGVP  691
            NG +   ++    S+     PT S +    N      + DG+S   Q  SG+Q++W+G P
Sbjct  128  NGASAVPNSSVVESSVLSSSPTQSKSTPMGNTIQATTVADGISMPMQPPSGFQNSWLGKP  187

Query  692  GQVSMADIVKMGKPHGK  742
            G VSMADIVKMG+  GK
Sbjct  188  GHVSMADIVKMGRSQGK  204



>gb|KGN49366.1| hypothetical protein Csa_6G522110 [Cucumis sativus]
Length=905

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 124/197 (63%), Gaps = 20/197 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP   RK+V+SLKEIV N  + EIYA L+ECNMDP+EAVNRLL+QDPFHEVKSKR+K+KE
Sbjct  76   IPPEWRKMVQSLKEIVNNCTDQEIYATLRECNMDPDEAVNRLLTQDPFHEVKSKREKKKE  135

Query  392  NKDTTEsrprgasssrggkgs--adrYAGR------GGSESLHGKSTYAY-KENGYTNTK  544
            NKD  +SR RG+S           DRYAGR      G S++    S   Y KENG ++  
Sbjct  136  NKDPIDSRSRGSSIPSSRTSKGGTDRYAGRSSSIQFGSSDTGLSSSKPVYKKENGASDHA  195

Query  545  STRTAGSTTNR----WLPT-ISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPG  694
             + +A   +        P+  S+   TEN KL      DG  +++Q S G+QSAW+G  G
Sbjct  196  GSSSASGQSGNHSFYQFPSHSSNNVATEN-KLSGLGAGDGAISSSQTSFGFQSAWLGAQG  254

Query  695  QVSMADIVKMGKPHGKA  745
            QVSMADIVKMGKP  K+
Sbjct  255  QVSMADIVKMGKPQSKS  271



>gb|KDP21205.1| hypothetical protein JCGZ_21676 [Jatropha curcas]
Length=866

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 131/205 (64%), Gaps = 35/205 (17%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IP+GSRK+V+SLKEIV N PE EIYA LKECNMDPNEAVNRLLSQDPFHEVKSKR+K
Sbjct  21   ISGIPAGSRKMVQSLKEIV-NCPEPEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKREK  79

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESL----------------HGKSTYA  514
            +KENK+TT+ R RGA+++           GRGG++                  HGK  Y 
Sbjct  80   KKENKETTDPRSRGANNTTHR-------GGRGGADRYGRGSSTQPSSNEFGVSHGKPAYK  132

Query  515  YKENG---YTNTKS--TRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGY  667
             KENG   Y    S  +  AGS  NR     SD+  TEN+       DG+S + Q  SG+
Sbjct  133  -KENGTHAYGGGSSYVSSVAGSNVNRRPALHSDSVATENKMSNAGSGDGIS-SLQPPSGF  190

Query  668  QSAWVGVPGQVSMADIVKMGKPHGK  742
            QS W+GVPGQVSMADIVKMG+P  K
Sbjct  191  QSPWMGVPGQVSMADIVKMGRPSNK  215



>gb|KHN14369.1| hypothetical protein glysoja_012407 [Glycine soja]
Length=831

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 123/198 (62%), Gaps = 21/198 (11%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+ SRK+V+SLKEIV N+P+ EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSKR+K+
Sbjct  12   ATIPASSRKMVQSLKEIVSNFPDHEIYATLKDCNMDPNEAVSRLLSQDPFHEVKSKREKK  71

Query  386  KENKDTTEsrprgasssrgg----kgsadrYAGRGGSES-------LHGKSTYAYKENGY  532
            K    T        +++       +   DRY GRGG+         L GK  Y  KENG 
Sbjct  72   KIKDPTDSRSRGSGTNNTSSRGGGRAGTDRYGGRGGANQFGSSDYGLQGKPVYK-KENGA  130

Query  533  -TNTKSTRTA----GSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVGV  688
             T   ST +A    G+ TN  LP+ SD+  TE        DG S+++Q  +G QSAW G 
Sbjct  131  PTFGGSTSSAPSVLGNNTNTRLPSYSDSVVTEKTYAFGIGDGPSSSSQR-AGLQSAWTGN  189

Query  689  PGQVSMADIVKMGKPHGK  742
             GQVSMADIVKMG+P  +
Sbjct  190  TGQVSMADIVKMGRPQAR  207



>ref|XP_009396490.1| PREDICTED: uncharacterized protein LOC103981474 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 118/202 (58%), Gaps = 27/202 (13%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
             A IP+GSRK+V+SLKEIV N  E+EIYA L+ECNMDPNEAV+RLLSQD FHEV+SKRDK
Sbjct  20   AAPIPAGSRKLVQSLKEIV-NCSETEIYAMLRECNMDPNEAVHRLLSQDAFHEVRSKRDK  78

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY----------KENGY  532
            +KE ++  ESR R  ++S          A RGG  +    S   Y           ENG 
Sbjct  79   KKEIREPPESRSRTVNNSSSRGARGS--ADRGGRSTSQSSSAVDYGASKGKLIHKNENGM  136

Query  533  TNTKSTRTA--GSTTNRWLP----------TISDAAGTENQKLVDGVSAATQHSSGYQSA  676
            +    T +    S  +  LP          ++ D     N  + DG+S   Q SSG+Q++
Sbjct  137  SAVLFTASVLESSMISSNLPQKPTAPSNSASMGDTIQAAN--IGDGISTLVQSSSGFQNS  194

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W+G PG +SMADIVKMG+P GK
Sbjct  195  WLGKPGHLSMADIVKMGRPQGK  216



>ref|XP_009115248.1| PREDICTED: putative uncharacterized protein DDB_G0271606 [Brassica 
rapa]
Length=859

 Score =   140 bits (353),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 134/195 (69%), Gaps = 19/195 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKE+V N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  25   IPSGSRKIVQSLKEVV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  83

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSESL--------HGKSTYAYKENGYTN-  538
             +D  +SRPRGA++      +G +DRYAGR  S  L         GKST + KE+G    
Sbjct  84   TRDIPDSRPRGANNRYNSGGRGGSDRYAGRSASTHLSSADSGNFQGKST-SKKESGTQGY  142

Query  539  TKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVSM  706
            T S  +A    N  L   SD+  TEN KL     DG+S  +Q +SG+Q+AW G PGQ+SM
Sbjct  143  TSSWSSASGVPNHQLTPHSDSVVTEN-KLPSATGDGIS-PSQPASGHQTAWFGAPGQMSM  200

Query  707  ADIVKMGKPHGKAPN  751
            ADIVKMG+P  K  N
Sbjct  201  ADIVKMGRPQNKTTN  215



>emb|CDY48333.1| BnaA09g26880D [Brassica napus]
Length=823

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 131/195 (67%), Gaps = 19/195 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKE+V N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  24   IPSGSRKIVQSLKEVV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  82

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSESL--------HGKSTYAYKENGYTN-  538
             +D  +SRPRGA++         +DRYAGR  S  L         GKST + KE+G    
Sbjct  83   TRDVPDSRPRGANNRYNSGVRGGSDRYAGRSASTHLSSADSGNFQGKST-SKKESGTQGY  141

Query  539  TKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVSM  706
            T S  +A    N  L   SD+  TEN KL     DG+   +Q +SG+Q+AW G PGQ+SM
Sbjct  142  TSSWSSASGVPNHQLTPHSDSVVTEN-KLPSATGDGI-LPSQPASGHQTAWFGAPGQMSM  199

Query  707  ADIVKMGKPHGKAPN  751
            ADIVKMG+P  K  N
Sbjct  200  ADIVKMGRPQNKTTN  214



>ref|XP_009410965.1| PREDICTED: uncharacterized protein LOC103992822 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 120/202 (59%), Gaps = 30/202 (15%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  386  KENKDTTEsrprgasssr--------------ggkgsadrYAGRGGSESLHGKSTYAYKE  523
            KE ++  ESR R  ++S                   S+    G G S+SLH       KE
Sbjct  74   KEIREPPESRSRTVNNSSGRGARGGLDRGVRSTSSQSSSIDYGAGKSKSLHK------KE  127

Query  524  NGYTNTKSTRTAGSTTNRWLP-----TISDAAGTEN----QKLVDGVSAATQHSSGYQSA  676
            NG +   ++    S+     P     T+S +    N      + DG+S   Q  SG+Q++
Sbjct  128  NGASAVPNSSVVESSVLSSSPTQRPTTLSKSTPMGNTIQATTVADGISMPMQPPSGFQNS  187

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W+G PG VSMADIVKMG+  GK
Sbjct  188  WLGKPGHVSMADIVKMGRSQGK  209



>ref|XP_009410962.1| PREDICTED: uncharacterized protein LOC103992822 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 120/202 (59%), Gaps = 30/202 (15%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  386  KENKDTTEsrprgasssr--------------ggkgsadrYAGRGGSESLHGKSTYAYKE  523
            KE ++  ESR R  ++S                   S+    G G S+SLH       KE
Sbjct  74   KEIREPPESRSRTVNNSSGRGARGGLDRGVRSTSSQSSSIDYGAGKSKSLHK------KE  127

Query  524  NGYTNTKSTRTAGSTTNRWLP-----TISDAAGTEN----QKLVDGVSAATQHSSGYQSA  676
            NG +   ++    S+     P     T+S +    N      + DG+S   Q  SG+Q++
Sbjct  128  NGASAVPNSSVVESSVLSSSPTQRPTTLSKSTPMGNTIQATTVADGISMPMQPPSGFQNS  187

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W+G PG VSMADIVKMG+  GK
Sbjct  188  WLGKPGHVSMADIVKMGRSQGK  209



>ref|XP_009410966.1| PREDICTED: uncharacterized protein LOC103992822 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=830

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 120/202 (59%), Gaps = 30/202 (15%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+GSRK+V+SLKEIV N PE+EIY+ L+ECNMDPNEAV+RLLSQD FHEVKSKRDK+
Sbjct  15   APIPTGSRKLVQSLKEIV-NCPEAEIYSMLRECNMDPNEAVHRLLSQDTFHEVKSKRDKK  73

Query  386  KENKDTTEsrprgasssr--------------ggkgsadrYAGRGGSESLHGKSTYAYKE  523
            KE ++  ESR R  ++S                   S+    G G S+SLH       KE
Sbjct  74   KEIREPPESRSRTVNNSSGRGARGGLDRGVRSTSSQSSSIDYGAGKSKSLHK------KE  127

Query  524  NGYTNTKSTRTAGSTTNRWLP-----TISDAAGTEN----QKLVDGVSAATQHSSGYQSA  676
            NG +   ++    S+     P     T+S +    N      + DG+S   Q  SG+Q++
Sbjct  128  NGASAVPNSSVVESSVLSSSPTQRPTTLSKSTPMGNTIQATTVADGISMPMQPPSGFQNS  187

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W+G PG VSMADIVKMG+  GK
Sbjct  188  WLGKPGHVSMADIVKMGRSQGK  209



>ref|XP_010538220.1| PREDICTED: uncharacterized protein LOC104812645 isoform X1 [Tarenaya 
hassleriana]
Length=818

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 130/200 (65%), Gaps = 24/200 (12%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNR+LSQDPFHEVKSK+DK
Sbjct  22   ISDIPSGSRKIVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRILSQDPFHEVKSKKDK  80

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGG--------SESLHGKSTYAYKEN--  526
            +KENKDTT+SR RG +++        +D YAGRG         S S   KST   +EN  
Sbjct  81   KKENKDTTDSRSRGVNNNYNHGVRGGSDHYAGRGSAAPFSSTESGSFQRKST-NRRENGR  139

Query  527  -GYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVP  691
             GY  + S+   G    R  P+ SD    EN+     L DG    +Q +SG+Q AW G  
Sbjct  140  QGYVGSASSGVVG----RNQPSHSDFVAIENKMPSVSLGDG-KQPSQSASGHQPAWFGAA  194

Query  692  GQVSMADIVKMGKPHGKAPN  751
            GQ+SMADIVKMG+P  K  N
Sbjct  195  GQMSMADIVKMGRPLNKIMN  214



>ref|XP_010538221.1| PREDICTED: uncharacterized protein LOC104812645 isoform X2 [Tarenaya 
hassleriana]
Length=817

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 130/200 (65%), Gaps = 24/200 (12%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNR+LSQDPFHEVKSK+DK
Sbjct  22   ISDIPSGSRKIVQSLKEIV-NCPEAEIYAMLKECNMDPNEAVNRILSQDPFHEVKSKKDK  80

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGG--------SESLHGKSTYAYKEN--  526
            +KENKDTT+SR RG +++        +D YAGRG         S S   KST   +EN  
Sbjct  81   KKENKDTTDSRSRGVNNNYNHGVRGGSDHYAGRGSAAPFSSTESGSFQRKST-NRRENGR  139

Query  527  -GYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVP  691
             GY  + S+   G    R  P+ SD    EN+     L DG    +Q +SG+Q AW G  
Sbjct  140  QGYVGSASSGVVG----RNQPSHSDFVAIENKMPSVSLGDG-KQPSQSASGHQPAWFGAA  194

Query  692  GQVSMADIVKMGKPHGKAPN  751
            GQ+SMADIVKMG+P  K  N
Sbjct  195  GQMSMADIVKMGRPLNKIMN  214



>ref|XP_009396491.1| PREDICTED: uncharacterized protein LOC103981474 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=885

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 119/201 (59%), Gaps = 26/201 (13%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
             A IP+GSRK+V+SLKEIV N  E+EIYA L+ECNMDPNEAV+RLLSQD FHEV+SKRDK
Sbjct  20   AAPIPAGSRKLVQSLKEIV-NCSETEIYAMLRECNMDPNEAVHRLLSQDAFHEVRSKRDK  78

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGG-SESLHGKSTYAY--------KENGYT  535
            +KE ++  ESR R  ++S          A RGG S S    + Y           ENG +
Sbjct  79   KKEIREPPESRSRTVNNSSSRGARGS--ADRGGRSTSQSSSADYGASKGKLIHKNENGMS  136

Query  536  NTKSTRTA--GSTTNRWLP----------TISDAAGTENQKLVDGVSAATQHSSGYQSAW  679
                T +    S  +  LP          ++ D     N  + DG+S   Q SSG+Q++W
Sbjct  137  AVLFTASVLESSMISSNLPQKPTAPSNSASMGDTIQAAN--IGDGISTLVQSSSGFQNSW  194

Query  680  VGVPGQVSMADIVKMGKPHGK  742
            +G PG +SMADIVKMG+P GK
Sbjct  195  LGKPGHLSMADIVKMGRPQGK  215



>ref|XP_006415581.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33934.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=838

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 131/192 (68%), Gaps = 18/192 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  24   IPSGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +D  +SR RGA+++     +G++DRYAGR GS         +  GKST   +    + T
Sbjct  83   TRDIPDSRLRGANNTYNRGGRGTSDRYAGRSGSTHFSSTDSGNFQGKSTNKKESGTQSYT  142

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPGQVSM  706
             S  +A    N      S+   TEN KL      DG+S ++Q +SG+Q+AW G PGQ+SM
Sbjct  143  GSWSSASGVANHHPTPHSNPVVTEN-KLPSVASGDGIS-SSQPASGHQAAWFGAPGQMSM  200

Query  707  ADIVKMGKPHGK  742
            ADIVKMG+P  K
Sbjct  201  ADIVKMGRPQNK  212



>ref|XP_004961191.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Setaria 
italica]
Length=847

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+GSRK+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPAGSRKLVQSLKEIV-NRPEAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTK-STRTAGST  568
             K+  E R R  +SS  G        GR  S S+H  ST    +N  +    S   A S 
Sbjct  74   IKEVPEPRSRSNTSSSRGVRGGADRGGR--SNSMHSSST----DNAASRPPVSGPGAASN  127

Query  569  TNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
             +    TI+ ++      + DG + + Q SSG+Q  W G PG +SMADIVKMG+P  KA
Sbjct  128  NSSQKQTIASSSSANKHMVADGPAVSLQSSSGFQHGWSGTPG-LSMADIVKMGRPQVKA  185



>ref|XP_006415582.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33935.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=836

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 131/192 (68%), Gaps = 18/192 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  24   IPSGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  82

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +D  +SR RGA+++     +G++DRYAGR GS         +  GKST   +    + T
Sbjct  83   TRDIPDSRLRGANNTYNRGGRGTSDRYAGRSGSTHFSSTDSGNFQGKSTNKKESGTQSYT  142

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPGQVSM  706
             S  +A    N      S+   TEN KL      DG+S ++Q +SG+Q+AW G PGQ+SM
Sbjct  143  GSWSSASGVANHHPTPHSNPVVTEN-KLPSVASGDGIS-SSQPASGHQAAWFGAPGQMSM  200

Query  707  ADIVKMGKPHGK  742
            ADIVKMG+P  K
Sbjct  201  ADIVKMGRPQNK  212



>ref|XP_010559257.1| PREDICTED: uncharacterized protein LOC104827729 isoform X1 [Tarenaya 
hassleriana]
Length=796

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 112/190 (59%), Gaps = 17/190 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  392  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST  550
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  551  RTAGSTTNRWL-----PTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVS  703
              AGS++   +     P  SD  GTEN  L     D V +++Q SS +Q AWV +PGQ +
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASSRHQRAWVAIPGQRT  198

Query  704  MADIVKMGKP  733
            MADIVKMG+P
Sbjct  199  MADIVKMGRP  208



>ref|XP_010559258.1| PREDICTED: uncharacterized protein LOC104827729 isoform X2 [Tarenaya 
hassleriana]
Length=795

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 112/190 (59%), Gaps = 17/190 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  392  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST  550
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  551  RTAGSTTNRWL-----PTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVS  703
              AGS++   +     P  SD  GTEN  L     D V +++Q SS +Q AWV +PGQ +
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASSRHQRAWVAIPGQRT  198

Query  704  MADIVKMGKP  733
            MADIVKMG+P
Sbjct  199  MADIVKMGRP  208



>ref|XP_010559260.1| PREDICTED: uncharacterized protein LOC104827729 isoform X4 [Tarenaya 
hassleriana]
Length=793

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 112/190 (59%), Gaps = 17/190 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  392  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST  550
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  551  RTAGSTTNRWL-----PTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVS  703
              AGS++   +     P  SD  GTEN  L     D V +++Q SS +Q AWV +PGQ +
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASSRHQRAWVAIPGQRT  198

Query  704  MADIVKMGKP  733
            MADIVKMG+P
Sbjct  199  MADIVKMGRP  208



>ref|XP_010559259.1| PREDICTED: uncharacterized protein LOC104827729 isoform X3 [Tarenaya 
hassleriana]
Length=794

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 112/190 (59%), Gaps = 17/190 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +R +V+ LKE+V N  + EIYA L EC+MDP+EAV+RLLSQD FHEVKSKRDK+KE
Sbjct  20   VPAMARNVVQGLKEVV-NCSDQEIYAMLVECDMDPDEAVSRLLSQDTFHEVKSKRDKKKE  78

Query  392  NKDTTEsrprgasssrg----gkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST  550
             KDTT+S+ R   S            D YAGRGG    +        A   N   N    
Sbjct  79   TKDTTDSQSRRTGSILNRGGCRSAGGDNYAGRGGGHKFNSNEPGGLLAKPANKRENRTRN  138

Query  551  RTAGSTTNRWL-----PTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVS  703
              AGS++   +     P  SD  GTEN  L     D V +++Q SS +Q AWV +PGQ +
Sbjct  139  HVAGSSSTSGVAWSQHPFSSDPKGTENTSLSTGSGDAVPSSSQASSRHQRAWVAIPGQRT  198

Query  704  MADIVKMGKP  733
            MADIVKMG+P
Sbjct  199  MADIVKMGRP  208



>ref|XP_008650021.1| PREDICTED: cell wall protein AWA1-like [Zea mays]
 gb|AFW79202.1| putative DUF1296 domain containing family protein [Zea mays]
Length=851

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P GSRK+V+ LKEIV N PE+EIYAAL+EC MDP+E V+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPPGSRKLVQGLKEIV-NRPEAEIYAALRECGMDPDETVSRLLSQDTFQEVKSKRDKKKE  73

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGG-SESLHGKSTYAYKENGYTNTKSTRTAGST  568
             K+  E+R R A+SS      +     RGG + S+H  ST    +N  +    + TA  T
Sbjct  74   IKEVPETRYRSANSSTNRGLRSG--VDRGGRNNSMHSSST----DNMTSRPPGSGTASGT  127

Query  569  TNRWLPTISDAAGTENQKLV-DGVSAATQHSSGYQ-SAWVGVPGQVSMADIVKMGKPHGK  742
            +++     S +A   N+ +V DG +A+ Q SSG+Q   W G PGQ+SMADIVKMG+P GK
Sbjct  128  SSQRQTVASPSA---NKHMVADGPAASLQSSSGFQHGGWSGTPGQLSMADIVKMGRPQGK  184



>tpg|DAA58234.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=821

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 109/174 (63%), Gaps = 7/174 (4%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL+ECNMDP+EAV+RLLSQD F EVKSKRD++KE
Sbjct  17   VPASARKLVQGLKEIV-NRPDAEIYAALRECNMDPDEAVSRLLSQDTFQEVKSKRDRKKE  75

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGSTT  571
             K+T E R RGAS+S          AGRG S    G S Y    +            +T 
Sbjct  76   VKETPEPRSRGASNSSRSSRGGVDRAGRGNSVQ-SGSSDYMASRSSILGP----AVAATN  130

Query  572  NRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKP  733
                PT+  +  T    + +G   A Q SSG+Q  W GVPGQ+SMADIVKMG+P
Sbjct  131  AMQKPTVP-SLSTNKDVVPNGSVGAQQSSSGFQHNWFGVPGQMSMADIVKMGRP  183



>ref|XP_008655402.1| PREDICTED: uncharacterized protein LOC101027201 isoform X1 [Zea 
mays]
 gb|AFW81159.1| putative DUF1296 domain containing family protein [Zea mays]
Length=856

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 122/182 (67%), Gaps = 13/182 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+GSRK+V+ LKEIV N PE+EIY+AL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPAGSRKLVQCLKEIV-NRPEAEIYSALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGG-SESLHGKSTYAYKENGYTNTKSTRTAGST  568
             K+  E+R R A+SS      +   A RGG S S+H  ST    +N  +    + +  ++
Sbjct  74   IKEVPETRYRSANSSTNRSLRSG--ADRGGRSNSVHSSST----DNMTSRPPVSGSCTAS  127

Query  569  TN-RWLPTISDAAGTENQKLV-DGVSAATQHSSGYQ-SAWVGVPGQVSMADIVKMGKPHG  739
             N   + TI  A+ + N+ +V DG++ + Q S G+Q   W G PGQ+SM DIVKMG+P G
Sbjct  128  VNSNQMQTI--ASSSANKHMVTDGLAVSLQSSCGFQHGGWSGTPGQLSMVDIVKMGRPQG  185

Query  740  KA  745
            KA
Sbjct  186  KA  187



>emb|CDX94662.1| BnaC07g09960D [Brassica napus]
Length=805

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 127/197 (64%), Gaps = 20/197 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEV--KSKRDKR  385
            IPSG RKIVESLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEV  K ++ K 
Sbjct  20   IPSGCRKIVESLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  78

Query  386  KENKDTTEsrprgasssrgg--kgsadrYAGRGGSE--------SLHGKSTYAYKENGYT  535
             + +D  +SR RGA+++     +G+++RYAGR GS         +  GKST   +     
Sbjct  79   SQTRDIPDSRLRGANNAYNRGGRGASNRYAGRNGSSHFSSTGSGNFQGKSTDKKESGTQG  138

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPGQV  700
             T S  +A    N      SD+  TEN KL      DGVS ++Q +SG+Q+AW G PG++
Sbjct  139  YTSSWPSASGVANHHQTPHSDSVVTEN-KLPSAPSGDGVS-SSQSASGHQTAWFGAPGKM  196

Query  701  SMADIVKMGKPHGKAPN  751
            SMADIVKMG+P  K  N
Sbjct  197  SMADIVKMGRPQSKTTN  213



>emb|CDY15632.1| BnaA07g08030D [Brassica napus]
Length=786

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (70%), Gaps = 22/197 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  19   IPSGCRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  77

Query  392  NKDTTEsrprgasssrgg--kgsadrYAGRGGSE--------SLHGKSTYAYKE--NGYT  535
             +D  +SR RGA+++     +G++ RYAGR GS         +  GKST   +    GYT
Sbjct  78   TRDIPDSRLRGANNAYNRGGRGTSSRYAGRNGSTRFSSSGSGNFQGKSTDKKESGTQGYT  137

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPGQV  700
            ++ S+  +G  TN    T SD+  TEN KL      DG+S ++Q +SG+Q+AW G PG++
Sbjct  138  SSWSS-ASGVATNHQT-TNSDSVVTEN-KLPSAPSGDGIS-SSQSASGHQTAWFGAPGKM  193

Query  701  SMADIVKMGKPHGKAPN  751
            SMADIVKMG+P  K  N
Sbjct  194  SMADIVKMGRPQNKTTN  210



>ref|XP_004961192.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Setaria 
italica]
Length=846

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 114/179 (64%), Gaps = 10/179 (6%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+GSRK+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  15   VPAGSRKLVQSLKEIV-NRPEAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  73

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGSTT  571
             K+  E R R  +SS  G        GR  S S+H  ST     +   +       G+ +
Sbjct  74   IKEVPEPRSRSNTSSSRGVRGGADRGGR--SNSMHSSST-----DNAASRPPVSGPGAAS  126

Query  572  NRWLPTISDAAGTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
            N      + A+ + N+ +V DG + + Q SSG+Q  W G PG +SMADIVKMG+P  KA
Sbjct  127  NNSSQKQTIASSSANKHMVADGPAVSLQSSSGFQHGWSGTPG-LSMADIVKMGRPQVKA  184



>ref|XP_008671999.1| PREDICTED: uncharacterized protein LOC100191159 isoform X1 [Zea 
mays]
 tpg|DAA58235.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=842

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 113/183 (62%), Gaps = 21/183 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL+ECNMDP+EAV+RLLSQD F EVKSKRD++KE
Sbjct  17   VPASARKLVQGLKEIV-NRPDAEIYAALRECNMDPDEAVSRLLSQDTFQEVKSKRDRKKE  75

Query  392  NKDTTEsrprgasssrggkgsadrYAGRG--------GSESLHGKSTYAYKENGYTNTKS  547
             K+T E R RGAS+S          AGRG        G++ +  +S+        TN   
Sbjct  76   VKETPEPRSRGASNSSRSSRGGVDRAGRGNSVQSGSSGTDYMASRSSILGPAVAATNAMQ  135

Query  548  TRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMG  727
              T        +P++S    T    + +G   A Q SSG+Q  W GVPGQ+SMADIVKMG
Sbjct  136  KPT--------VPSLS----TNKDVVPNGSVGAQQSSSGFQHNWFGVPGQMSMADIVKMG  183

Query  728  KPH  736
            +P 
Sbjct  184  RPQ  186



>ref|XP_003567874.1| PREDICTED: uncharacterized protein LOC100840916 [Brachypodium 
distachyon]
Length=859

 Score =   134 bits (337),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 109/177 (62%), Gaps = 12/177 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P  SRK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  19   VPQASRKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  77

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGS--  565
             K+T E R R A+++           G  G+    G++++A+  +    T  +  +G   
Sbjct  78   VKETPEPRSRAANNATNR--------GVRGAPDRGGRNSFAHTSSTDNATARSSVSGPGM  129

Query  566  -TTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKP  733
             +TN        ++      + DG S   Q SSG+Q  W G PGQ+SMADIVKMG+P
Sbjct  130  LSTNSIQKQTVPSSSVNKTMVADGPSTQPQPSSGFQHGWSGTPGQLSMADIVKMGRP  186



>ref|XP_004969440.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Setaria italica]
Length=837

 Score =   134 bits (337),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 119/185 (64%), Gaps = 22/185 (12%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL+QD F EVKSKRDK+KE
Sbjct  18   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLTQDTFQEVKSKRDKKKE  76

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST------R  553
             K+T E R RGAS+SR         A RGG++     S      + Y  ++S+       
Sbjct  77   VKETPEPRSRGASNSR---------ATRGGADRARRSSLVQSGSSDYMASRSSILGPAVP  127

Query  554  TAGSTTNRWLPTISDAAGTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGK  730
             + ST  + +P++       N+ +V +G   A Q SSG+Q AW GVPG +SMADIVKMG+
Sbjct  128  ASNSTQKQTVPSL-----PANKDVVPNGSVGAQQSSSGFQHAWCGVPGHMSMADIVKMGR  182

Query  731  PHGKA  745
            P  K+
Sbjct  183  PQVKS  187



>ref|NP_174230.2| Kinase-related protein [Arabidopsis thaliana]
 gb|AAL36210.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20314.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31077.1| Kinase-related protein [Arabidopsis thaliana]
Length=831

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 126/191 (66%), Gaps = 16/191 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQDPFHEVKSK++K+KE
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQDPFHEVKSKKEKKKE  75

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +D ++SRPRGA+++        + RYAGR GS         +  GKST   +      T
Sbjct  76   TRDISDSRPRGANNTYNRGARGGSARYAGRSGSTHFSSTDSGNFQGKSTNKKESGTQGYT  135

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVSMA  709
             S  +A    N +    S+   TEN+     L DG+S ++Q +SG+Q+AW G PGQ SMA
Sbjct  136  SSWSSASGVANTYQTPHSEPVATENKLPPVTLGDGIS-SSQSASGHQTAWFGAPGQRSMA  194

Query  710  DIVKMGKPHGK  742
            ++VKMG+P  K
Sbjct  195  EVVKMGRPQNK  205



>ref|XP_006306765.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39663.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=832

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 123/184 (67%), Gaps = 10/184 (5%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  26   IPSGSRKIVQSLKEIV-NAPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  84

Query  392  NKDTTEsrprgasssrg---gkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAG  562
             +D  + RPRG +S+      +G +DRYAGR  S +  GKST   +      T    +A 
Sbjct  85   TRDVPDYRPRGTNSTYNRGGARGGSDRYAGR-DSGNFQGKSTNKKESGTQGYTAPWSSAS  143

Query  563  STTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGK  730
               N      SD+   EN+       DG+S ++Q +SG+Q+AW G PGQ SMADIVKMG 
Sbjct  144  GVANHHQTQNSDSVAAENKSSSVTSGDGIS-SSQLASGHQTAWFGAPGQRSMADIVKMGI  202

Query  731  PHGK  742
            P  K
Sbjct  203  PQNK  206



>ref|XP_006306766.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39664.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=840

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 124/192 (65%), Gaps = 17/192 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAVNRLLSQDPFHEVKSK++K+KE
Sbjct  26   IPSGSRKIVQSLKEIV-NAPEAEIYAMLKECNMDPNEAVNRLLSQDPFHEVKSKKEKKKE  84

Query  392  NKDTTEsrprgasssrg---gkgsadrYAGRG--------GSESLHGKSTYAYKENGYTN  538
             +D  + RPRG +S+      +G +DRYAGRG         S +  GKST   +      
Sbjct  85   TRDVPDYRPRGTNSTYNRGGARGGSDRYAGRGRSTNYISTDSGNFQGKSTNKKESGTQGY  144

Query  539  TKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQVSM  706
            T    +A    N      SD+   EN+       DG+S ++Q +SG+Q+AW G PGQ SM
Sbjct  145  TAPWSSASGVANHHQTQNSDSVAAENKSSSVTSGDGIS-SSQLASGHQTAWFGAPGQRSM  203

Query  707  ADIVKMGKPHGK  742
            ADIVKMG P  K
Sbjct  204  ADIVKMGIPQNK  215



>ref|XP_010478296.1| PREDICTED: probable serine/threonine-protein kinase yakA [Camelina 
sativa]
Length=845

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 128/190 (67%), Gaps = 14/190 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLSQDPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSQDPFHEVKSKKEKKKE  78

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +DT +SRPRGA+++        +DRY+GRGGS         +  GKST   +      T
Sbjct  79   TRDTPDSRPRGANNTYNRGARGGSDRYSGRGGSTHFSSTDSGNFQGKSTNKKESGPQGYT  138

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQ--KLVDG-VSAATQHSSGYQSAWVGVPGQVSMAD  712
             S  +A   T+      SD+  TEN+   +  G V +++Q +SG+Q+AW G PGQ SMAD
Sbjct  139  ASWSSASGVTDYHQTQNSDSVATENKLSSVTSGDVISSSQPASGHQTAWFGAPGQRSMAD  198

Query  713  IVKMGKPHGK  742
            IVKMG P  K
Sbjct  199  IVKMGIPQNK  208



>ref|XP_009102862.1| PREDICTED: uncharacterized protein LOC103828968 isoform X2 [Brassica 
rapa]
Length=782

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 123/199 (62%), Gaps = 29/199 (15%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  18   IPSGCRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  76

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST-------  550
             +D  +SR RG  ++           GRG S+   G S ++   +G    KST       
Sbjct  77   TRDIPDSRLRGTYNTYNR-------GGRGASDRYTGSSHFSSTGSGNFQGKSTDKKKSGT  129

Query  551  -------RTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPG  694
                    +A    N      SD+  TEN KL      DG+S ++Q +SG+Q+AW G PG
Sbjct  130  QGHAGSWSSASGVANHHQTPHSDSVVTEN-KLPSAPSGDGIS-SSQSASGHQTAWFGAPG  187

Query  695  QVSMADIVKMGKPHGKAPN  751
            ++SMADIVKMG+P  K  N
Sbjct  188  KMSMADIVKMGRPQNKTKN  206



>ref|XP_009102861.1| PREDICTED: uncharacterized protein LOC103828968 isoform X1 [Brassica 
rapa]
Length=783

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 123/199 (62%), Gaps = 29/199 (15%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  18   IPSGCRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  76

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST-------  550
             +D  +SR RG  ++           GRG S+   G S ++   +G    KST       
Sbjct  77   TRDIPDSRLRGTYNTYNR-------GGRGASDRYTGSSHFSSTGSGNFQGKSTDKKKSGT  129

Query  551  -------RTAGSTTNRWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGVPG  694
                    +A    N      SD+  TEN KL      DG+S ++Q +SG+Q+AW G PG
Sbjct  130  QGHAGSWSSASGVANHHQTPHSDSVVTEN-KLPSAPSGDGIS-SSQSASGHQTAWFGAPG  187

Query  695  QVSMADIVKMGKPHGKAPN  751
            ++SMADIVKMG+P  K  N
Sbjct  188  KMSMADIVKMGRPQNKTKN  206



>ref|XP_004969439.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Setaria italica]
Length=839

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 120/187 (64%), Gaps = 24/187 (13%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL+QD F EVKSKRDK+KE
Sbjct  18   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLTQDTFQEVKSKRDKKKE  76

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENG--YTNTKST-----  550
             K+T E R RGAS+SR         A RGG++     S      +G  Y  ++S+     
Sbjct  77   VKETPEPRSRGASNSR---------ATRGGADRARRSSLVQSGSSGTDYMASRSSILGPA  127

Query  551  -RTAGSTTNRWLPTISDAAGTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVKM  724
               + ST  + +P++       N+ +V +G   A Q SSG+Q AW GVPG +SMADIVKM
Sbjct  128  VPASNSTQKQTVPSL-----PANKDVVPNGSVGAQQSSSGFQHAWCGVPGHMSMADIVKM  182

Query  725  GKPHGKA  745
            G+P  K+
Sbjct  183  GRPQVKS  189



>gb|EEC79711.1| hypothetical protein OsI_21014 [Oryza sativa Indica Group]
Length=852

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 108/175 (62%), Gaps = 11/175 (6%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            SRK+V+SLKEIV N PE+EIYAAL++C MDP+EAV+RLLSQD F EVKSKRDK+KE K+ 
Sbjct  26   SRKLVQSLKEIV-NRPEAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKSKRDKKKEVKEI  84

Query  404  TEsrprgasssrggkgsadrYAGRGG-SESLHGKSTYAYKENGYTNTKSTRTAGSTTNRW  580
             E R R AS++          A RGG + S H  S         +    T T  ST  + 
Sbjct  85   PEPRSRAASNAASRGVRGG--ADRGGRNSSFHSSSIDNVASRSISGPGMTST-NSTQKQT  141

Query  581  LPTISDAAGTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGK  742
            +P+        N+ +V DG S   Q SSG+Q  W G PGQ+SMADIVKMG+P  K
Sbjct  142  IPS-----SLVNKSVVADGPSVPAQSSSGFQHGWSGTPGQLSMADIVKMGRPQVK  191



>ref|NP_001056347.1| Os05g0566900 [Oryza sativa Japonica Group]
 gb|AAU10662.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18261.1| Os05g0566900 [Oryza sativa Japonica Group]
 dbj|BAG89781.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00089.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64717.1| hypothetical protein OsJ_19573 [Oryza sativa Japonica Group]
Length=852

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 108/175 (62%), Gaps = 11/175 (6%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            SRK+V+SLKEIV N PE+EIYAAL++C MDP+EAV+RLLSQD F EVKSKRDK+KE K+ 
Sbjct  26   SRKLVQSLKEIV-NRPEAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKSKRDKKKEVKEI  84

Query  404  TEsrprgasssrggkgsadrYAGRGG-SESLHGKSTYAYKENGYTNTKSTRTAGSTTNRW  580
             E R R AS++          A RGG + S H  S         +    T T  ST  + 
Sbjct  85   PEPRSRAASNAASRGVRGG--ADRGGRNSSFHSSSIDNVASRSISGPGMTST-NSTQKQT  141

Query  581  LPTISDAAGTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGK  742
            +P+        N+ +V DG S   Q SSG+Q  W G PGQ+SMADIVKMG+P  K
Sbjct  142  IPS-----SLVNKSVVADGPSVPAQSSSGFQHGWSGTPGQLSMADIVKMGRPQVK  191



>ref|XP_010460715.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X2 [Camelina sativa]
Length=842

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 127/190 (67%), Gaps = 14/190 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLSQDPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSQDPFHEVKSKKEKKKE  78

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +DT +SRPRGA+++        +DRY+GRGGS         +  GKST   +      T
Sbjct  79   TRDTPDSRPRGANNTYNRGARGGSDRYSGRGGSTHFSSTDSGNFQGKSTNKKESGPQGYT  138

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQ--KLVDG-VSAATQHSSGYQSAWVGVPGQVSMAD  712
             S  +A    +      SD+  TEN+   +  G V +++Q +SG+Q+AW G PGQ SMAD
Sbjct  139  ASWSSASGVADHHQTQNSDSVATENKLSSVTSGDVISSSQPASGHQTAWFGAPGQRSMAD  198

Query  713  IVKMGKPHGK  742
            IVKMG P  K
Sbjct  199  IVKMGIPQNK  208



>ref|XP_010460714.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X1 [Camelina sativa]
Length=843

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 127/190 (67%), Gaps = 14/190 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLSQDPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSQDPFHEVKSKKEKKKE  78

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +DT +SRPRGA+++        +DRY+GRGGS         +  GKST   +      T
Sbjct  79   TRDTPDSRPRGANNTYNRGARGGSDRYSGRGGSTHFSSTDSGNFQGKSTNKKESGPQGYT  138

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQ--KLVDG-VSAATQHSSGYQSAWVGVPGQVSMAD  712
             S  +A    +      SD+  TEN+   +  G V +++Q +SG+Q+AW G PGQ SMAD
Sbjct  139  ASWSSASGVADHHQTQNSDSVATENKLSSVTSGDVISSSQPASGHQTAWFGAPGQRSMAD  198

Query  713  IVKMGKPHGK  742
            IVKMG P  K
Sbjct  199  IVKMGIPQNK  208



>gb|AFW83477.1| putative DUF1296 domain containing family protein [Zea mays]
Length=355

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 108/177 (61%), Gaps = 14/177 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL QD F EVKSKRDK+KE
Sbjct  20   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLCQDTFQEVKSKRDKKKE  78

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSE--SLHGKSTYAYKENGYTNTKSTRTAGS  565
             K+T + R RGAS+S          + RGG +                Y  ++S+    +
Sbjct  79   VKETLDPRSRGASNSCR--------SSRGGMDRAGRSSSVQSGSSGTDYVTSRSSILGPA  130

Query  566  TTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPH  736
               +  PT+  +  T    + +G   A Q SSG+Q  W GVPGQ+SMADIVKMG+P 
Sbjct  131  VPVK--PTVP-SLSTNKDVVFNGSVGAPQSSSGFQHNWFGVPGQMSMADIVKMGRPQ  184



>ref|XP_006827353.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
 gb|ERM94590.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
Length=904

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 120/201 (60%), Gaps = 20/201 (10%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            +  IPS +RKIV+SLKEIV N P++EIYA L+ECNMDPN+ V RLLSQD FHEVKSKR+K
Sbjct  15   IPAIPSSARKIVQSLKEIV-NCPDNEIYAMLRECNMDPNDTVQRLLSQDTFHEVKSKREK  73

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRG----------GSESLHGKSTYAY-KENG  529
            +KE KDT E R R   S+    G     A RG           SES   +   +Y KENG
Sbjct  74   KKEIKDTAEPRSRIVGSATNRGGRVGA-ADRGVGRAASTPYNSSESGGTRPKVSYKKENG  132

Query  530  YTNTKSTRT---AGSTTNRWLPTISDAAGTEN----QKLVDGVSAATQHSSGYQSAWVGV  688
             ++  S      AGS+ +R   + SD+   E+        +  SA+ Q SS +Q AW G 
Sbjct  133  TSSLSSFSVSGMAGSSISRRSTSPSDSLPMESWVQTASTSEASSASFQPSSRFQPAWTGA  192

Query  689  PGQVSMADIVKMGKPHGKAPN  751
            PGQVSMADIVK G+P  KA N
Sbjct  193  PGQVSMADIVKSGRPSTKATN  213



>dbj|BAJ85689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 12/175 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P  S+K+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  19   VPQASKKLVQSLKEIV-NRPEAEIYAALRECAMDPDEAVSRLLSQDTFQEVKSKRDKKKE  77

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGS--  565
             K+T E R R A+++            RGG +   G++  AY  +    T  +  +GS  
Sbjct  78   VKETPEPRSRAANNATSRGV-------RGGPDR-GGRNNSAYNSSIDNMTSRSSVSGSGM  129

Query  566  -TTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMG  727
             +TN        ++      + D  S   Q SSG+Q  W G PGQ+SMADIVKMG
Sbjct  130  PSTNSTQKQTVPSSSVNKNLVADAPSVPPQTSSGFQHGWSGTPGQLSMADIVKMG  184



>dbj|BAJ92311.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 12/175 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P  S+K+V+SLKEIV N PE+EIYAAL+EC MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  19   VPQASKKLVQSLKEIV-NRPEAEIYAALRECAMDPDEAVSRLLSQDTFQEVKSKRDKKKE  77

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGS--  565
             K+T E R R A+++            RGG +   G++  AY  +    T  +  +GS  
Sbjct  78   VKETPEPRSRAANNATSRGV-------RGGPDR-GGRNNSAYNSSIDNMTSRSSVSGSGM  129

Query  566  -TTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMG  727
             +TN        ++      + D  S   Q SSG+Q  W G PGQ+SMADIVKMG
Sbjct  130  PSTNSTQKQTVPSSSVNKNLVADAPSVPPQTSSGFQHGWSGTPGQLSMADIVKMG  184



>emb|CDY43334.1| BnaC03g59060D [Brassica napus]
Length=822

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 122/196 (62%), Gaps = 17/196 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  22   IPSGSRKIVQSLKEIV-NAPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  80

Query  392  NKDTTEs----rprgasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYT  535
             +D  +          +    G G +DRYAGR GS  L         GKST   +     
Sbjct  81   TRDVPDYRLRGANNTYNRGGRGGGGSDRYAGRSGSAHLNSTDSGNFQGKSTNKRESGTQG  140

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVS  703
             T S  +A    N      SD+  TEN+       DG+S+++Q +SG+Q+ W G PGQ+S
Sbjct  141  YTSSWSSASGVANHHQTPHSDSVVTENRLPPAASSDGISSSSQPASGHQTPWFGAPGQMS  200

Query  704  MADIVKMGKPHGKAPN  751
            MADIVK G+P  K  N
Sbjct  201  MADIVKRGRPQNKTTN  216



>gb|AAL58943.1|AF462857_1 At1g29350/F15D2_27 [Arabidopsis thaliana]
Length=832

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 16/191 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQDPFHEVKSK++K+KE
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQDPFHEVKSKKEKKKE  75

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +D ++SRPRGA+++        + RYAGR GS         +  GKST   +      T
Sbjct  76   TRDISDSRPRGANNTYNRGARGGSARYAGRSGSTHFSSTDSGNFQGKSTNKKESGTQGYT  135

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVSMA  709
             S  +A    N +    S+    EN+     L DG+S +++ +SG+Q+AW G PGQ SMA
Sbjct  136  SSWSSASGVANTYQTPHSEPIAMENKLPPVTLGDGIS-SSKSASGHQTAWFGAPGQRSMA  194

Query  710  DIVKMGKPHGK  742
            ++VKMG+P  K
Sbjct  195  EVVKMGRPQNK  205



>ref|NP_174229.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE31075.1| uncharacterized protein AT1G29350 [Arabidopsis thaliana]
Length=831

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 16/191 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQDPFHEVKSK++K+KE
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQDPFHEVKSKKEKKKE  75

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSE--------SLHGKSTYAYKENGYTNT  541
             +D ++SRPRGA+++        + RYAGR GS         +  GKST   +      T
Sbjct  76   TRDISDSRPRGANNTYNRGARGGSARYAGRSGSTHFSSTDSGNFQGKSTNKKESGTQGYT  135

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQ----KLVDGVSAATQHSSGYQSAWVGVPGQVSMA  709
             S  +A    N +    S+    EN+     L DG+S +++ +SG+Q+AW G PGQ SMA
Sbjct  136  SSWSSASGVANTYQTPHSEPIAMENKLPPVTLGDGIS-SSKSASGHQTAWFGAPGQRSMA  194

Query  710  DIVKMGKPHGK  742
            ++VKMG+P  K
Sbjct  195  EVVKMGRPQNK  205



>gb|AFW83478.1| putative DUF1296 domain containing family protein, partial [Zea 
mays]
Length=600

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 14/180 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL QD F EVKSKRDK+KE
Sbjct  20   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLCQDTFQEVKSKRDKKKE  78

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSE--SLHGKSTYAYKENGYTNTKSTRTAGS  565
             K+T + R RGAS+S          + RGG +                Y  ++S+    +
Sbjct  79   VKETLDPRSRGASNSCR--------SSRGGMDRAGRSSSVQSGSSGTDYVTSRSSILGPA  130

Query  566  TTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
               +  PT+  +  T    + +G   A Q SSG+Q  W GVPGQ+SMADIVKMG+P  ++
Sbjct  131  VPVK--PTVP-SLSTNKDVVFNGSVGAPQSSSGFQHNWFGVPGQMSMADIVKMGRPQVRS  187



>ref|XP_009394232.1| PREDICTED: uncharacterized protein LOC103979756 [Musa acuminata 
subsp. malaccensis]
Length=884

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 118/197 (60%), Gaps = 20/197 (10%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP+GSRK+V+SL+EI+ + PE EIYA L+ECNMDPNEAV+RLL+QD FHEVKSKR+K+
Sbjct  12   APIPTGSRKLVQSLREIL-HCPEPEIYAMLRECNMDPNEAVHRLLAQDTFHEVKSKREKK  70

Query  386  KENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY--------KENGYTNT  541
            KE ++  ESR R  +SS G         G   + S    + Y          KENG TN 
Sbjct  71   KEIREPPESRSRTVNSSSGHGTRVGTDLGARSTSSQSSSTDYGTFKGKPNHKKENG-TNA  129

Query  542  -------KSTRTAGSTTNR-WLPTISDAAGTENQ--KLVDGVSAATQHSSGYQSAWVGVP  691
                   +S   + S T R  +P+ S   G   Q   +  G+S   Q SS +Q++W+G P
Sbjct  130  LPNSLLLESATVSSSPTQRPTIPSKSVPQGNVIQLTSITGGLSMPMQSSSVFQNSWLGRP  189

Query  692  GQVSMADIVKMGKPHGK  742
            G VSMADIVKMG+P  +
Sbjct  190  GHVSMADIVKMGRPQSQ  206



>ref|XP_010499452.1| PREDICTED: RNA polymerase II degradation factor 1-like [Camelina 
sativa]
Length=842

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 124/190 (65%), Gaps = 14/190 (7%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSR+IV+SLKEIV N PE+EIYA LKECNM+PNEAV RLLS DPFHEVKSK++K+KE
Sbjct  20   IPSGSREIVKSLKEIV-NAPEAEIYAMLKECNMEPNEAVARLLSSDPFHEVKSKKEKKKE  78

Query  392  NKDTTEsrprgasssrggkgs--adrYAGRGGSESL--------HGKSTYAYKENGYTNT  541
             +DT +SRPRGA++         +DRY+GRGGS            GKST   +      T
Sbjct  79   TRDTPDSRPRGANNMYNRGARGGSDRYSGRGGSTHFSSTDSGNYQGKSTNKKESGPQGYT  138

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQ--KLVDG-VSAATQHSSGYQSAWVGVPGQVSMAD  712
             S  +A    +      SD+  TEN+   +  G V +++Q +SG+Q+AW G PGQ SMAD
Sbjct  139  ASWSSASGVADHHQTQNSDSVATENKLSSVTSGDVISSSQPASGHQTAWFGAPGQRSMAD  198

Query  713  IVKMGKPHGK  742
            IVKMG P  K
Sbjct  199  IVKMGIPQNK  208



>emb|CDJ26391.1| unnamed protein product [Triticum aestivum]
Length=845

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 117/185 (63%), Gaps = 17/185 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV    +SEIYAAL++C MDP+EAV+RLLSQD F EVK+KRDK+KE
Sbjct  16   VPASARKLVQGLKEIVSRS-DSEIYAALRDCGMDPDEAVSRLLSQDTFQEVKNKRDKKKE  74

Query  392  -NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRT----  556
             NK T E R RGA++S          A R G++  +  S+      G  N  S  +    
Sbjct  75   VNKGTPEPRSRGANNSNSR-------AARVGTDRTNRSSSVQSVSGGVDNVASRSSILGP  127

Query  557  -AGSTTNRWLPTISDAAGTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGK  730
               ST +   PT+  +    N+ +V DG+  A+Q SSG+Q  W GVPGQ+SMADIVKMG+
Sbjct  128  GVPSTNSTQKPTVPSSFA--NKDVVPDGLCGASQSSSGFQQNWCGVPGQMSMADIVKMGR  185

Query  731  PHGKA  745
            P G++
Sbjct  186  PQGRS  190



>emb|CDX90188.1| BnaA08g17960D [Brassica napus]
Length=822

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 131/197 (66%), Gaps = 20/197 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+GSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  16   IPTGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  74

Query  392  NKDTTEsrpr--gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKE--NGYT  535
             +D  + R R    + +RGG+G +DRYAGR GS  L         GKST   +    GYT
Sbjct  75   TRDVPDYRLRGGHNTYNRGGRGGSDRYAGRSGSAHLNSTDSGNFQGKSTNKRESGTQGYT  134

Query  536  NTKSTRTAGSTTNRWLPTISDAAGTENQKLVDGV-----SAATQHSSGYQSAWVGVPGQV  700
            ++ S+ + G   +   P  SD+  TEN KL         S+++Q +SG+Q+ W G PGQ+
Sbjct  135  SSWSSSSGGVANHHQTPH-SDSVVTEN-KLPPAASSDGISSSSQPASGHQTPWFGAPGQM  192

Query  701  SMADIVKMGKPHGKAPN  751
            SMADIVK G P  K  N
Sbjct  193  SMADIVKRGIPQNKTTN  209



>ref|XP_010666705.1| PREDICTED: uncharacterized protein LOC104883839 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=847

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (61%), Gaps = 19/192 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ S+++++SLKE+V N  E EIYA LKEC+M+ + AV RLL  DPFHEVKSK++KRK+
Sbjct  25   VPTSSKQLIQSLKEVV-NCSEDEIYAMLKECDMNVDVAVERLLLLDPFHEVKSKQEKRKK  83

Query  392  NKDT----------TEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENG---Y  532
            NKD           T +R   A + R    S+  + G   S +  GKS Y  KENG   Y
Sbjct  84   NKDVGDSRVRGTSGTSTRGGRAGTDRYSSRSSMGHYGTSDSGAARGKSAYK-KENGPSAY  142

Query  533  TNTKSTRTAGSTTNRWLPTISDA--AGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSM  706
            T++ +   A    NR  P +SDA  A T +    + +  A+  SSG+Q AW G+PGQVSM
Sbjct  143  TSS-AMGMASYNVNRRQPPLSDATTAKTSSYNAAEALVGASP-SSGFQPAWSGIPGQVSM  200

Query  707  ADIVKMGKPHGK  742
            ADIVKMG+P  K
Sbjct  201  ADIVKMGRPQRK  212



>ref|XP_010666704.1| PREDICTED: uncharacterized protein LOC104883839 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=858

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (61%), Gaps = 19/192 (10%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ S+++++SLKE+V N  E EIYA LKEC+M+ + AV RLL  DPFHEVKSK++KRK+
Sbjct  25   VPTSSKQLIQSLKEVV-NCSEDEIYAMLKECDMNVDVAVERLLLLDPFHEVKSKQEKRKK  83

Query  392  NKDT----------TEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENG---Y  532
            NKD           T +R   A + R    S+  + G   S +  GKS Y  KENG   Y
Sbjct  84   NKDVGDSRVRGTSGTSTRGGRAGTDRYSSRSSMGHYGTSDSGAARGKSAYK-KENGPSAY  142

Query  533  TNTKSTRTAGSTTNRWLPTISDA--AGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSM  706
            T++ +   A    NR  P +SDA  A T +    + +  A+  SSG+Q AW G+PGQVSM
Sbjct  143  TSS-AMGMASYNVNRRQPPLSDATTAKTSSYNAAEALVGASP-SSGFQPAWSGIPGQVSM  200

Query  707  ADIVKMGKPHGK  742
            ADIVKMG+P  K
Sbjct  201  ADIVKMGRPQRK  212



>ref|XP_002893558.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69817.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
Length=841

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 125/198 (63%), Gaps = 30/198 (15%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSGSR IV+SLKEIV N PE+EIYA LKECNMDPNE VNRLLSQDPFHEVKSK++K+KE
Sbjct  25   IPSGSRIIVQSLKEIV-NSPEAEIYAMLKECNMDPNETVNRLLSQDPFHEVKSKKEKKKE  83

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKSTRTAG  562
             +D ++SRPRGA+++            RGGS+   G+S    ++  ++G    KS     
Sbjct  84   TRDISDSRPRGANNTYNR-------GARGGSDRYAGRSGSTHFSSTDSGNFQGKSANKKE  136

Query  563  STTNRWLPTISDAAGTEN-------------QKLV-----DGVSAATQHSSGYQSAWVGV  688
            S T  +L + S A+G  N              KL      DG+S ++Q +SG+Q+AW G 
Sbjct  137  SGTQGYLGSWSSASGVANTYQTAHSEPVATENKLPSVPSGDGIS-SSQSASGHQTAWFGA  195

Query  689  PGQVSMADIVKMGKPHGK  742
            PGQ SMA+IVKMG P  +
Sbjct  196  PGQRSMAEIVKMGIPQNQ  213



>ref|XP_008656717.1| PREDICTED: uncharacterized protein LOC103636139 [Zea mays]
 gb|AFW83479.1| putative DUF1296 domain containing family protein [Zea mays]
Length=840

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 108/176 (61%), Gaps = 14/176 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL+EC MDP+EAV+RLL QD F EVKSKRDK+KE
Sbjct  20   VPASARKLVQGLKEIV-NRPDAEIYAALRECGMDPDEAVSRLLCQDTFQEVKSKRDKKKE  78

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSE--SLHGKSTYAYKENGYTNTKSTRTAGS  565
             K+T + R RGAS+S          + RGG +                Y  ++S+    +
Sbjct  79   VKETLDPRSRGASNSCR--------SSRGGMDRAGRSSSVQSGSSGTDYVTSRSSILGPA  130

Query  566  TTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKP  733
               +  PT+  +  T    + +G   A Q SSG+Q  W GVPGQ+SMADIVKMG+P
Sbjct  131  VPVK--PTVP-SLSTNKDVVFNGSVGAPQSSSGFQHNWFGVPGQMSMADIVKMGRP  183



>emb|CDX84653.1| BnaA03g15770D [Brassica napus]
Length=813

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 122/207 (59%), Gaps = 32/207 (15%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            +  IPSGSRK+V+SLKEIV   PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K
Sbjct  10   ITDIPSGSRKMVQSLKEIVNCCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEK  69

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAG  562
            +KEN+D  +SRPRG S+S            RGGS+   G    +     + +++S    G
Sbjct  70   KKENRDIPDSRPRGYSNSYNR-------GSRGGSDRYAGGPGRS-GATSFNSSESRSFQG  121

Query  563  STTNR-------WLPTISDAAGTENQKLV---DGVSAAT--------------QHSSGYQ  670
             TTN+       +  + S  +G  N   +   D V+  +              Q  SG Q
Sbjct  122  KTTNKRESEKETYAGSFSSTSGVSNHDQIPHSDSVAVDSKTETVSSGGGISSSQPVSGQQ  181

Query  671  SAWVGVPGQVSMADIVKMGKPHGKAPN  751
            +AW G  GQ+SMADIVKMG+PH K  N
Sbjct  182  TAWFGAAGQMSMADIVKMGRPHNKTAN  208



>ref|NP_001043788.1| Os01g0663800 [Oryza sativa Japonica Group]
 dbj|BAD72338.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72381.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAF05702.1| Os01g0663800 [Oryza sativa Japonica Group]
 gb|EEE55130.1| hypothetical protein OsJ_02914 [Oryza sativa Japonica Group]
Length=851

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 113/185 (61%), Gaps = 23/185 (12%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P  +RK+V+ LKEIV N P++EIYAAL++C MDP+EAV+RLLSQD F EVKSKRDK+KE
Sbjct  23   VPGSARKLVQGLKEIV-NRPDAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKSKRDKKKE  81

Query  392  -NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKS-------  547
             NK+  E + RGA +S          A R G++     S+     +G  N  S       
Sbjct  82   VNKEALEPKSRGAVNSNSR-------ATRAGADRSGRSSSVQSGSSGADNMSSRSSILGP  134

Query  548  -TRTAGSTTNRWLPTISDAAGTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVK  721
                  ST  + +P+      T N+ ++ DG   A Q SSG+Q++W GVPGQ+SMADIVK
Sbjct  135  GVLATNSTQKQTVPS-----STVNKDVLHDGSFGAMQPSSGFQNSWCGVPGQMSMADIVK  189

Query  722  MGKPH  736
            MG+P 
Sbjct  190  MGRPQ  194



>ref|XP_006410568.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52021.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=885

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 123/202 (61%), Gaps = 30/202 (15%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEK  79

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGK-----STYAYKENGYTNTKS  547
            +KE +D  +SRPRG S++            RGGS+   G      + ++  E+G    K+
Sbjct  80   KKEIRDIPDSRPRGYSNTYNR-------GTRGGSDRFSGPGRSGATPFSSSESGNFQGKA  132

Query  548  TR---------------TAGSTTNRWLPTISDAAGTENQKLVD--GVSAATQHSSGYQSA  676
            T                T+G +T+  +P     A       V   G   ++Q  SG+Q+A
Sbjct  133  TNKRESEKQGYAGSFSSTSGVSTHHPIPHSDSVAMDRKTPTVTSGGGIPSSQTVSGHQTA  192

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W G  GQ+SMADIVKMG+PH K
Sbjct  193  WCGAAGQMSMADIVKMGRPHNK  214



>ref|XP_006410567.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52020.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=842

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 123/202 (61%), Gaps = 30/202 (15%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEK  79

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGK-----STYAYKENGYTNTKS  547
            +KE +D  +SRPRG S++            RGGS+   G      + ++  E+G    K+
Sbjct  80   KKEIRDIPDSRPRGYSNTYNRGT-------RGGSDRFSGPGRSGATPFSSSESGNFQGKA  132

Query  548  TR---------------TAGSTTNRWLPTISDAAGTENQKLVD--GVSAATQHSSGYQSA  676
            T                T+G +T+  +P     A       V   G   ++Q  SG+Q+A
Sbjct  133  TNKRESEKQGYAGSFSSTSGVSTHHPIPHSDSVAMDRKTPTVTSGGGIPSSQTVSGHQTA  192

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W G  GQ+SMADIVKMG+PH K
Sbjct  193  WCGAAGQMSMADIVKMGRPHNK  214



>ref|XP_006410569.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52022.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=840

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 123/202 (61%), Gaps = 30/202 (15%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K
Sbjct  21   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEK  79

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGK-----STYAYKENGYTNTKS  547
            +KE +D  +SRPRG S++            RGGS+   G      + ++  E+G    K+
Sbjct  80   KKEIRDIPDSRPRGYSNTYNRGT-------RGGSDRFSGPGRSGATPFSSSESGNFQGKA  132

Query  548  TR---------------TAGSTTNRWLPTISDAAGTENQKLVD--GVSAATQHSSGYQSA  676
            T                T+G +T+  +P     A       V   G   ++Q  SG+Q+A
Sbjct  133  TNKRESEKQGYAGSFSSTSGVSTHHPIPHSDSVAMDRKTPTVTSGGGIPSSQTVSGHQTA  192

Query  677  WVGVPGQVSMADIVKMGKPHGK  742
            W G  GQ+SMADIVKMG+PH K
Sbjct  193  WCGAAGQMSMADIVKMGRPHNK  214



>ref|XP_009109669.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Brassica rapa]
Length=822

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 123/194 (63%), Gaps = 16/194 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+GSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  16   IPTGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  74

Query  392  NKDTTEsrpr--gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYTNT  541
             +D  + R R    + +RGG+G +DRY GR GS  L         GKST   +      T
Sbjct  75   TRDVPDYRLRGGHNTYNRGGRGGSDRYGGRSGSTHLSSTDSGNFRGKSTNKRESGTQGYT  134

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSA----ATQHSSGYQSAWVGVPGQVSMA  709
             S  +A    N      SD+  TEN KL    S+    ++Q +SG+Q+ W G  GQ+SMA
Sbjct  135  SSWSSASGVANHHQTPHSDSVVTEN-KLPPAASSDGILSSQPASGHQTPWFGAQGQMSMA  193

Query  710  DIVKMGKPHGKAPN  751
            DIVK G P  K  N
Sbjct  194  DIVKRGIPQNKTTN  207



>ref|XP_009109668.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Brassica rapa]
Length=823

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 123/194 (63%), Gaps = 16/194 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+GSRKIV+SLKEIV N PE+EIYA LKECNMDPNEAV+RLLSQDPFHEVKSK++K+KE
Sbjct  16   IPTGSRKIVQSLKEIV-NSPEAEIYAMLKECNMDPNEAVHRLLSQDPFHEVKSKKEKKKE  74

Query  392  NKDTTEsrpr--gasssrggkgsadrYAGRGGSESL--------HGKSTYAYKENGYTNT  541
             +D  + R R    + +RGG+G +DRY GR GS  L         GKST   +      T
Sbjct  75   TRDVPDYRLRGGHNTYNRGGRGGSDRYGGRSGSTHLSSTDSGNFRGKSTNKRESGTQGYT  134

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSA----ATQHSSGYQSAWVGVPGQVSMA  709
             S  +A    N      SD+  TEN KL    S+    ++Q +SG+Q+ W G  GQ+SMA
Sbjct  135  SSWSSASGVANHHQTPHSDSVVTEN-KLPPAASSDGILSSQPASGHQTPWFGAQGQMSMA  193

Query  710  DIVKMGKPHGKAPN  751
            DIVK G P  K  N
Sbjct  194  DIVKRGIPQNKTTN  207



>ref|XP_003569505.1| PREDICTED: uncharacterized protein LOC100846506 isoform X1 [Brachypodium 
distachyon]
Length=834

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 118/184 (64%), Gaps = 22/184 (12%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL++C MDP+EAV+RLLSQD F EVK+KRDK+KE
Sbjct  19   VPASARKLVQGLKEIV-NRPDAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKNKRDKKKE  77

Query  392  -NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGST  568
              K T+E R RGA+++          A RGG++     S+     +G  N  S     S 
Sbjct  78   IPKATSEPRSRGATNTNSR-------ATRGGADRTGRSSSVQSVSSGADNMLSR---SSI  127

Query  569  TNRWLPTISDAA-----GTENQKLV-DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGK  730
                +P+ S+AA      + N+ +V DG   + Q SSG+Q  W GVPGQ+SMAD+VKMG+
Sbjct  128  LGPGVPS-SNAAQKQTVPSSNKDVVPDG---SLQSSSGFQQNWYGVPGQMSMADVVKMGR  183

Query  731  PHGK  742
            P G+
Sbjct  184  PQGR  187



>emb|CDY61669.1| BnaC01g40800D [Brassica napus]
Length=740

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 108/190 (57%), Gaps = 18/190 (9%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+VESLKEIV N  + EIYA L +C+MDP+E V+RLLSQD FHEVKSKRDK+KE
Sbjct  18   VPASSRKVVESLKEIV-NCSDLEIYAMLVDCDMDPDETVSRLLSQDTFHEVKSKRDKKKE  76

Query  392  NKDTTEsrprgasssrggkgsadrY-AGRGGSESLHGKSTYAY-------KENGYTN--T  541
             KD  ES  R   +     G  D Y   RGG          +        +ENG  N   
Sbjct  77   TKDPAESWTRSTPNRGARSGGYDGYNTSRGGGNRFKSSERASVQSVPVNRRENGTRNHWA  136

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKL-----VDGVSAATQHSSGYQSAWVGV-PGQVS  703
             S+ T G    R  P  SD   +E +K       +GV++++  +  YQSAW    PGQ +
Sbjct  137  GSSSTPG-VLGRQPPPNSDPTNSEVKKAQPAGSTEGVTSSSLPTPAYQSAWANANPGQRT  195

Query  704  MADIVKMGKP  733
            MADIVKMG+P
Sbjct  196  MADIVKMGRP  205



>ref|XP_002881327.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57586.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 127/196 (65%), Gaps = 14/196 (7%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGS+K+V+SLKEIV N PE+EIYA LK+CNMDPNEAV+RLLSQDPFHEVKSK++K
Sbjct  21   ISDIPSGSKKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVSRLLSQDPFHEVKSKKEK  79

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGG--------SESLHGKSTYAYKENGY  532
            +KE +D  +SR RG S++        +DRYAGR G        S S  GK+T   +    
Sbjct  80   KKEIRDIPDSRRRGYSNNYNHGIRGGSDRYAGRNGATPFSSNDSGSFQGKTTNKRESGMQ  139

Query  533  TNTKSTRTAGSTTNRWLPTISDAAGTENQ--KLVDGVSAATQHS-SGYQSAWVGVPGQVS  703
            T+  S  +    ++      SD+   E++   +  G   ++ HS +G+Q+AW G  GQ+S
Sbjct  140  THAGSYSSTSGISSHHQIPHSDSVAKESKTPTVTSGGEISSSHSVTGHQTAWFGGSGQLS  199

Query  704  MADIVKMGKPHGKAPN  751
            MADIVKMG+PH K  N
Sbjct  200  MADIVKMGRPHNKTSN  215



>ref|XP_010232108.1| PREDICTED: uncharacterized protein LOC100846506 isoform X2 [Brachypodium 
distachyon]
Length=824

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 111/184 (60%), Gaps = 32/184 (17%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ +RK+V+ LKEIV N P++EIYAAL++C MDP+EAV+RLLSQD F EVK+KRDK+KE
Sbjct  19   VPASARKLVQGLKEIV-NRPDAEIYAALRDCGMDPDEAVSRLLSQDTFQEVKNKRDKKKE  77

Query  392  -NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGY------TNTKST  550
              K T+E R RGA+++          A RGG++     S+     +G       +N    
Sbjct  78   IPKATSEPRSRGATNTNSR-------ATRGGADRTGRSSSVQSVSSGAGPGVPSSNAAQK  130

Query  551  RTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGK  730
            +T  S+    +P              DG   + Q SSG+Q  W GVPGQ+SMAD+VKMG+
Sbjct  131  QTVPSSNKDVVP--------------DG---SLQSSSGFQQNWYGVPGQMSMADVVKMGR  173

Query  731  PHGK  742
            P G+
Sbjct  174  PQGR  177



>ref|XP_011467573.1| PREDICTED: uncharacterized protein LOC101307606 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A    G++K+++SLKE+V N PE+EIYA LKECNMDPN+AV RLLS D FHEVKSKR++R
Sbjct  12   AQFLPGTKKMIQSLKEVV-NCPEAEIYAVLKECNMDPNDAVQRLLSLDTFHEVKSKRERR  70

Query  386  KENKDTTEsrprgas--ssrggkgsadrYAGRGGS--ESLHGKSTYAYK-ENGYTN-TKS  547
            KE KDT ESRPR  +  S+RG + + +  AG  GS   S +     AYK +NG+   +  
Sbjct  71   KEMKDTQESRPRVYNGGSNRGVRVTTEHIAGSCGSTQTSFNELGKAAYKGQNGFAAPSPH  130

Query  548  TRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAW-VGVPGQVSMADIVKM  724
            + + G TTN+  P+    + + +    D +SA+ Q S G QSAW     G  SMADIVKM
Sbjct  131  SSSVGRTTNQQ-PSSYSDSFSTSTGSGDAISASVQPSPGNQSAWSTTSSGHFSMADIVKM  189

Query  725  GK  730
            G+
Sbjct  190  GR  191



>ref|XP_009141365.1| PREDICTED: RNA polymerase II degradation factor 1-like [Brassica 
rapa]
Length=819

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 129/199 (65%), Gaps = 18/199 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V+ IP+GSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK+DK
Sbjct  18   VSDIPTGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKDK  76

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAG--RGGS--------ESLHGKSTYAYKEN  526
            +KE +D  +SRPRG S++        +DRYAG  R G+         S  GK+T   +  
Sbjct  77   KKEVRDIQDSRPRGYSNNYNRGTRGGSDRYAGPRRTGASSFNSSESGSFQGKTTNKRESE  136

Query  527  GYTNTKS-TRTAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVGVPG  694
              T   S + T+G+ +++ +P  SD+   +++       G  +++Q  S  Q AW G  G
Sbjct  137  KQTYGGSFSSTSGAPSHQQIPH-SDSVAVDSKTPTVSSGGGISSSQPVSVQQPAWFGAAG  195

Query  695  QVSMADIVKMGKPHGKAPN  751
            Q SMADIVKMG+PH K  N
Sbjct  196  QRSMADIVKMGRPHTKTTN  214



>gb|AAG51735.1|AC068667_14 unknown protein; 25451-20507 [Arabidopsis thaliana]
Length=858

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 126/219 (58%), Gaps = 44/219 (20%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ---------------  346
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQ               
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQAVAFNMVPLVIVQLS  75

Query  347  -------------DPFHEVKSKRDKRKENKDTTEsrprgasssrggkgs--adrYAGRGG  481
                         DPFHEVKSK++K+KE +D ++SRPRGA+++        + RYAGR G
Sbjct  76   SWFGFIEKKDVVNDPFHEVKSKKEKKKETRDISDSRPRGANNTYNRGARGGSARYAGRSG  135

Query  482  SE--------SLHGKSTYAYKENGYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KL  625
            S         +  GKST   +      T S  +A    N +    S+   TEN+     L
Sbjct  136  STHFSSTDSGNFQGKSTNKKESGTQGYTSSWSSASGVANTYQTPHSEPVATENKLPPVTL  195

Query  626  VDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGK  742
             DG+S+ +Q +SG+Q+AW G PGQ SMA++VKMG+P  K
Sbjct  196  GDGISS-SQSASGHQTAWFGAPGQRSMAEVVKMGRPQNK  233



>emb|CDY43685.1| BnaA04g20060D [Brassica napus]
Length=830

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 129/199 (65%), Gaps = 18/199 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            V+ IP+GSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK+DK
Sbjct  17   VSDIPTGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKDK  75

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAG--RGGS--------ESLHGKSTYAYKEN  526
            +KE +D  +SRPRG S++        +DRYAG  R G+         S  GK+T   +  
Sbjct  76   KKEVRDIQDSRPRGYSNNYNRGTRGGSDRYAGPRRTGASSFNSSESGSFQGKTTNKRESE  135

Query  527  GYTNTKS-TRTAGSTTNRWLPTISDAAGTENQKLV---DGVSAATQHSSGYQSAWVGVPG  694
              T   S + T+G+ +++ +P  SD+   +++       G  +++Q  S  Q AW G  G
Sbjct  136  KQTYGGSFSSTSGAPSHQQIPH-SDSVAVDSKTPTVSSGGGISSSQPVSVQQPAWFGAAG  194

Query  695  QVSMADIVKMGKPHGKAPN  751
            Q SMADIVKMG+PH K  N
Sbjct  195  QRSMADIVKMGRPHTKTTN  213



>ref|XP_009132981.1| PREDICTED: uncharacterized protein LOC103857526 [Brassica rapa]
Length=808

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 123/199 (62%), Gaps = 16/199 (8%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            +  IPSGSRK+V+SLKEIV   PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K
Sbjct  10   ITDIPSGSRKMVQSLKEIVNCCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEK  69

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGG-----------SESLHGKSTYAYKE  523
            +KEN+D  +SRPRG S+S        +DRYAG  G           S S  GK++   + 
Sbjct  70   KKENRDILDSRPRGYSNSYNRGSRGGSDRYAGGPGRSGATSFSSSESRSFQGKTSNKRES  129

Query  524  NGYTNTKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVS---AATQHSSGYQSAWVGVPG  694
               T   S  +    ++      SD+   +++    G     +++Q  SG Q+AW G  G
Sbjct  130  EKETYAASFSSTSGVSSHHQIPHSDSVAVDSKTATVGSGGRISSSQPVSGQQTAWFGAAG  189

Query  695  QVSMADIVKMGKPHGKAPN  751
            Q+SMADIVKMG+PH K  N
Sbjct  190  QMSMADIVKMGRPHNKTAN  208



>ref|XP_009131438.1| PREDICTED: flocculation protein FLO11 [Brassica rapa]
Length=780

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 104/189 (55%), Gaps = 16/189 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+VESLKEIV N  + EIYA L +C+MDP+E V+RLLSQD FHEVKSKRDK+KE
Sbjct  19   VPASSRKVVESLKEIV-NCSDLEIYAMLVDCDMDPDETVSRLLSQDTFHEVKSKRDKKKE  77

Query  392  NKDTTEsrprgasssrggkgsadrY-AGRGGSESLHGK---STYAYKENGYTNTKSTRTA  559
             KD  ES  R   +        D Y   RGG          S  +   N   N      A
Sbjct  78   TKDPAESWTRSTQNRGARSSGYDGYNTSRGGGNRFKSNERGSVQSVPANRRENGTRNHWA  137

Query  560  GSTTN-----RWLPTISDAAGTENQKLV-----DGVSAATQHSSGYQSAWVGV-PGQVSM  706
            GS++      R  P  SD    E +K       + V++++  +  YQSAW    PGQ +M
Sbjct  138  GSSSTPGVLGRQPPPNSDPTNAEVKKAQPTGSNEAVTSSSLPTPAYQSAWANANPGQRTM  197

Query  707  ADIVKMGKP  733
            ADIVKMG+P
Sbjct  198  ADIVKMGRP  206



>ref|XP_010449499.1| PREDICTED: uncharacterized protein LOC104731723 isoform X2 [Camelina 
sativa]
Length=794

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 102/196 (52%), Gaps = 31/196 (16%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSEVEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST----RTA  559
             KD  +S  R   +     G+      RGG           Y  NG  N +      R  
Sbjct  76   TKDPADSWTRNIPNRGARSGNDSYNTSRGGGNK--------YNSNGTGNAQGVPANRREN  127

Query  560  GSTTNRWLPTI-------------SDAAGTENQKLVDGVSAATQHSS----GYQSAWVGV  688
            G+  N W  +              SD    E +K   G S A   SS     YQSAW   
Sbjct  128  GAPRNHWAGSSSSSGVLGRQPLSNSDPPSAEVKKAPTGSSDAVTSSSLPTPAYQSAWASA  187

Query  689  -PGQVSMADIVKMGKP  733
             PGQ +MADIVKMG+P
Sbjct  188  NPGQRTMADIVKMGRP  203



>ref|XP_010449498.1| PREDICTED: uncharacterized protein LOC104731723 isoform X1 [Camelina 
sativa]
Length=795

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 102/196 (52%), Gaps = 31/196 (16%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSEVEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST----RTA  559
             KD  +S  R   +     G+      RGG           Y  NG  N +      R  
Sbjct  76   TKDPADSWTRNIPNRGARSGNDSYNTSRGGGNK--------YNSNGTGNAQGVPANRREN  127

Query  560  GSTTNRWLPTI-------------SDAAGTENQKLVDGVSAATQHSS----GYQSAWVGV  688
            G+  N W  +              SD    E +K   G S A   SS     YQSAW   
Sbjct  128  GAPRNHWAGSSSSSGVLGRQPLSNSDPPSAEVKKAPTGSSDAVTSSSLPTPAYQSAWASA  187

Query  689  -PGQVSMADIVKMGKP  733
             PGQ +MADIVKMG+P
Sbjct  188  NPGQRTMADIVKMGRP  203



>ref|XP_010413764.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=843

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 127/204 (62%), Gaps = 30/204 (15%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGS+K+V+SLKEIV N PE+EIYA LK+CNMDPNEAV RLLSQDPFHEVKSK++K
Sbjct  27   ISDIPSGSKKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVTRLLSQDPFHEVKSKKEK  85

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST-  550
            +KE +D  +SR RG +++            RGGS+   G+S    +   E+G    K+T 
Sbjct  86   KKEIRDIPDSRSRGYNNTYNR-------GSRGGSDRYTGRSGATPFTSSESGSVKVKTTN  138

Query  551  -RTAG-------------STTNRWLPTISD--AAGTENQKLVDGVSAATQHS-SGYQSAW  679
             R +G              +++  +P  SD  A  ++   +  G   ++ HS +G+Q+AW
Sbjct  139  KRESGMQSYAGSYSSTSGISSHHQIPH-SDFVAKDSKTPTVTSGGELSSSHSVTGHQTAW  197

Query  680  VGVPGQVSMADIVKMGKPHGKAPN  751
             G  GQ+SMADIVKMG+PH +  N
Sbjct  198  FGALGQMSMADIVKMGRPHSQTRN  221



>ref|XP_010413763.1| PREDICTED: alpha-protein kinase 1-like isoform X1 [Camelina sativa]
Length=864

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 127/204 (62%), Gaps = 30/204 (15%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGS+K+V+SLKEIV N PE+EIYA LK+CNMDPNEAV RLLSQDPFHEVKSK++K
Sbjct  27   ISDIPSGSKKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVTRLLSQDPFHEVKSKKEK  85

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST-  550
            +KE +D  +SR RG +++            RGGS+   G+S    +   E+G    K+T 
Sbjct  86   KKEIRDIPDSRSRGYNNTYNR-------GSRGGSDRYTGRSGATPFTSSESGSVKVKTTN  138

Query  551  -RTAG-------------STTNRWLPTISD--AAGTENQKLVDGVSAATQHS-SGYQSAW  679
             R +G              +++  +P  SD  A  ++   +  G   ++ HS +G+Q+AW
Sbjct  139  KRESGMQSYAGSYSSTSGISSHHQIPH-SDFVAKDSKTPTVTSGGELSSSHSVTGHQTAW  197

Query  680  VGVPGQVSMADIVKMGKPHGKAPN  751
             G  GQ+SMADIVKMG+PH +  N
Sbjct  198  FGALGQMSMADIVKMGRPHSQTRN  221



>ref|XP_010439897.1| PREDICTED: uncharacterized protein LOC104723267 isoform X1 [Camelina 
sativa]
Length=799

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 103/199 (52%), Gaps = 34/199 (17%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST----RTA  559
             KD  +S  R   +     G+      RGG           Y  NG  N +      R  
Sbjct  76   TKDPADSWTRNIPNRGARSGNDSYNTSRGGGNK--------YNSNGTGNAQGVPANRREN  127

Query  560  GSTTNRWLPTI----------------SDAAGTENQKLVDGVSAATQHSS----GYQSAW  679
            G+  N W  +                 SD   +E +K   G S A   SS     YQSAW
Sbjct  128  GAPRNHWAGSSASSISSGVLGRQPLSNSDPPSSEVKKAPTGSSDAVASSSLPTPAYQSAW  187

Query  680  VGV-PGQVSMADIVKMGKP  733
                PGQ +MADIVKMG+P
Sbjct  188  ASANPGQRTMADIVKMGRP  206



>ref|XP_010439898.1| PREDICTED: uncharacterized protein LOC104723267 isoform X2 [Camelina 
sativa]
Length=798

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 103/199 (52%), Gaps = 34/199 (17%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+KE
Sbjct  17   VPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKKKE  75

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKST----RTA  559
             KD  +S  R   +     G+      RGG           Y  NG  N +      R  
Sbjct  76   TKDPADSWTRNIPNRGARSGNDSYNTSRGGGNK--------YNSNGTGNAQGVPANRREN  127

Query  560  GSTTNRWLPTI----------------SDAAGTENQKLVDGVSAATQHSS----GYQSAW  679
            G+  N W  +                 SD   +E +K   G S A   SS     YQSAW
Sbjct  128  GAPRNHWAGSSASSISSGVLGRQPLSNSDPPSSEVKKAPTGSSDAVASSSLPTPAYQSAW  187

Query  680  VGV-PGQVSMADIVKMGKP  733
                PGQ +MADIVKMG+P
Sbjct  188  ASANPGQRTMADIVKMGRP  206



>ref|XP_010434571.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X3 [Camelina sativa]
Length=798

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 105/194 (54%), Gaps = 23/194 (12%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+
Sbjct  15   AGVPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKK  73

Query  386  KENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGS  565
            KE KD  +S  R   +     G+      RGG    +   T     N      + R  G+
Sbjct  74   KETKDPADSWTRNIPNRGARSGNDSYNTSRGGGNKYNSNET----GNAQGVPANRRENGA  129

Query  566  TTNRWLPTI-------------SDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-P  691
              N W  +              SD   +E +K      D V++++  +  YQSAW    P
Sbjct  130  PRNHWAGSSSSSGVLGRQPLSNSDPPSSEVKKAPTGSNDAVTSSSLPTPAYQSAWASANP  189

Query  692  GQVSMADIVKMGKP  733
            GQ +MADIVKMG+P
Sbjct  190  GQRTMADIVKMGRP  203



>ref|XP_010434569.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X1 [Camelina sativa]
 ref|XP_010434570.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=799

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 105/194 (54%), Gaps = 23/194 (12%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A +P+ SRK+V+SLKEIV N  E EIYA L EC+MDP+E V+RLLSQD FHEVKSKR+K+
Sbjct  15   AGVPASSRKVVQSLKEIV-NCSELEIYAMLVECDMDPDETVSRLLSQDTFHEVKSKREKK  73

Query  386  KENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGS  565
            KE KD  +S  R   +     G+      RGG    +   T     N      + R  G+
Sbjct  74   KETKDPADSWTRNIPNRGARSGNDSYNTSRGGGNKYNSNET----GNAQGVPANRRENGA  129

Query  566  TTNRWLPTI-------------SDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-P  691
              N W  +              SD   +E +K      D V++++  +  YQSAW    P
Sbjct  130  PRNHWAGSSSSSGVLGRQPLSNSDPPSSEVKKAPTGSNDAVTSSSLPTPAYQSAWASANP  189

Query  692  GQVSMADIVKMGKP  733
            GQ +MADIVKMG+P
Sbjct  190  GQRTMADIVKMGRP  203



>gb|AAG51729.1|AC068667_8 unknown protein; 16040-11188 [Arabidopsis thaliana]
Length=858

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 125/219 (57%), Gaps = 44/219 (20%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ---------------  346
            IPSGSRKIV+SL EIV N PE+EIYA LKECNMDPNE V+RLLSQ               
Sbjct  17   IPSGSRKIVQSLTEIV-NSPEAEIYAMLKECNMDPNETVSRLLSQAVAFNMVPLVIVQLS  75

Query  347  -------------DPFHEVKSKRDKRKENKDTTEsrprgasssrggkgs--adrYAGRGG  481
                         DPFHEVKSK++K+KE +D ++SRPRGA+++        + RYAGR G
Sbjct  76   SWFGFIEKKDVVNDPFHEVKSKKEKKKETRDISDSRPRGANNTYNRGARGGSARYAGRSG  135

Query  482  SE--------SLHGKSTYAYKENGYTNTKSTRTAGSTTNRWLPTISDAAGTENQ----KL  625
            S         +  GKST   +      T S  +A    N +    S+    EN+     L
Sbjct  136  STHFSSTDSGNFQGKSTNKKESGTQGYTSSWSSASGVANTYQTPHSEPIAMENKLPPVTL  195

Query  626  VDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGK  742
             DG+S+ ++ +SG+Q+AW G PGQ SMA++VKMG+P  K
Sbjct  196  GDGISS-SKSASGHQTAWFGAPGQRSMAEVVKMGRPQNK  233



>gb|KFK28493.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=797

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 105/189 (56%), Gaps = 16/189 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V  LKEIV N  + EIY  L ECNMDP+E VNRLLSQD FHEVKSKR+K+KE
Sbjct  17   IPASSRKVVMGLKEIV-NCSDLEIYTMLVECNMDPDETVNRLLSQDTFHEVKSKREKKKE  75

Query  392  NKDTTEsrprgasssrg--gkgsadrYAGRGGSESLHGKSTYA-------YKENGYTNT-  541
             KD  +S  R +S +     + +      RG     +   T +        +ENG  N  
Sbjct  76   TKDPMDSWTRTSSITNRGGRRDNDSYNTARGSGNRYNSNETGSPHGVVANRRENGSRNHW  135

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-PGQVSM  706
              + TA     R  P+ SD    E +K      D V++++  +  YQSAW    PGQ +M
Sbjct  136  AGSSTASGVLGRQPPSNSDPVSVEVKKAPMVSSDAVTSSSVPTPAYQSAWANANPGQRTM  195

Query  707  ADIVKMGKP  733
            ADIVKMG+P
Sbjct  196  ADIVKMGRP  204



>gb|KFK28492.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=796

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 105/189 (56%), Gaps = 16/189 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V  LKEIV N  + EIY  L ECNMDP+E VNRLLSQD FHEVKSKR+K+KE
Sbjct  17   IPASSRKVVMGLKEIV-NCSDLEIYTMLVECNMDPDETVNRLLSQDTFHEVKSKREKKKE  75

Query  392  NKDTTEsrprgasssrg--gkgsadrYAGRGGSESLHGKSTYA-------YKENGYTNT-  541
             KD  +S  R +S +     + +      RG     +   T +        +ENG  N  
Sbjct  76   TKDPMDSWTRTSSITNRGGRRDNDSYNTARGSGNRYNSNETGSPHGVVANRRENGSRNHW  135

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-PGQVSM  706
              + TA     R  P+ SD    E +K      D V++++  +  YQSAW    PGQ +M
Sbjct  136  AGSSTASGVLGRQPPSNSDPVSVEVKKAPMVSSDAVTSSSVPTPAYQSAWANANPGQRTM  195

Query  707  ADIVKMGKP  733
            ADIVKMG+P
Sbjct  196  ADIVKMGRP  204



>ref|XP_002870069.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=802

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 107/188 (57%), Gaps = 15/188 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+V+ LKEIV N  E EIYA L EC+MDP+EAVNRLLSQD FHEVKSKR+K+KE
Sbjct  16   VPASSRKVVQGLKEIV-NCSELEIYAMLVECDMDPDEAVNRLLSQDTFHEVKSKREKKKE  74

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKST----YAYKENGYTNTKSTRTA  559
             KD  +S  R   +     G+      RGG    +   T    +    N   N      A
Sbjct  75   TKDPADSWTRNVPNRGARSGNDSYNTSRGGGNKYNSNETGNVHHGVPANRRENGARNHWA  134

Query  560  GSTTN-----RWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-PGQVSMA  709
            GS+ +     R  P+ SD   +E +K      D V++++  S  YQSAW    PGQ +MA
Sbjct  135  GSSVSSGVLGRQPPSNSDPPSSEVKKAPTGPSDAVTSSSLPSPAYQSAWASANPGQRTMA  194

Query  710  DIVKMGKP  733
            +IVKMG+P
Sbjct  195  EIVKMGRP  202



>ref|XP_009377414.1| PREDICTED: uncharacterized protein LOC103966021 [Pyrus x bretschneideri]
Length=822

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 110/192 (57%), Gaps = 25/192 (13%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
             A  P  +RKI++SLKEIV N PE EIY+ LKECNMDP++AV RLLS D FHEV+SKR++
Sbjct  13   AAQFPPTTRKIIQSLKEIV-NCPEPEIYSVLKECNMDPSDAVQRLLSLDTFHEVRSKRER  71

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHG-----------KSTYAYK-EN  526
            RKE K+T +++ R  ++             RG SE   G               AYK +N
Sbjct  72   RKEIKETQDTKSRVHNAGSNC-------GARGISERTGGWCGSTQTSSNELGKAAYKGQN  124

Query  527  GYT----NTKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPG  694
            G+     +T ++   G TT++  P+    + + + +  D VSA+ Q S+G QS      G
Sbjct  125  GFVAPSPHTSASHFTGGTTSQQ-PSSQHESFSTSIRPGDAVSASLQPSAGNQSTSGTSLG  183

Query  695  QVSMADIVKMGK  730
             +SMADIVKMG+
Sbjct  184  NLSMADIVKMGR  195



>ref|XP_006484855.1| PREDICTED: uncharacterized protein LOC102628559 isoform X2 [Citrus 
sinensis]
Length=836

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 109/201 (54%), Gaps = 33/201 (16%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            + IP+ ++KIV++LKE + +N  +SEIYA L ECNMDPN+A  RLLSQD F EVKSKR++
Sbjct  19   SQIPAAAKKIVQNLKETLNKNCTDSEIYAVLVECNMDPNDAFQRLLSQDAFKEVKSKRER  78

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYA---YKENGYTNTK---  544
            RKE K+T ESR R  S +            R GSE   G++      Y E G T  K   
Sbjct  79   RKEMKETQESRARSNSVTANR-------GARFGSEQAVGQTGSTENNYNELGKTANKREM  131

Query  545  -------------STRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQS  673
                         + R  G   N   P  SD    +N++ +    D +S++ Q  SG Q 
Sbjct  132  GSAAPSGSSSSSYTYRATGKIINEQPPIHSDFFNADNRRQLLGTGDTISSSMQMCSGNQP  191

Query  674  AWVGVP-GQVSMADIVKMGKP  733
             W G+  GQVS+ADIV+ G+P
Sbjct  192  TWPGISKGQVSLADIVR-GRP  211



>ref|XP_006484854.1| PREDICTED: uncharacterized protein LOC102628559 isoform X1 [Citrus 
sinensis]
Length=840

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 109/201 (54%), Gaps = 33/201 (16%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            + IP+ ++KIV++LKE + +N  +SEIYA L ECNMDPN+A  RLLSQD F EVKSKR++
Sbjct  19   SQIPAAAKKIVQNLKETLNKNCTDSEIYAVLVECNMDPNDAFQRLLSQDAFKEVKSKRER  78

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYA---YKENGYTNTK---  544
            RKE K+T ESR R  S +            R GSE   G++      Y E G T  K   
Sbjct  79   RKEMKETQESRARSNSVTANR-------GARFGSEQAVGQTGSTENNYNELGKTANKREM  131

Query  545  -------------STRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQS  673
                         + R  G   N   P  SD    +N++ +    D +S++ Q  SG Q 
Sbjct  132  GSAAPSGSSSSSYTYRATGKIINEQPPIHSDFFNADNRRQLLGTGDTISSSMQMCSGNQP  191

Query  674  AWVGVP-GQVSMADIVKMGKP  733
             W G+  GQVS+ADIV+ G+P
Sbjct  192  TWPGISKGQVSLADIVR-GRP  211



>gb|KFK36320.1| hypothetical protein AALP_AA4G107400 [Arabis alpina]
Length=834

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 127/196 (65%), Gaps = 14/196 (7%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGSRK+V+SLKEIV N PE+EIYA LK+CNMDPNEAVNRLLSQDPFHEVKSK++K
Sbjct  22   ISDIPSGSRKMVQSLKEIV-NCPEAEIYAVLKDCNMDPNEAVNRLLSQDPFHEVKSKKEK  80

Query  383  RKENKDTTEsrprgasssrggkgs--adrYAGRGG------SES--LHGKSTYAYKENGY  532
            +KE +D  +SRPRG S+S        +DRY GR G      SES    GK+T   +    
Sbjct  81   KKETRDIPDSRPRGYSNSYNRGNKGGSDRYGGRSGATPFSSSESGGYQGKATNKRQSGME  140

Query  533  TNTKS-TRTAGSTTNRWLPTISDAAGTENQKLV--DGVSAATQHSSGYQSAWVGVPGQVS  703
            T+  S + T G +++  +P     A       +   G ++++Q  SG+Q+AW G  GQ+S
Sbjct  141  TSQGSFSSTTGVSSHHQIPHSDPVAMDSKTPTIASGGGTSSSQSVSGHQTAWFGAAGQMS  200

Query  704  MADIVKMGKPHGKAPN  751
            MADIVK G P  K+ N
Sbjct  201  MADIVKRGIPDNKSTN  216



>ref|XP_006414144.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
 gb|ESQ55597.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
Length=799

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 100/194 (52%), Gaps = 26/194 (13%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            + + SRK+V+SLKEIV N  + EIYA L EC+MDP+E VNRLLSQD FHEVKSKRDK+K 
Sbjct  19   VSASSRKVVQSLKEIV-NCSDLEIYAMLVECDMDPDETVNRLLSQDTFHEVKSKRDKKKN  77

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTN-TKSTRTAGST  568
             K   ES      +        D Y     + +  G + Y   E G      + R    T
Sbjct  78   TKIPAESWTCSTPNRGARSSGNDSY-----NTARDGGNRYNSNELGSVQGVPANRRENRT  132

Query  569  TNRWL--------------PTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-P  691
             N W               P+ SD    E +K      D +++++  S  YQSAW    P
Sbjct  133  RNHWAVSSSSSSGVLGHQPPSNSDPTDVEVKKAPMGSSDAITSSSLPSPAYQSAWANANP  192

Query  692  GQVSMADIVKMGKP  733
            GQ +MADIVKMG+P
Sbjct  193  GQRTMADIVKMGRP  206



>ref|XP_009356619.1| PREDICTED: uncharacterized protein LOC103947437 isoform X3 [Pyrus 
x bretschneideri]
Length=804

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 107/186 (58%), Gaps = 13/186 (7%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
             A  P  ++KI++SLKEIV N PE EIY+ LKEC+MDPN+AV RLLS D FHEVKSKR++
Sbjct  13   AAQFPPMTKKIIQSLKEIV-NCPEPEIYSVLKECDMDPNDAVQRLLSLDTFHEVKSKRER  71

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLH------GKSTYAYKENGYTN--  538
            RKE K+T +S+PR  S               G   S        GK+ Y   +NG+ +  
Sbjct  72   RKEIKETQDSKPRVHSVGSNRGAKGSNEHTGGWCGSTQTGSNEPGKAAYK-GQNGFVSPH  130

Query  539  -TKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADI  715
             + S  T G+T+ +  P+    + + + +  D V  + Q S+G QS      G +SMADI
Sbjct  131  TSASHLTGGATSQQ--PSSQRESFSTSIRPGDAVCVSLQPSTGNQSTSGTSSGNLSMADI  188

Query  716  VKMGKP  733
            VKMG+P
Sbjct  189  VKMGRP  194



>ref|XP_010102151.1| hypothetical protein L484_021385 [Morus notabilis]
 gb|EXB92401.1| hypothetical protein L484_021385 [Morus notabilis]
Length=826

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 117/185 (63%), Gaps = 17/185 (9%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            ++K++++LKEIV + PESEIYA LKECNMDP++AV RLLSQD FHEVKSKR++RKE K+T
Sbjct  19   TKKMIQNLKEIV-DCPESEIYAVLKECNMDPDDAVQRLLSQDTFHEVKSKRERRKEMKET  77

Query  404  TEsrprga----sssrggkgsadrYAGRGGS--ESLHGKSTYAYK-ENGYTN-TKSTRTA  559
             E RPR      S   G K +++RY+G  GS   S     T A+K EN +   ++S  TA
Sbjct  78   QELRPRVNYNGPSRGSGNKSASERYSGWSGSFQTSYEETGTNAHKGENAWAAPSQSYLTA  137

Query  560  ---GSTTNRWLPTISDAAGTE--NQKLVDG--VSAATQHSSGYQSAWVGV-PGQVSMADI  715
               G T +      SD+  T+   Q +  G  +S   Q S G QSAW+G   GQ+SMAD+
Sbjct  138  DVKGETMSPQPSFNSDSLSTDCGGQSIRTGGAISNTVQPSPGCQSAWLGTSAGQLSMADV  197

Query  716  VKMGK  730
            V+ G+
Sbjct  198  VRQGR  202



>ref|XP_009356618.1| PREDICTED: uncharacterized protein LOC103947437 isoform X2 [Pyrus 
x bretschneideri]
Length=809

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 107/186 (58%), Gaps = 13/186 (7%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
             A  P  ++KI++SLKEIV N PE EIY+ LKEC+MDPN+AV RLLS D FHEVKSKR++
Sbjct  13   AAQFPPMTKKIIQSLKEIV-NCPEPEIYSVLKECDMDPNDAVQRLLSLDTFHEVKSKRER  71

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLH------GKSTYAYKENGYTN--  538
            RKE K+T +S+PR  S               G   S        GK+ Y   +NG+ +  
Sbjct  72   RKEIKETQDSKPRVHSVGSNRGAKGSNEHTGGWCGSTQTGSNEPGKAAYK-GQNGFVSPH  130

Query  539  -TKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADI  715
             + S  T G+T+ +  P+    + + + +  D V  + Q S+G QS      G +SMADI
Sbjct  131  TSASHLTGGATSQQ--PSSQRESFSTSIRPGDAVCVSLQPSTGNQSTSGTSSGNLSMADI  188

Query  716  VKMGKP  733
            VKMG+P
Sbjct  189  VKMGRP  194



>ref|XP_009356617.1| PREDICTED: uncharacterized protein LOC103947437 isoform X1 [Pyrus 
x bretschneideri]
Length=827

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 107/185 (58%), Gaps = 11/185 (6%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
             A  P  ++KI++SLKEIV N PE EIY+ LKEC+MDPN+AV RLLS D FHEVKSKR++
Sbjct  13   AAQFPPMTKKIIQSLKEIV-NCPEPEIYSVLKECDMDPNDAVQRLLSLDTFHEVKSKRER  71

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKST----YAYK-ENGYTN---  538
            RKE K+T +S+PR  S               G   S    S      AYK +NG+ +   
Sbjct  72   RKEIKETQDSKPRVHSVGSNRGAKGSNEHTGGWCGSTQTGSNEPGKAAYKGQNGFVSPHT  131

Query  539  TKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIV  718
            + S  T G+T+ +  P+    + + + +  D V  + Q S+G QS      G +SMADIV
Sbjct  132  SASHLTGGATSQQ--PSSQRESFSTSIRPGDAVCVSLQPSTGNQSTSGTSSGNLSMADIV  189

Query  719  KMGKP  733
            KMG+P
Sbjct  190  KMGRP  194



>ref|XP_006437175.1| hypothetical protein CICLE_v10033869mg, partial [Citrus clementina]
 gb|ESR50415.1| hypothetical protein CICLE_v10033869mg, partial [Citrus clementina]
Length=787

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 107/199 (54%), Gaps = 33/199 (17%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            IP+ ++KIV++LKE + +N  +SEIYA L ECNMDPN+A  RLLSQD F EVKSKR++RK
Sbjct  21   IPAAAKKIVQNLKETLNKNCTDSEIYAVLVECNMDPNDAFQRLLSQDAFKEVKSKRERRK  80

Query  389  ENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYA---YKENGYTNTK-----  544
            E K+T ESR R  S +            R GSE   G++      Y E G T  K     
Sbjct  81   EMKETQESRARSNSVTANR-------GARFGSEQAVGQTGSTENNYNELGKTANKREMGS  133

Query  545  -----------STRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAW  679
                       +    G   N   P  SD    +N++ +    D +S++ Q  SG Q  W
Sbjct  134  AAPSGSSSSSYTYHATGKIINEQPPIHSDFFNADNRRQLLGTGDTISSSMQMCSGNQPTW  193

Query  680  VGVP-GQVSMADIVKMGKP  733
             G+  GQVS+ADIV+ G+P
Sbjct  194  PGISKGQVSLADIVR-GRP  211



>ref|NP_193549.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84004.1| uncharacterized protein AT4G18150 [Arabidopsis thaliana]
Length=758

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 104/194 (54%), Gaps = 21/194 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+++ LKEIV    E EIYA L EC+M+P+EAVNRLLSQD FHEVKSKR+K+KE
Sbjct  15   VPASSRKVIQDLKEIVE-CSELEIYAMLVECDMNPDEAVNRLLSQDTFHEVKSKREKKKE  73

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKST-------YAYKENGYTNTKST  550
             KD  +S  R   +     G+      RGG        T          +ENG  N  + 
Sbjct  74   TKDHADSWTRNVPNRGARSGNDSYNTSRGGRNKYKSNETGKIQGVPVNRRENGARNHLAG  133

Query  551  RTAGSTTNRWL--------PTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-P  691
             +A S     L        P+ SD   ++ +K      D V+ ++     YQSAW    P
Sbjct  134  SSASSGLLGRLPGLLRRQPPSNSDLPSSKVKKAPTTPSDAVTLSSLPFPAYQSAWASANP  193

Query  692  GQVSMADIVKMGKP  733
            GQ +MA+IVKMG+P
Sbjct  194  GQRTMAEIVKMGRP  207



>ref|XP_007048866.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
 gb|EOX93023.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
Length=873

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 108/201 (54%), Gaps = 31/201 (15%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            IP+  +K+V+ LKE+V  N  +SEIYA L++CNMDPNEAV RLLSQD FH+VKS+R++RK
Sbjct  23   IPASVKKVVQDLKEVVGNNCTDSEIYAVLRDCNMDPNEAVQRLLSQDTFHKVKSRRERRK  82

Query  389  ENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS------------TYAYKENG-  529
            E K+T E + R  + +            RGGSE   G S              + KEN  
Sbjct  83   EMKETQELKNRANNGTSNRGV-------RGGSEHSFGWSGSTKISSNELGKAASRKENAS  135

Query  530  -----YTNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWV  682
                 Y+ + +    G T N      S++   +N++      D + ++ Q S G Q   V
Sbjct  136  VASIPYSASSTICATGQTLNEQPCPQSNSFNADNRRQSMGTGDMIDSSLQPSLGSQPTRV  195

Query  683  GVP-GQVSMADIVKMGKPHGK  742
            G   G V+MADIV+MG+P  K
Sbjct  196  GATLGHVTMADIVRMGRPQSK  216



>ref|XP_010469381.1| PREDICTED: uncharacterized protein LOC104749443 isoform X1 [Camelina 
sativa]
 ref|XP_010469382.1| PREDICTED: uncharacterized protein LOC104749443 isoform X2 [Camelina 
sativa]
Length=195

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 11/119 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGS+K+V+SLKEIV N P++EIYA LK+CNMDPNEAV RLLSQDPFHEV SK++K
Sbjct  26   ISDIPSGSKKMVQSLKEIV-NCPDAEIYAVLKDCNMDPNEAVTRLLSQDPFHEVTSKQEK  84

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST  550
            +K+ +D  +SR RG +++            RGGS+   G+S    +   E+G    K+T
Sbjct  85   KKQIRDIQDSRSRGYNNNYNR-------GSRGGSDRYTGRSGATPFTSSESGSVQVKTT  136



>ref|XP_010469383.1| PREDICTED: uncharacterized protein LOC104749443 isoform X3 [Camelina 
sativa]
Length=189

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 11/119 (9%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
            ++ IPSGS+K+V+SLKEIV N P++EIYA LK+CNMDPNEAV RLLSQDPFHEV SK++K
Sbjct  26   ISDIPSGSKKMVQSLKEIV-NCPDAEIYAVLKDCNMDPNEAVTRLLSQDPFHEVTSKQEK  84

Query  383  RKENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKS---TYAYKENGYTNTKST  550
            +K+ +D  +SR RG +++            RGGS+   G+S    +   E+G    K+T
Sbjct  85   KKQIRDIQDSRSRGYNNNYNR-------GSRGGSDRYTGRSGATPFTSSESGSVQVKTT  136



>gb|AAT44198.1| unknown protein [Oryza sativa Japonica Group]
Length=860

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 97/186 (52%), Gaps = 13/186 (7%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IP  SRK+V+ LK I+ +  E+EIYA L +C MDP+ AV RL+SQDPFHEV+ KRDK+
Sbjct  34   AAIPPASRKLVQGLKGILTDRSEAEIYATLLDCGMDPDVAVERLISQDPFHEVRRKRDKK  93

Query  386  KENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGS  565
            KE K   E+RPR                  GG  +  GK     +   ++  KS+ +   
Sbjct  94   KEIKAPQETRPRPFYKPAFRGSKT------GGDSTGSGKGPTKKETELHSLPKSSVSDSV  147

Query  566  TTNRWLPTISDAA-GTENQKLV------DGVSAATQHSSGYQSAWVGVPGQVSMADIVKM  724
              +     IS A   T N  L+      D  S   Q  S  +  W G+PG+ SMADIVKM
Sbjct  148  KESNPTEKISAADHATINDSLILSSGQADAKSTPLQPPSQVKHGWGGMPGRPSMADIVKM  207

Query  725  GKPHGK  742
            GKP  K
Sbjct  208  GKPQAK  213



>emb|CAB53656.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78817.1| hypothetical protein [Arabidopsis thaliana]
Length=762

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 106/195 (54%), Gaps = 22/195 (11%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+++ LKEIV    E EIYA L EC+M+P+EAVNRLLSQD FHE KSKR+K+KE
Sbjct  15   VPASSRKVIQDLKEIVE-CSELEIYAMLVECDMNPDEAVNRLLSQDTFHEAKSKREKKKE  73

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESL--HGKS------TYAYKENGYTNTKS  547
             KD  +S  R   +     G+      RGG      +GK+          +ENG  N  +
Sbjct  74   TKDHADSWTRNVPNRGARSGNDSYNTSRGGRNKYKSNGKTGKIQGVPVNRRENGARNHLA  133

Query  548  TRTAGSTTNRWL--------PTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGV-  688
              +A S     L        P+ SD   ++ +K      D V+ ++     YQSAW    
Sbjct  134  GSSASSGLLGRLPGLLRRQPPSNSDLPSSKVKKAPTTPSDAVTLSSLPFPAYQSAWASAN  193

Query  689  PGQVSMADIVKMGKP  733
            PGQ +MA+IVKMG+P
Sbjct  194  PGQRTMAEIVKMGRP  208



>gb|KHG01632.1| Segment polarity dishevelled DVL-3 [Gossypium arboreum]
Length=861

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 103/195 (53%), Gaps = 30/195 (15%)
 Frame = +2

Query  227  RKIVESLKEIVRNY-PESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            +K+V++LKEIV N   + EIYA L++CNMDP++AV RLLSQD FHEVKSKR++RKE K+T
Sbjct  24   KKVVQNLKEIVNNSCTDWEIYAVLRDCNMDPSDAVQRLLSQDTFHEVKSKRERRKEMKET  83

Query  404  TEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY-----------KEN------GY  532
             E               A  +  R GSE   G+S               KEN       Y
Sbjct  84   QE-------QKTRANSHASSHGVRDGSEHSFGRSRSMLISNELGKAACKKENVSVSYIPY  136

Query  533  TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQ-  697
            + +      G T N      S++   + ++      D + ++ Q S G QS+WVG   Q 
Sbjct  137  SASSKLCAMGQTWNEQPSPQSNSFNADYRRQSIGTGDTIDSSMQPSYGSQSSWVGSTLQH  196

Query  698  VSMADIVKMGKPHGK  742
            V+MADIVKMG+P  K
Sbjct  197  VAMADIVKMGRPKSK  211



>gb|KDP46910.1| hypothetical protein JCGZ_10401 [Jatropha curcas]
Length=883

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 111/195 (57%), Gaps = 16/195 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            IP  + K+++S++EI+  N  ++EIY+ LKEC+MDPN+AV RLLSQD FHEVKSKR++RK
Sbjct  20   IPPATEKMIQSIREIIDDNCTDTEIYSVLKECDMDPNDAVQRLLSQDIFHEVKSKRERRK  79

Query  389  ENKDTTEsrprgasssrggkgsadrY-AGRGGSESLH---GKSTYAYKEN-----GYTNT  541
            E K+T ES+ R +S+   G      Y  GR  S+  +   GK+ Y  +EN       T++
Sbjct  80   EMKETQESKARCSSNGYRGVKGCAEYNVGRSSSQISYNDLGKAAYV-RENLSIPPAVTSS  138

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLVDG----VSAATQHSSGYQSAWVGVP-GQVSM  706
             S      T N  L   SD+   +N +   G    + ++   S   Q+A+ G P G  SM
Sbjct  139  SSLTYHMRTVNEQLSPHSDSFSPDNGRETLGTANTIFSSEPTSLAPQAAFGGGPSGHASM  198

Query  707  ADIVKMGKPHGKAPN  751
            ADIVKM   H  A N
Sbjct  199  ADIVKMSCQHNMASN  213



>ref|XP_008229421.1| PREDICTED: cell wall protein AWA1-like [Prunus mume]
Length=840

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 103/184 (56%), Gaps = 9/184 (5%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDK  382
             A +  G +K+V+SLKEIV N PE EIY+ LK+CNMDPNEAV RLLS D FHEVKSKR++
Sbjct  10   AAPLSPGGKKMVQSLKEIV-NCPEPEIYSVLKDCNMDPNEAVQRLLSLDTFHEVKSKRER  68

Query  383  RKENKDTTEsrprgasssrg-----gkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKS  547
            RKE K+T +S+ R  SS               + G   + S          +NG+    +
Sbjct  69   RKEMKETQDSKLRVHSSGSNRGVRGSSERNGGWCGSTQTSSNELGQAACKGQNGFVAPAA  128

Query  548  TRTAGSTTNRWLPTISDAAGTENQKLVDG-VSAATQHSSGYQSAWVGV-PGQVSMADIVK  721
            +   G T ++  P+    + + +    DG  SA+ Q S G QS   G   G +SMA+IVK
Sbjct  129  SHFMGGTMSQQ-PSSHSDSLSTSIGSGDGATSASVQPSPGNQSTSFGTSSGHLSMAEIVK  187

Query  722  MGKP  733
            MG+P
Sbjct  188  MGRP  191



>ref|XP_009614043.1| PREDICTED: uncharacterized protein LOC104107048 isoform X3 [Nicotiana 
tomentosiformis]
Length=789

 Score = 98.6 bits (244),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 69/101 (68%), Gaps = 8/101 (8%)
 Frame = +2

Query  464  YAGRGGSESLHGKSTYAYK-ENG-YTN--TKSTRTAGSTTNRWLPTISDAAGTENQK--L  625
            Y GRGGSE    K T  YK ENG YT+  T +   +GS  +R + TISDAA  E++K   
Sbjct  50   YVGRGGSEPT--KPTPGYKKENGSYTSYLTSTPEVSGSNVSRRVATISDAAANESKKPAA  107

Query  626  VDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKAP  748
            VDGVS+ +QHSSGYQ  W GVPGQVSMADIVKMGKP  K P
Sbjct  108  VDGVSSVSQHSSGYQPTWGGVPGQVSMADIVKMGKPQSKVP  148


 Score = 29.3 bits (64),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +3

Query  297  KSVIWTLTKPSIGSSLKI  350
            K+VIWTL KPSIG  LK+
Sbjct  5    KNVIWTLMKPSIGFLLKV  22



>ref|NP_001056433.1| Os05g0581800 [Oryza sativa Japonica Group]
 gb|AAU10711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18347.1| Os05g0581800 [Oryza sativa Japonica Group]
Length=852

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 94/181 (52%), Gaps = 13/181 (7%)
 Frame = +2

Query  221  GSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKD  400
             SRK+V+ LK I+ +  E+EIYA L +C MDP+ AV RL+SQDPFHEV+ KRDK+KE K 
Sbjct  29   ASRKLVQGLKGILTDRSEAEIYATLLDCGMDPDVAVERLISQDPFHEVRRKRDKKKEIKA  88

Query  401  TTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGSTTNRW  580
              E+RPR                  GG  +  GK     +   ++  KS+ +     +  
Sbjct  89   PQETRPRPFYKPAFRGSKT------GGDSTGSGKGPTKKETELHSLPKSSVSDSVKESNP  142

Query  581  LPTISDAA-GTENQKLV------DGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHG  739
               IS A   T N  L+      D  S   Q  S  +  W G+PG+ SMADIVKMGKP  
Sbjct  143  TEKISAADHATINDSLILSSGQADAKSTPLQPPSQVKHGWGGMPGRPSMADIVKMGKPQA  202

Query  740  K  742
            K
Sbjct  203  K  203



>ref|XP_004961107.1| PREDICTED: uncharacterized protein LOC101764022 isoform X2 [Setaria 
italica]
Length=793

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRDK+KE
Sbjct  25   IPTASRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDKKKE  84

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGSTT  571
             K + ESRPR           A   + R G +S+        KE       ++      T
Sbjct  85   TKASQESRPRSFQKPMNRGYKAG--SDRSGRDSMGVSKGPIKKEPELHAPLNSSALDVRT  142

Query  572  NRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
            +    TIS    T N    D  +  TQ  S  Q  W G+PG+ S+A+IVKMG+P  K+
Sbjct  143  SNPTETIS---ATGNVAQADAKN-TTQPPSQVQHGWGGIPGRPSLAEIVKMGRPQAKS  196



>ref|NP_001141689.1| uncharacterized protein LOC100273818 [Zea mays]
 gb|ACN27855.1| unknown [Zea mays]
 gb|ACN28046.1| unknown [Zea mays]
 gb|AFW79333.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 91/178 (51%), Gaps = 7/178 (4%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP  SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRD++KE
Sbjct  26   IPVASRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDRKKE  85

Query  392  NKDTTEsrprgasssrgg-kgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGST  568
             K   E+RPR           +    +GR  +    G      +     N+ +     S 
Sbjct  86   TKVNHETRPRPFQKYTYRGYKAVSDRSGRDPTGGFKGPVKKEPEMQAPLNSSALDVKTSD  145

Query  569  TNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGK  742
            T          + T N    D  +  +Q  S  Q  W G+PG+ SMA+IVKMG+P  K
Sbjct  146  TTEIF------SATINVAQTDAKNTTSQPLSKVQHGWGGIPGRPSMAEIVKMGRPQAK  197



>ref|XP_009614044.1| PREDICTED: uncharacterized protein LOC104107048 isoform X4 [Nicotiana 
tomentosiformis]
Length=783

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 69/101 (68%), Gaps = 8/101 (8%)
 Frame = +2

Query  464  YAGRGGSESLHGKSTYAYK-ENG-YTN--TKSTRTAGSTTNRWLPTISDAAGTENQK--L  625
            Y GRGGSE    K T  YK ENG YT+  T +   +GS  +R + TISDAA  E++K   
Sbjct  44   YVGRGGSEPT--KPTPGYKKENGSYTSYLTSTPEVSGSNVSRRVATISDAAANESKKPAA  101

Query  626  VDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKAP  748
            VDGVS+ +QHSSGYQ  W GVPGQVSMADIVKMGKP  K P
Sbjct  102  VDGVSSVSQHSSGYQPTWGGVPGQVSMADIVKMGKPQSKVP  142



>gb|KJB75412.1| hypothetical protein B456_012G040900 [Gossypium raimondii]
Length=860

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 103/195 (53%), Gaps = 30/195 (15%)
 Frame = +2

Query  227  RKIVESLKEIVRNY-PESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            +K+V++LKEIV N   + EIYA L++CNMDP++AV RLLSQD FHEVKSKR++RKE K+T
Sbjct  24   KKVVQNLKEIVNNSCTDWEIYAVLRDCNMDPSDAVQRLLSQDTFHEVKSKRERRKEMKET  83

Query  404  TEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAY-----------KEN------GY  532
             E + R  S +            R GSE   G+S               KEN       Y
Sbjct  84   QEQKTRANSRASSRGV-------RDGSEHSFGQSRSMLISNELGKAACKKENVSVSYIPY  136

Query  533  TNTKSTRTAGSTTNRWLPTISDAAGTENQKLV----DGVSAATQHSSGYQSAWVGVPGQ-  697
            + +      G T N       ++   + ++      D + ++ Q S G  S+WVG   Q 
Sbjct  137  SASSKLCAMGQTWNEQPSPQRNSFNADYRRQSIGTGDMIDSSMQPSYGSHSSWVGSTLQH  196

Query  698  VSMADIVKMGKPHGK  742
            V+MADIVKMG+P  K
Sbjct  197  VAMADIVKMGRPKSK  211



>ref|XP_004961106.1| PREDICTED: uncharacterized protein LOC101764022 isoform X1 [Setaria 
italica]
Length=794

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 97/179 (54%), Gaps = 7/179 (4%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+ SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRDK+KE
Sbjct  25   IPTASRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDKKKE  84

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGST-  568
             K + ESRPR           A   + R G     G S    K+    +     +A    
Sbjct  85   TKASQESRPRSFQKPMNRGYKAG--SDRSGRADSMGVSKGPIKKEPELHAPLNSSALDVR  142

Query  569  TNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
            T+    TIS    T N    D  +  TQ  S  Q  W G+PG+ S+A+IVKMG+P  K+
Sbjct  143  TSNPTETIS---ATGNVAQADAKNT-TQPPSQVQHGWGGIPGRPSLAEIVKMGRPQAKS  197



>ref|XP_010230981.1| PREDICTED: uncharacterized protein LOC100825596 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 95/191 (50%), Gaps = 24/191 (13%)
 Frame = +2

Query  212  IPSGSRKIVESLK-EIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            IP  SRK+V+ LK +     P  +IYA L +C MDP+ AV RL+SQDPFHEV+ KR+ +K
Sbjct  31   IPPASRKLVQGLKGDPWPTAPRPKIYATLLDCGMDPDVAVERLISQDPFHEVRRKRNNKK  90

Query  389  ENKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGST  568
            E K   E+R R    S              GS+++  +S  +Y   G  +T S +     
Sbjct  91   EVKAPQEARSRPFYKSTYR-----------GSKAVSDRSGRSYSGLGADSTGSVKGTSKK  139

Query  569  TNRWLP----TISDAAGTENQ--------KLVDGVSAATQHSSGYQSAWVGVPGQVSMAD  712
                +P    + SD+    N          L D   +  Q  S  Q  W GVPG+ SMAD
Sbjct  140  EAGLIPPENLSASDSVKASNPTETVSAAGNLADAKPSTFQPPSQAQHGWGGVPGRPSMAD  199

Query  713  IVKMGKPHGKA  745
            IVKMG+P  K+
Sbjct  200  IVKMGRPQAKS  210



>ref|XP_008647566.1| PREDICTED: uncharacterized protein LOC100273818 isoform X1 [Zea 
mays]
Length=828

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 92/190 (48%), Gaps = 30/190 (16%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP  SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRD++KE
Sbjct  26   IPVASRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDRKKE  85

Query  392  NKDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENGY-------------  532
             K   E                 +Y  R G +++  +S  A    G+             
Sbjct  86   TKVNHE----------TRPRPFQKYTYR-GYKAVSDRSGRADPTGGFKGPVKKEPEMQAP  134

Query  533  TNTKSTRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMAD  712
             N+ +     S T          + T N    D  +  +Q  S  Q  W G+PG+ SMA+
Sbjct  135  LNSSALDVKTSDTTEIF------SATINVAQTDAKNTTSQPLSKVQHGWGGIPGRPSMAE  188

Query  713  IVKMGKPHGK  742
            IVKMG+P  K
Sbjct  189  IVKMGRPQAK  198



>ref|XP_003567822.1| PREDICTED: uncharacterized protein LOC100825596 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 93/186 (50%), Gaps = 15/186 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLK-EIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            IP  SRK+V+ LK +     P  +IYA L +C MDP+ AV RL+SQDPFHEV+ KR+ +K
Sbjct  31   IPPASRKLVQGLKGDPWPTAPRPKIYATLLDCGMDPDVAVERLISQDPFHEVRRKRNNKK  90

Query  389  ENKDTTEs------rprgasssrggkgsadrYAGRGGSE-SLHGKSTYAYKENGYTNTKS  547
            E K   E+      +     S      S   Y+G G S  S+ G S    KE G    ++
Sbjct  91   EVKAPQEARSRPFYKSTYRGSKAVSDRSGRSYSGLGDSTGSVKGTSK---KEAGLIPPEN  147

Query  548  TRTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMG  727
               + S           AAG     L D   +  Q  S  Q  W GVPG+ SMADIVKMG
Sbjct  148  LSASDSVKASNPTETVSAAG----NLADAKPSTFQPPSQAQHGWGGVPGRPSMADIVKMG  203

Query  728  KPHGKA  745
            +P  K+
Sbjct  204  RPQAKS  209



>dbj|BAJ94362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=845

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 97/184 (53%), Gaps = 15/184 (8%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP  SRK+V+ LK I+ +  E+EIYA L +C MDP+ AV RL+SQDPFHEV+ KR  +KE
Sbjct  34   IPHASRKLVQGLKGILADRTEAEIYATLLDCAMDPDVAVERLISQDPFHEVRRKRSNKKE  93

Query  392  NKDTTEsrprga-sssrggkgsadrYAGRGGSESLHGKSTYAY-----KENGYTNTKSTR  553
             K   E+R R     +  G        GRG S    G ST +      KE       +T 
Sbjct  94   VKAPQETRSRPFYKPAYRGSKVGSDRGGRGYSGP--GDSTASAKGPIKKETELLPPPNTS  151

Query  554  TAGSTT-NRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGK  730
            T  +   +  + TIS+A       L D  S + Q     Q  W GVPG+ S+A+IVKMG+
Sbjct  152  TPDAVKGSNPMETISEAG-----NLADAKSTSFQPPQ-VQHGWGGVPGRPSLAEIVKMGR  205

Query  731  PHGK  742
            P  K
Sbjct  206  PQAK  209



>ref|XP_001756751.1| predicted protein [Physcomitrella patens]
 gb|EDQ78348.1| predicted protein, partial [Physcomitrella patens]
Length=79

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 2/61 (3%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQ-DPFHEVKSKRDKRK  388
            IP+ ++K+V+ LKE+V N  E EIYA LKECNMDPNEA  RLL+Q DPFHEVK KRDK+K
Sbjct  13   IPASTKKVVQDLKEVVGN-SEEEIYAMLKECNMDPNEAAQRLLNQGDPFHEVKRKRDKKK  71

Query  389  E  391
            E
Sbjct  72   E  72



>ref|XP_007214926.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
 gb|EMJ16125.1| hypothetical protein PRUPE_ppa001246mg [Prunus persica]
Length=873

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKE  69

Query  392  NKDTTE  409
            N +  E
Sbjct  70   NLNNRE  75



>ref|XP_008229782.1| PREDICTED: putative GPI-anchored protein PB15E9.01c isoform X2 
[Prunus mume]
Length=874

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKE  69

Query  392  NKDTTE  409
            N +  E
Sbjct  70   NLNNRE  75



>ref|XP_008342251.1| PREDICTED: chitinase-like protein PB1E7.04c isoform X1 [Malus 
domestica]
Length=866

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+G RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNGVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  392  NKDTTE  409
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_008229781.1| PREDICTED: cell wall protein AWA1 isoform X1 [Prunus mume]
Length=875

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLFQDPFHEVKRKRDKRKE  69

Query  392  NKDTTE  409
            N +  E
Sbjct  70   NLNNRE  75



>ref|XP_008342252.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=865

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+G RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNGVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  392  NKDTTE  409
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_010323918.1| PREDICTED: melanoma-associated antigen C1 isoform X2 [Solanum 
lycopersicum]
Length=875

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  392  N  394
            N
Sbjct  75   N  75



>ref|XP_010323917.1| PREDICTED: melanoma-associated antigen C1 isoform X1 [Solanum 
lycopersicum]
Length=876

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  392  N  394
            N
Sbjct  75   N  75



>ref|XP_010323919.1| PREDICTED: melanoma-associated antigen C1 isoform X3 [Solanum 
lycopersicum]
Length=874

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  392  N  394
            N
Sbjct  75   N  75



>ref|XP_010323920.1| PREDICTED: melanoma-associated antigen C1 isoform X4 [Solanum 
lycopersicum]
Length=871

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  392  N  394
            N
Sbjct  75   N  75



>ref|XP_011467308.1| PREDICTED: endochitinase A isoform X1 [Fragaria vesca subsp. 
vesca]
Length=882

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  11   IPTSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  70

Query  392  NKDTTE  409
            N    E
Sbjct  71   NLSNRE  76



>ref|XP_011467310.1| PREDICTED: endochitinase A isoform X3 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  11   IPTSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  70

Query  392  NKDTTE  409
            N    E
Sbjct  71   NLSNRE  76



>ref|XP_011467309.1| PREDICTED: endochitinase A isoform X2 [Fragaria vesca subsp. 
vesca]
Length=881

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EIYA LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  11   IPTSVRKTIQDIKEITGNHSEEEIYAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  70

Query  392  NKDTTE  409
            N    E
Sbjct  71   NLSNRE  76



>ref|XP_006357673.1| PREDICTED: flocculation protein FLO11-like isoform X3 [Solanum 
tuberosum]
Length=875

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  392  N  394
            N
Sbjct  75   N  75



>ref|XP_006357672.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Solanum 
tuberosum]
Length=876

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  392  N  394
            N
Sbjct  75   N  75



>ref|XP_006357671.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Solanum 
tuberosum]
Length=877

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPSG RK ++++KEI  N+ E EIYA LKEC+MDPNE   +LLSQD FHEVKSKRD+RKE
Sbjct  15   IPSGMRKTIQNIKEITGNHGEDEIYAMLKECSMDPNETTQKLLSQDTFHEVKSKRDRRKE  74

Query  392  N  394
            N
Sbjct  75   N  75



>ref|XP_006447832.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
 ref|XP_006469425.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform 
X2 [Citrus sinensis]
 gb|ESR61072.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
Length=886

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  +K+++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPFHEVK KRDKRKE
Sbjct  18   IPNNMKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKE  77

Query  392  NKDTTE  409
            N +  E
Sbjct  78   NVNNRE  83



>ref|XP_006447831.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
 ref|XP_006469424.1| PREDICTED: hyphally regulated cell wall protein 3-like isoform 
X1 [Citrus sinensis]
 gb|ESR61071.1| hypothetical protein CICLE_v10014215mg [Citrus clementina]
Length=887

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  +K+++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPFHEVK KRDKRKE
Sbjct  18   IPNNMKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKE  77

Query  392  NKDTTE  409
            N +  E
Sbjct  78   NVNNRE  83



>gb|KDO50974.1| hypothetical protein CISIN_1g006896mg [Citrus sinensis]
Length=627

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  +K+++++KEI  N+ E EIYA LKEC+MDPNE   RLL QDPFHEVK KRDKRKE
Sbjct  18   IPNNMKKMIQNIKEITGNHSEDEIYAMLKECSMDPNETAQRLLFQDPFHEVKRKRDKRKE  77

Query  392  NKDTTE  409
            N +  E
Sbjct  78   NVNNRE  83



>gb|AFW81250.1| putative DUF1296 domain containing family protein [Zea mays]
Length=787

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 94/174 (54%), Gaps = 11/174 (6%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRDK+KE K  
Sbjct  28   SRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDKKKETKVN  87

Query  404  TEsrprgasssr-ggkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGSTTNRW  580
             E+RPR    S  GG  +    +GRGG     G +    + +   N+ +     S T+  
Sbjct  88   QETRPRPFQKSIYGGYKAGSDRSGRGG---FKGPAKKEPELHASINSSALDVNTSATSET  144

Query  581  LPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGK  742
                 + A  + +          Q  S  +  W GVPG+ SMA+IVKMG+P  K
Sbjct  145  FSATGNVAQADAKNTF-------QPPSQVKHGWGGVPGRPSMAEIVKMGRPQAK  191



>gb|AFW81251.1| putative DUF1296 domain containing family protein [Zea mays]
Length=847

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 93/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRDK+KE K  
Sbjct  28   SRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDKKKETKVN  87

Query  404  TEsrprgasssrg-gkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGSTTNRW  580
             E+RPR    S   G  +    +GRGG     G +    + +   N+ +     S T+  
Sbjct  88   QETRPRPFQKSIYGGYKAGSDRSGRGG---FKGPAKKEPELHASINSSALDVNTSATSET  144

Query  581  LPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKA  745
                 + A  + +          Q  S  +  W GVPG+ SMA+IVKMG+P  K 
Sbjct  145  FSATGNVAQADAKNTF-------QPPSQVKHGWGGVPGRPSMAEIVKMGRPQAKV  192



>ref|XP_008654852.1| PREDICTED: uncharacterized protein LOC100280182 isoform X2 [Zea 
mays]
Length=823

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 93/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRDK+KE K  
Sbjct  28   SRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDKKKETKVN  87

Query  404  TEsrprgasssrg-gkgsadrYAGRGGSESLHGKSTYAYKENGYTNTKSTRTAGSTTNRW  580
             E+RPR    S   G  +    +GRGG     G +    + +   N+ +     S T+  
Sbjct  88   QETRPRPFQKSIYGGYKAGSDRSGRGG---FKGPAKKEPELHASINSSALDVNTSATSET  144

Query  581  LPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGK  742
                 + A  + +          Q  S  +  W GVPG+ SMA+IVKMG+P  K
Sbjct  145  FSATGNVAQADAKNTF-------QPPSQVKHGWGGVPGRPSMAEIVKMGRPQAK  191



>ref|XP_009785963.1| PREDICTED: uncharacterized protein LOC104234138 isoform X3 [Nicotiana 
sylvestris]
Length=780

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 67/103 (65%), Gaps = 10/103 (10%)
 Frame = +2

Query  464  YAGRGGSESLHGKSTYAYK-ENG-YT-NTKSTR-TAGSTTNRWLPTISDAAGTENQK---  622
            Y GRGGSE    K T  YK ENG YT N  ST   +GS  +R   TISDAA  E ++   
Sbjct  39   YVGRGGSEPT--KPTPGYKKENGSYTSNLASTPGVSGSNISRRAATISDAAANETKRPAS  96

Query  623  -LVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKPHGKAP  748
              VDGVS+ +QHSSGYQ  W GVPGQVSMADIVKMGKP  K P
Sbjct  97   AAVDGVSSVSQHSSGYQHTWGGVPGQVSMADIVKMGKPQSKVP  139



>ref|XP_007217053.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
 gb|EMJ18252.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
Length=883

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A +  G +K+V+SLKEIV N PE EIY+ LK+CNMDPNEAV RLLS D FHEVKSKR++R
Sbjct  11   APLSPGMKKMVQSLKEIV-NCPEPEIYSVLKDCNMDPNEAVQRLLSLDTFHEVKSKRERR  69

Query  386  KENKDTTE  409
            KE K+T +
Sbjct  70   KEMKETQD  77



>emb|CDX78828.1| BnaA01g08950D [Brassica napus]
Length=698

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            +P+ SRK+VESLKEIV N  + EIYA L +C+MDP+E V+RLLSQD FHEVKSKRDK+KE
Sbjct  19   VPASSRKVVESLKEIV-NCSDLEIYAMLVDCDMDPDETVSRLLSQDTFHEVKSKRDKKKE  77

Query  392  NKDTTE  409
             KD  E
Sbjct  78   TKDPAE  83



>ref|XP_008342489.1| PREDICTED: uncharacterized protein LOC103405294 [Malus domestica]
Length=843

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A  P  +RKI++SLKEIV N PE EIY+ LKEC+MDP++AV RLLS D FHEVKSKR++R
Sbjct  14   AQFPPTTRKIIQSLKEIV-NCPEPEIYSVLKECSMDPSDAVQRLLSLDTFHEVKSKRERR  72

Query  386  KENKDTTE  409
            KE K+T +
Sbjct  73   KEIKETQD  80



>ref|XP_008362365.1| PREDICTED: uncharacterized protein LOC103426056 [Malus domestica]
Length=843

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A  P  +RKI++SLKEIV N PE EIY+ LKEC+MDP++AV RLLS D FHEVKSKR++R
Sbjct  14   AQFPPTTRKIIQSLKEIV-NCPEPEIYSVLKECSMDPSDAVQRLLSLDTFHEVKSKRERR  72

Query  386  KENKDTTE  409
            KE K+T +
Sbjct  73   KEIKETQD  80



>ref|XP_011026252.1| PREDICTED: uncharacterized protein LOC105126918 isoform X3 [Populus 
euphratica]
Length=829

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 108/197 (55%), Gaps = 24/197 (12%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRD  379
            V  IP  S+K+V+++KEIV +N  ++EIY+ L   NMD + AV  LL+QDPFH+VKSKR+
Sbjct  11   VMQIPGASKKVVQNIKEIVNKNCTDAEIYSVLCHFNMDADAAVQNLLNQDPFHQVKSKRE  70

Query  380  KRKENKDTTEsrprgasssrggkgsadrYAGRGG------SESLHGKSTYAYKENGYTNT  541
            +RKE K+T ES  RG ++   G  +   Y  + G      S++  GK+ Y  KENG    
Sbjct  71   RRKEMKETQESMARGNNNGYHGVKAGGEY--KFGLVPCQISDNDLGKAAYR-KENGSV--  125

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLVDGV---------SAATQHSSGYQSAWV-GVP  691
                   S+T  +   + +   + N    + V         +  T  SSG Q+AW  G  
Sbjct  126  --AHPGPSSTLIYRVKLKNEQPSSNNDSCNPVDSRQTKATGTGDTILSSGTQAAWSGGTT  183

Query  692  GQVSMADIVKMGKPHGK  742
            G +SMADIV+MG+P  K
Sbjct  184  GHISMADIVRMGRPRSK  200



>ref|XP_011026251.1| PREDICTED: uncharacterized protein LOC105126918 isoform X2 [Populus 
euphratica]
Length=862

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 108/197 (55%), Gaps = 24/197 (12%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRD  379
            V  IP  S+K+V+++KEIV +N  ++EIY+ L   NMD + AV  LL+QDPFH+VKSKR+
Sbjct  11   VMQIPGASKKVVQNIKEIVNKNCTDAEIYSVLCHFNMDADAAVQNLLNQDPFHQVKSKRE  70

Query  380  KRKENKDTTEsrprgasssrggkgsadrYAGRGG------SESLHGKSTYAYKENGYTNT  541
            +RKE K+T ES  RG ++   G  +   Y  + G      S++  GK+ Y  KENG    
Sbjct  71   RRKEMKETQESMARGNNNGYHGVKAGGEY--KFGLVPCQISDNDLGKAAYR-KENGSV--  125

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLVDGV---------SAATQHSSGYQSAWV-GVP  691
                   S+T  +   + +   + N    + V         +  T  SSG Q+AW  G  
Sbjct  126  --AHPGPSSTLIYRVKLKNEQPSSNNDSCNPVDSRQTKATGTGDTILSSGTQAAWSGGTT  183

Query  692  GQVSMADIVKMGKPHGK  742
            G +SMADIV+MG+P  K
Sbjct  184  GHISMADIVRMGRPRSK  200



>ref|XP_011026250.1| PREDICTED: uncharacterized protein LOC105126918 isoform X1 [Populus 
euphratica]
Length=864

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 108/197 (55%), Gaps = 24/197 (12%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRD  379
            V  IP  S+K+V+++KEIV +N  ++EIY+ L   NMD + AV  LL+QDPFH+VKSKR+
Sbjct  11   VMQIPGASKKVVQNIKEIVNKNCTDAEIYSVLCHFNMDADAAVQNLLNQDPFHQVKSKRE  70

Query  380  KRKENKDTTEsrprgasssrggkgsadrYAGRGG------SESLHGKSTYAYKENGYTNT  541
            +RKE K+T ES  RG ++   G  +   Y  + G      S++  GK+ Y  KENG    
Sbjct  71   RRKEMKETQESMARGNNNGYHGVKAGGEY--KFGLVPCQISDNDLGKAAYR-KENGSV--  125

Query  542  KSTRTAGSTTNRWLPTISDAAGTENQKLVDGV---------SAATQHSSGYQSAWV-GVP  691
                   S+T  +   + +   + N    + V         +  T  SSG Q+AW  G  
Sbjct  126  --AHPGPSSTLIYRVKLKNEQPSSNNDSCNPVDSRQTKATGTGDTILSSGTQAAWSGGTT  183

Query  692  GQVSMADIVKMGKPHGK  742
            G +SMADIV+MG+P  K
Sbjct  184  GHISMADIVRMGRPRSK  200



>ref|XP_002320531.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa]
 gb|EEE98846.2| hypothetical protein POPTR_0014s16780g [Populus trichocarpa]
Length=886

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPS +RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LLSQDPFHEVK KRD++KE
Sbjct  10   IPSNARKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRKRDRKKE  69

Query  392  NKDTTE  409
            N    E
Sbjct  70   NAHNRE  75



>ref|XP_006654800.1| PREDICTED: uncharacterized protein LOC102700994 [Oryza brachyantha]
Length=815

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 82/148 (55%), Gaps = 12/148 (8%)
 Frame = +2

Query  308  MDPNEAVNRLLSQDPFHEVKSKRDKRKENKDTTEsrprgasssrggkgsadrYAGRGGSE  487
            MDP+EAV+RLLSQD F EVKSKRDK+KE K+  E R R  S++            RGG++
Sbjct  1    MDPDEAVSRLLSQDTFQEVKSKRDKKKEVKEIPEPRSRATSNAASRGV-------RGGTD  53

Query  488  SLHGKSTYAYKENGYTNTKSTRTAGSTTNRWLPTISDA--AGTENQKLV-DGVSAATQHS  658
               G    ++  +   N  S   +G       PT      + + N+ +V DG S   Q S
Sbjct  54   --RGGRNSSFHSSSIDNVASRSISGPGMTSINPTQKQTVPSSSVNKSVVADGPSVPPQSS  111

Query  659  SGYQSAWVGVPGQVSMADIVKMGKPHGK  742
            SG+Q  W G PGQ+SMADIVKMG+P  K
Sbjct  112  SGFQHGWSGTPGQLSMADIVKMGRPQAK  139



>ref|XP_011008079.1| PREDICTED: flocculation protein FLO11 [Populus euphratica]
Length=886

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IPS +RK ++++KEI  N+ + EIYA LKEC+MDPNE   +LLSQDPFHEVK KRD++KE
Sbjct  10   IPSNARKTIQNIKEIAGNHSDEEIYAMLKECSMDPNETAQKLLSQDPFHEVKRKRDRKKE  69

Query  392  NKDTTE  409
            N    E
Sbjct  70   NAHNRE  75



>ref|XP_006857739.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
 gb|ERN19206.1| hypothetical protein AMTR_s00061p00187940 [Amborella trichopoda]
Length=909

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  206  AMIPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKR  385
            A IPS  RK+++++KEI  N+ + EIYA LKECNMDPNE   +LL QD FHEV+ KRDKR
Sbjct  11   ASIPSSVRKMIQNIKEIAGNHHDDEIYAMLKECNMDPNETTQKLLLQDTFHEVRRKRDKR  70

Query  386  KENKDTTE  409
            KEN + T+
Sbjct  71   KENLNNTD  78



>ref|XP_009361529.1| PREDICTED: uncharacterized protein LOC103951798 isoform X1 [Pyrus 
x bretschneideri]
Length=861

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  392  NKDTTE  409
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_009361530.1| PREDICTED: mucin-12 isoform X2 [Pyrus x bretschneideri]
Length=860

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKE  391
            IP+  RK ++ +KEI  N+ E EI+A LKECNMDPNE   +LL QDPFHEVK KRDKRKE
Sbjct  10   IPNSVRKTIQDIKEITGNHSEEEIHAMLKECNMDPNETAQKLLLQDPFHEVKRKRDKRKE  69

Query  392  NKDTTE  409
            N +  E
Sbjct  70   NLNNKE  75



>ref|XP_002300878.1| hypothetical protein POPTR_0002s06020g [Populus trichocarpa]
 gb|EEE80151.1| hypothetical protein POPTR_0002s06020g [Populus trichocarpa]
Length=908

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 112/201 (56%), Gaps = 22/201 (11%)
 Frame = +2

Query  203  VAMIPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRD  379
            V  IP  S+K+V+++KEIV +N  ++EIY+ L + NMD + AV  LL+QDPFH+VKSKR+
Sbjct  11   VMQIPGASKKVVQNIKEIVNKNCTDAEIYSVLCDFNMDADAAVQNLLNQDPFHQVKSKRE  70

Query  380  KRKE-----NKDTTEsrprgasssrggkgsadrY----AGRGGSESLHGKSTYAYKENG-  529
            +RKE      K+T ES  RG+++   G  +   Y         S++  GK+ Y  KENG 
Sbjct  71   RRKEIAFLQMKETQESMARGSNNGYHGVKAGGEYNFGLVPCQISDNDLGKAAYR-KENGS  129

Query  530  --YTNTKST-------RTAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWV  682
              +    ST       +    ++N       D+  T+     D + ++ Q SSG Q+AW 
Sbjct  130  VAHPGPSSTLIYRVKLKNEQPSSNNDSCNPDDSRQTKATGTGDTILSSAQLSSGTQAAWS  189

Query  683  G-VPGQVSMADIVKMGKPHGK  742
            G   G VSMADIV+MG+P  K
Sbjct  190  GGTTGHVSMADIVRMGRPRSK  210



>ref|XP_008654854.1| PREDICTED: uncharacterized protein LOC100280182 isoform X4 [Zea 
mays]
Length=791

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 92/183 (50%), Gaps = 25/183 (14%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRDK+KE K  
Sbjct  28   SRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDKKKETKVN  87

Query  404  TEsrprgasssrggkgsadrYAG-RGGSE------SLHGKSTYAYKE---NGYTNTKSTR  553
             E        +R        Y G + GS+      S+ G    A KE   +   N+ +  
Sbjct  88   QE--------TRPRPFQKSIYGGYKAGSDRSGRANSIGGFKGPAKKEPELHASINSSALD  139

Query  554  TAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKP  733
               S T+       + A  + +          Q  S  +  W GVPG+ SMA+IVKMG+P
Sbjct  140  VNTSATSETFSATGNVAQADAKNTF-------QPPSQVKHGWGGVPGRPSMAEIVKMGRP  192

Query  734  HGK  742
              K
Sbjct  193  QAK  195



>ref|XP_010464402.1| PREDICTED: uncharacterized protein LOC104744960 isoform X1 [Camelina 
sativa]
 ref|XP_010464403.1| PREDICTED: uncharacterized protein LOC104744960 isoform X2 [Camelina 
sativa]
Length=840

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIVR-NYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            IP+ +RK+++++KE    NY E EI+A L ECNMDP+E   RLL QDPFHEVK KRDKRK
Sbjct  10   IPASTRKMIQNIKETTAGNYSEDEIHAMLHECNMDPDETAQRLLLQDPFHEVKKKRDKRK  69

Query  389  EN---KDTTEsrprgasssrggkgsadrYAGRGGSESLHGKSTYAYKENG  529
            EN   KD+ ES  R   + RG +     ++ R  S  + G      KENG
Sbjct  70   ENINSKDSAESPWRSGGAGRGSRAGRGNFSSRHASHDVAGAKNSFRKENG  119



>gb|KDO60962.1| hypothetical protein CISIN_1g0031901mg, partial [Citrus sinensis]
 gb|KDO60963.1| hypothetical protein CISIN_1g0031901mg, partial [Citrus sinensis]
 gb|KDO60964.1| hypothetical protein CISIN_1g0031901mg, partial [Citrus sinensis]
Length=81

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = +2

Query  212  IPSGSRKIVESLKEIV-RNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRK  388
            IP+ ++KIV++LKE + +N  +SEIYA L ECNMDPN+A  RLLSQD F EVKSKR++RK
Sbjct  21   IPAAAKKIVQNLKETLNKNCTDSEIYAVLVECNMDPNDAFQRLLSQDAFKEVKSKRERRK  80

Query  389  E  391
            E
Sbjct  81   E  81



>ref|XP_008654853.1| PREDICTED: uncharacterized protein LOC100280182 isoform X3 [Zea 
mays]
Length=792

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 92/183 (50%), Gaps = 25/183 (14%)
 Frame = +2

Query  224  SRKIVESLKEIVRNYPESEIYAALKECNMDPNEAVNRLLSQDPFHEVKSKRDKRKENKDT  403
            SRK+V+SLK I+ +  E EIYA L +C MDP+ AV RL+SQD FHEV+ KRDK+KE K  
Sbjct  28   SRKMVQSLKGILADRSEGEIYATLCDCGMDPDIAVERLISQDTFHEVRRKRDKKKETKVN  87

Query  404  TEsrprgasssrggkgsadrYAG-RGGSE------SLHGKSTYAYKE---NGYTNTKSTR  553
             E        +R        Y G + GS+      S+ G    A KE   +   N+ +  
Sbjct  88   QE--------TRPRPFQKSIYGGYKAGSDRSGRANSIGGFKGPAKKEPELHASINSSALD  139

Query  554  TAGSTTNRWLPTISDAAGTENQKLVDGVSAATQHSSGYQSAWVGVPGQVSMADIVKMGKP  733
               S T+       + A  + +          Q  S  +  W GVPG+ SMA+IVKMG+P
Sbjct  140  VNTSATSETFSATGNVAQADAKNTF-------QPPSQVKHGWGGVPGRPSMAEIVKMGRP  192

Query  734  HGK  742
              K
Sbjct  193  QAK  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840