BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043G14

Length=790
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               311   4e-99   Solanum tuberosum [potatoes]
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          309   3e-98   Solanum lycopersicum
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    308   1e-97   Solanum tuberosum [potatoes]
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          305   7e-97   Nicotiana tomentosiformis
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          305   1e-96   Nicotiana sylvestris
gb|ABC69422.1|  CYP72A58                                                304   2e-96   Nicotiana tabacum [American tobacco]
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               300   9e-95   Solanum tuberosum [potatoes]
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          299   2e-94   Nicotiana tomentosiformis
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      298   5e-94   Solanum tuberosum [potatoes]
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    296   2e-93   Nicotiana sylvestris
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    296   2e-93   Nicotiana sylvestris
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          295   8e-93   
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      295   8e-93   Solanum tuberosum [potatoes]
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               294   2e-92   Solanum tuberosum [potatoes]
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    294   2e-92   Solanum lycopersicum
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          291   2e-92   Nicotiana sylvestris
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               291   2e-91   Solanum lycopersicum
gb|ABC69393.1|  CYP72A55v2                                              289   1e-90   Nicotiana tabacum [American tobacco]
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          289   1e-90   Nicotiana tomentosiformis
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          289   2e-90   Sesamum indicum [beniseed]
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   5e-90   Nicotiana tomentosiformis
emb|CDP19599.1|  unnamed protein product                                287   9e-90   Coffea canephora [robusta coffee]
emb|CDP15981.1|  unnamed protein product                                287   9e-90   Coffea canephora [robusta coffee]
gb|ABC69392.1|  CYP72A55v1                                              286   2e-89   Nicotiana tabacum [American tobacco]
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          286   3e-89   Solanum lycopersicum
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          285   4e-89   Nicotiana sylvestris
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               283   2e-88   Vitis vinifera
emb|CDP15982.1|  unnamed protein product                                283   2e-88   Coffea canephora [robusta coffee]
emb|CBI22134.3|  unnamed protein product                                283   2e-88   Vitis vinifera
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      281   2e-87   Solanum tuberosum [potatoes]
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          281   2e-87   Vitis vinifera
emb|CDP19609.1|  unnamed protein product                                280   3e-87   Coffea canephora [robusta coffee]
gb|EYU43426.1|  hypothetical protein MIMGU_mgv1a018638mg                274   1e-86   Erythranthe guttata [common monkey flower]
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               278   2e-86   Solanum tuberosum [potatoes]
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          277   4e-86   Vitis vinifera
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             277   5e-86   
emb|CBI22139.3|  unnamed protein product                                274   7e-86   Vitis vinifera
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          276   1e-85   Solanum lycopersicum
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          276   2e-85   Prunus mume [ume]
emb|CDP15988.1|  unnamed protein product                                275   2e-85   Coffea canephora [robusta coffee]
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                     275   2e-85   Sesamum indicum [beniseed]
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          275   3e-85   Vitis vinifera
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          275   3e-85   Solanum lycopersicum
emb|CDP15983.1|  unnamed protein product                                275   3e-85   Coffea canephora [robusta coffee]
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    275   4e-85   Solanum tuberosum [potatoes]
emb|CAN72247.1|  hypothetical protein VITISV_024665                     267   8e-85   Vitis vinifera
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               274   8e-85   Cicer arietinum [garbanzo]
emb|CAN72443.1|  hypothetical protein VITISV_032856                     265   9e-85   Vitis vinifera
dbj|BAF98466.1|  cytochrome P450                                        274   1e-84   Coptis japonica var. dissecta
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          274   1e-84   Vitis vinifera
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                273   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_004295683.1|  PREDICTED: cytochrome P450 CYP72A219-like          273   2e-84   Fragaria vesca subsp. vesca
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          273   2e-84   Sesamum indicum [beniseed]
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               273   2e-84   
gb|KEH38478.1|  cytochrome P450 family 72 protein                       273   2e-84   Medicago truncatula
emb|CBI39916.3|  unnamed protein product                                273   2e-84   Vitis vinifera
emb|CBI22133.3|  unnamed protein product                                276   2e-84   Vitis vinifera
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               273   3e-84   Vitis vinifera
ref|XP_010645072.1|  PREDICTED: cytochrome P450 CYP72A219-like          268   8e-84   Vitis vinifera
emb|CDP19607.1|  unnamed protein product                                270   1e-83   Coffea canephora [robusta coffee]
emb|CDP15975.1|  unnamed protein product                                271   1e-83   Coffea canephora [robusta coffee]
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    271   2e-83   Glycine max [soybeans]
emb|CDP15976.1|  unnamed protein product                                271   2e-83   Coffea canephora [robusta coffee]
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               270   2e-83   Vitis vinifera
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    270   3e-83   Vitis vinifera
emb|CDP15985.1|  unnamed protein product                                270   3e-83   Coffea canephora [robusta coffee]
emb|CBI22131.3|  unnamed protein product                                268   5e-83   Vitis vinifera
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          269   7e-83   Prunus mume [ume]
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      269   1e-82   Glycine max [soybeans]
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          268   1e-82   Nicotiana sylvestris
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    268   1e-82   Vitis vinifera
gb|EYU31631.1|  hypothetical protein MIMGU_mgv1a004628mg                264   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               268   2e-82   Solanum tuberosum [potatoes]
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          268   2e-82   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          268   2e-82   Glycyrrhiza uralensis [Chinese licorice]
gb|ABC69419.1|  CYP72A56                                                268   3e-82   Nicotiana tabacum [American tobacco]
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          268   3e-82   Nicotiana tomentosiformis
gb|ABC69390.1|  CYP72A53v1                                              267   3e-82   Nicotiana tabacum [American tobacco]
emb|CDP19600.1|  unnamed protein product                                267   3e-82   Coffea canephora [robusta coffee]
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          267   3e-82   Pyrus x bretschneideri [bai li]
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          267   3e-82   
emb|CDP19601.1|  unnamed protein product                                267   4e-82   Coffea canephora [robusta coffee]
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               267   4e-82   Solanum lycopersicum
emb|CBI39884.3|  unnamed protein product                                265   5e-82   Vitis vinifera
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               266   6e-82   Vitis vinifera
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   7e-82   Nicotiana tomentosiformis
gb|AJD25172.1|  cytochrome P450 CYP72A331                               266   8e-82   Salvia miltiorrhiza [Chinese salvia]
gb|KHN44056.1|  Secologanin synthase                                    266   9e-82   Glycine soja [wild soybean]
emb|CBI22129.3|  unnamed protein product                                264   9e-82   Vitis vinifera
emb|CDP15986.1|  unnamed protein product                                265   9e-82   Coffea canephora [robusta coffee]
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   1e-81   Vitis vinifera
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   1e-81   
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   1e-81   Nicotiana tomentosiformis
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   1e-81   Solanum lycopersicum
ref|XP_006598136.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    262   1e-81   
emb|CDX97593.1|  BnaA05g24860D                                          266   1e-81   
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             265   2e-81   
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          265   2e-81   Pyrus x bretschneideri [bai li]
gb|ABC69389.1|  CYP72A52v1                                              265   2e-81   Nicotiana tabacum [American tobacco]
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    265   2e-81   
ref|XP_004294188.2|  PREDICTED: cytochrome P450 72A15-like              266   2e-81   Fragaria vesca subsp. vesca
gb|KEH38473.1|  cytochrome P450 family 72 protein                       262   4e-81   Medicago truncatula
gb|KEH38475.1|  cytochrome P450 family 72 protein                       265   4e-81   Medicago truncatula
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               265   5e-81   Citrus sinensis [apfelsine]
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    264   5e-81   Nicotiana tomentosiformis
ref|XP_004294187.1|  PREDICTED: cytochrome P450 CYP72A219-like          265   5e-81   Fragaria vesca subsp. vesca
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               264   6e-81   Solanum tuberosum [potatoes]
gb|KJB12900.1|  hypothetical protein B456_002G043400                    260   7e-81   Gossypium raimondii
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                264   7e-81   Erythranthe guttata [common monkey flower]
emb|CDP15978.1|  unnamed protein product                                263   1e-80   Coffea canephora [robusta coffee]
gb|AHK60841.1|  CYP72A225                                               264   1e-80   Catharanthus roseus [chatas]
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    263   1e-80   Prunus mume [ume]
ref|XP_004151605.1|  PREDICTED: secologanin synthase-like               258   1e-80   
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    263   1e-80   Solanum lycopersicum
ref|XP_010092742.1|  Secologanin synthase                               263   2e-80   Morus notabilis
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               263   2e-80   Vitis vinifera
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   2e-80   Nicotiana sylvestris
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          263   2e-80   Sesamum indicum [beniseed]
ref|XP_010327256.1|  PREDICTED: cytochrome P450 CYP72A219-like          259   2e-80   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    263   2e-80   Glycine max [soybeans]
emb|CDP15973.1|  unnamed protein product                                263   2e-80   Coffea canephora [robusta coffee]
ref|XP_006477947.1|  PREDICTED: secologanin synthase-like               254   2e-80   
gb|KHN44057.1|  Secologanin synthase                                    263   3e-80   Glycine soja [wild soybean]
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    262   3e-80   Prunus mume [ume]
emb|CBI39886.3|  unnamed protein product                                263   4e-80   Vitis vinifera
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          262   5e-80   Solanum lycopersicum
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               261   8e-80   Solanum tuberosum [potatoes]
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    261   8e-80   Prunus mume [ume]
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    261   8e-80   Prunus mume [ume]
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   9e-80   Nicotiana sylvestris
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   1e-79   Solanum lycopersicum
gb|KJB12898.1|  hypothetical protein B456_002G043200                    261   1e-79   Gossypium raimondii
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              261   1e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011469476.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    256   2e-79   Fragaria vesca subsp. vesca
ref|XP_011469477.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    256   2e-79   Fragaria vesca subsp. vesca
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          260   2e-79   Solanum lycopersicum
emb|CAN67740.1|  hypothetical protein VITISV_015554                     260   2e-79   Vitis vinifera
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               260   2e-79   Solanum tuberosum [potatoes]
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          260   3e-79   Pyrus x bretschneideri [bai li]
gb|ABC69417.1|  CYP72A54                                                259   4e-79   Nicotiana tabacum [American tobacco]
ref|XP_006377672.1|  hypothetical protein POPTR_0011s101202g            256   4e-79   
ref|XP_010327096.1|  PREDICTED: cytochrome P450 CYP72A219-like          251   4e-79   
ref|XP_006442294.1|  hypothetical protein CICLE_v10024650mg             251   4e-79   
gb|KJB12901.1|  hypothetical protein B456_002G043400                    259   6e-79   Gossypium raimondii
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          259   6e-79   Malus domestica [apple tree]
gb|KHG14489.1|  Secologanin synthase                                    259   7e-79   Gossypium arboreum [tree cotton]
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          258   1e-78   Solanum lycopersicum
ref|XP_007022096.1|  Cytochrome P450, family 72, subfamily A, pol...    257   1e-78   
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    258   1e-78   Panax ginseng [Asiatic ginseng]
gb|KHN36820.1|  Secologanin synthase                                    257   1e-78   Glycine soja [wild soybean]
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          258   1e-78   Sesamum indicum [beniseed]
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          258   1e-78   Artemisia annua [sweet Annie]
emb|CDY32348.1|  BnaC01g36670D                                          258   2e-78   Brassica napus [oilseed rape]
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               258   2e-78   Solanum tuberosum [potatoes]
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              258   2e-78   Camelina sativa [gold-of-pleasure]
gb|AJD25170.1|  cytochrome P450 CYP72A329                               258   2e-78   Salvia miltiorrhiza [Chinese salvia]
gb|KEH28455.1|  cytochrome P450 family 72 protein                       254   2e-78   Medicago truncatula
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    257   2e-78   
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      265   3e-78   
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          257   3e-78   Sesamum indicum [beniseed]
gb|AJD25169.1|  cytochrome P450 CYP72A328                               257   3e-78   Salvia miltiorrhiza [Chinese salvia]
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                257   3e-78   Erythranthe guttata [common monkey flower]
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    257   3e-78   
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               257   4e-78   
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    257   4e-78   
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               256   5e-78   Citrus sinensis [apfelsine]
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                   255   6e-78   Citrus sinensis [apfelsine]
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               256   7e-78   Solanum lycopersicum
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             256   7e-78   Phaseolus vulgaris [French bean]
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          256   1e-77   Nicotiana tomentosiformis
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                256   1e-77   Erythranthe guttata [common monkey flower]
gb|KHN14193.1|  Secologanin synthase                                    256   1e-77   Glycine soja [wild soybean]
ref|XP_011460847.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    256   1e-77   Fragaria vesca subsp. vesca
ref|XP_009411224.1|  PREDICTED: cytochrome P450 72A15-like              251   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      255   1e-77   Citrus sinensis [apfelsine]
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      255   1e-77   Citrus sinensis [apfelsine]
gb|KJB12905.1|  hypothetical protein B456_002G043600                    251   1e-77   Gossypium raimondii
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          255   2e-77   Nicotiana sylvestris
emb|CDX98486.1|  BnaC05g38890D                                          255   2e-77   
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             255   2e-77   Medicago truncatula
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    256   2e-77   Populus euphratica
gb|KJB26994.1|  hypothetical protein B456_004G270700                    255   2e-77   Gossypium raimondii
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             255   2e-77   Phaseolus vulgaris [French bean]
gb|AJD25171.1|  cytochrome P450 CYP72A330                               255   2e-77   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             254   3e-77   
ref|XP_002882888.1|  CYP72A15                                           254   3e-77   
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               254   3e-77   Solanum tuberosum [potatoes]
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             254   3e-77   Eutrema salsugineum [saltwater cress]
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          254   3e-77   Solanum lycopersicum
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          254   4e-77   Solanum lycopersicum
ref|XP_004307203.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    255   4e-77   Fragaria vesca subsp. vesca
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               254   4e-77   
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          254   4e-77   
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              254   4e-77   Brassica rapa
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               254   4e-77   Solanum tuberosum [potatoes]
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          254   5e-77   Cucumis melo [Oriental melon]
emb|CDY20078.1|  BnaA01g29240D                                          253   6e-77   Brassica napus [oilseed rape]
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             253   7e-77   Citrus clementina [clementine]
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          253   1e-76   Cucumis melo [Oriental melon]
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    254   2e-76   
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               252   2e-76   Citrus sinensis [apfelsine]
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    252   2e-76   Citrus sinensis [apfelsine]
gb|KEH38469.1|  cytochrome P450 family 709 protein                      252   2e-76   Medicago truncatula
gb|AIA82924.1|  SLS1                                                    252   3e-76   Gentiana rigescens
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    252   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJD25167.1|  cytochrome P450 CYP72A326                               252   3e-76   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          251   4e-76   
ref|XP_008367417.1|  PREDICTED: cytochrome P450 CYP72A219-like          243   4e-76   
ref|XP_009594691.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    249   4e-76   Nicotiana tomentosiformis
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    251   4e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    251   4e-76   
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          251   4e-76   Pyrus x bretschneideri [bai li]
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          251   5e-76   Cucumis melo [Oriental melon]
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          252   5e-76   Populus euphratica
gb|AJD25168.1|  cytochrome P450 CYP72A327                               251   6e-76   Salvia miltiorrhiza [Chinese salvia]
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                251   6e-76   Erythranthe guttata [common monkey flower]
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              251   6e-76   Elaeis guineensis
gb|KJB12904.1|  hypothetical protein B456_002G043600                    251   6e-76   Gossypium raimondii
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      251   7e-76   Citrus sinensis [apfelsine]
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             251   7e-76   
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    251   8e-76   Arabis alpina [alpine rockcress]
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               251   8e-76   Citrus sinensis [apfelsine]
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          251   8e-76   Prunus mume [ume]
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    251   9e-76   
gb|KJB12906.1|  hypothetical protein B456_002G043600                    251   9e-76   Gossypium raimondii
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              250   1e-75   Eucalyptus grandis [rose gum]
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             250   1e-75   Capsella rubella
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    250   1e-75   
gb|KHN47456.1|  Secologanin synthase                                    251   2e-75   Glycine soja [wild soybean]
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      251   2e-75   Glycine max [soybeans]
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          250   2e-75   
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          250   2e-75   Sesamum indicum [beniseed]
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              249   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          249   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    249   3e-75   Nicotiana tomentosiformis
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              249   3e-75   Brassica rapa
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               249   3e-75   
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          249   4e-75   
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               249   4e-75   Cicer arietinum [garbanzo]
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             249   4e-75   Prunus persica
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              249   5e-75   Camelina sativa [gold-of-pleasure]
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    249   5e-75   Prunus mume [ume]
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    249   6e-75   
gb|KEH36886.1|  cytochrome P450 family monooxygenase                    244   7e-75   Medicago truncatula
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          248   7e-75   Nelumbo nucifera [Indian lotus]
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                248   7e-75   Erythranthe guttata [common monkey flower]
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               248   8e-75   
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              248   8e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        248   9e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              248   9e-75   Brassica rapa
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     248   1e-74   Eucalyptus grandis [rose gum]
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              248   1e-74   Eucalyptus grandis [rose gum]
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  248   1e-74   Medicago truncatula
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          248   2e-74   Medicago truncatula
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          247   2e-74   
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          247   2e-74   Pyrus x bretschneideri [bai li]
gb|KHN44046.1|  Secologanin synthase                                    246   3e-74   Glycine soja [wild soybean]
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              246   3e-74   Brassica rapa
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    246   3e-74   Eucalyptus grandis [rose gum]
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      246   4e-74   Glycine max [soybeans]
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    246   4e-74   Arabis alpina [alpine rockcress]
gb|KFK38824.1|  hypothetical protein AALP_AA3G165400                    254   5e-74   Arabis alpina [alpine rockcress]
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    246   5e-74   Brassica rapa
gb|KFK38825.1|  hypothetical protein AALP_AA3G165400                    254   5e-74   Arabis alpina [alpine rockcress]
emb|CDX98484.1|  BnaC05g38910D                                          246   5e-74   
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              246   5e-74   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              246   6e-74   Elaeis guineensis
ref|XP_006495015.1|  PREDICTED: secologanin synthase-like               241   7e-74   Citrus sinensis [apfelsine]
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              246   7e-74   Eucalyptus grandis [rose gum]
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          245   7e-74   
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               245   8e-74   Solanum tuberosum [potatoes]
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          246   8e-74   Medicago truncatula
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          245   9e-74   Pyrus x bretschneideri [bai li]
gb|KHG18227.1|  Secologanin synthase                                    245   1e-73   Gossypium arboreum [tree cotton]
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          245   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          245   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              245   1e-73   Camelina sativa [gold-of-pleasure]
emb|CDY28093.1|  BnaC06g02740D                                          245   1e-73   Brassica napus [oilseed rape]
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             245   1e-73   Prunus persica
ref|XP_004295684.1|  PREDICTED: cytochrome P450 CYP72A219-like          245   1e-73   
emb|CDY65330.1|  BnaC03g73760D                                          240   2e-73   
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   2e-73   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    244   2e-73   
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          245   2e-73   
emb|CDP11335.1|  unnamed protein product                                245   2e-73   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    244   2e-73   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      244   2e-73   
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              245   2e-73   
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    244   2e-73   
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    244   2e-73   
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               244   2e-73   
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  244   4e-73   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          243   5e-73   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              243   5e-73   
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    243   6e-73   
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    243   6e-73   
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    243   7e-73   
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              243   7e-73   
emb|CDY32349.1|  BnaC01g36680D                                          243   7e-73   
emb|CDX98485.1|  BnaC05g38900D                                          243   8e-73   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          243   8e-73   
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    243   1e-72   
emb|CDY51038.1|  BnaA06g03010D                                          242   1e-72   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      242   1e-72   
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               243   2e-72   
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              242   2e-72   
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          242   2e-72   
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    242   2e-72   
emb|CDP15980.1|  unnamed protein product                                242   2e-72   
gb|AEI59771.1|  cytochrome P450                                         242   2e-72   
ref|XP_004294189.1|  PREDICTED: cytochrome P450 72A15-like              242   2e-72   
emb|CDX97592.1|  BnaA05g24870D                                          241   2e-72   
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              241   2e-72   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              242   2e-72   
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   241   3e-72   
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          241   3e-72   
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        241   3e-72   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    241   3e-72   
ref|XP_008784422.1|  PREDICTED: cytochrome P450 CYP72A219-like          241   4e-72   
emb|CDX82468.1|  BnaA03g33530D                                          241   4e-72   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             241   4e-72   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              241   5e-72   
emb|CDY51036.1|  BnaA06g02990D                                          241   5e-72   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             241   5e-72   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              241   5e-72   
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             241   7e-72   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              240   7e-72   
gb|KEH37984.1|  cytochrome P450 family 72 protein                       237   8e-72   
emb|CDX82471.1|  BnaA03g33500D                                          240   9e-72   
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          240   1e-71   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          240   1e-71   
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   240   1e-71   
ref|XP_003605472.1|  Cytochrome P450 monooxygenase CYP72A61             236   1e-71   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             240   1e-71   
gb|EPS69403.1|  hypothetical protein M569_05363                         239   2e-71   
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          239   2e-71   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              239   2e-71   
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          239   3e-71   
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    238   4e-71   
ref|XP_010041835.1|  PREDICTED: cytochrome P450 72A15-like              235   4e-71   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               238   5e-71   
gb|AGX93046.1|  secologanin synthase-like protein                       238   5e-71   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             238   6e-71   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          238   7e-71   
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          238   7e-71   
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          238   7e-71   
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          237   7e-71   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          238   7e-71   
emb|CDX97591.1|  BnaA05g24880D                                          237   8e-71   
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    238   9e-71   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  238   9e-71   
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          236   1e-70   
emb|CAN72865.1|  hypothetical protein VITISV_029731                     237   1e-70   
emb|CDP15979.1|  unnamed protein product                                237   1e-70   
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              237   1e-70   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             237   2e-70   
ref|XP_010910666.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    229   2e-70   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              236   3e-70   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               237   3e-70   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          236   3e-70   
gb|AGX93044.1|  secologanin synthase-like protein                       236   3e-70   
ref|XP_003605471.1|  Cytochrome P450 monooxygenase CYP72A61             236   3e-70   
gb|KEH37983.1|  cytochrome P450 family 72 protein                       236   4e-70   
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          236   4e-70   
ref|XP_010678723.1|  PREDICTED: cytochrome P450 CYP72A219-like          235   4e-70   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          236   5e-70   
emb|CDP06076.1|  unnamed protein product                                235   6e-70   
ref|XP_006442299.1|  hypothetical protein CICLE_v100199322mg            226   6e-70   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          235   6e-70   
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61             236   7e-70   
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          235   8e-70   
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          235   9e-70   
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    235   1e-69   
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          234   1e-69   
dbj|BAB02396.1|  cytochrome P450                                        234   1e-69   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          234   1e-69   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             234   1e-69   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          234   1e-69   
dbj|BAL45199.1|  cytochrome P450 monooxygenase                          234   1e-69   
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    234   2e-69   
ref|XP_010685026.1|  PREDICTED: cytochrome P450 CYP72A219-like          234   2e-69   
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    234   2e-69   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          234   2e-69   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       234   3e-69   
gb|AFK42047.1|  unknown                                                 234   3e-69   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               234   3e-69   
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    234   4e-69   
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          233   5e-69   
ref|XP_010092744.1|  Secologanin synthase                               234   6e-69   
gb|EPS70870.1|  hypothetical protein M569_03891                         233   1e-68   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          232   1e-68   
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              232   1e-68   
gb|AGX93049.1|  secologanin synthase-like protein                       232   1e-68   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              232   1e-68   
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              232   1e-68   
gb|AEI59772.1|  cytochrome P450                                         231   2e-68   
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    230   2e-68   
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          231   3e-68   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    231   4e-68   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     230   5e-68   
gb|AAA17732.1|  cytochrome P450                                         230   6e-68   
ref|XP_004300362.1|  PREDICTED: cytochrome P450 CYP72A219-like          230   6e-68   
emb|CDY20075.1|  BnaA01g29270D                                          230   6e-68   
ref|XP_006830578.1|  hypothetical protein AMTR_s00117p00135230          222   7e-68   
gb|EPS61577.1|  hypothetical protein M569_13217                         230   7e-68   
ref|XP_007149354.1|  hypothetical protein PHAVU_005G0634001g            228   8e-68   
ref|XP_010678917.1|  PREDICTED: cytochrome P450 72A15-like              230   9e-68   
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             230   1e-67   
gb|AGX93064.1|  secologanin synthase                                    230   1e-67   
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          229   1e-67   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             229   1e-67   
gb|EPS61578.1|  hypothetical protein M569_13218                         229   1e-67   
gb|ADU19849.1|  putative secologanin synthase                           229   1e-67   
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             229   2e-67   
dbj|BAL45208.1|  cytochrome P450 monooxygenase                          228   3e-67   
emb|CDP15972.1|  unnamed protein product                                224   8e-67   
ref|XP_004301212.1|  PREDICTED: cytochrome P450 CYP72A219-like          227   9e-67   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              227   1e-66   
gb|KDO52098.1|  hypothetical protein CISIN_1g038814mg                   217   1e-66   
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          226   2e-66   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          226   2e-66   
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              227   2e-66   
ref|XP_006848523.1|  hypothetical protein AMTR_s00013p00262850          222   2e-66   
gb|AGX93047.1|  secologanin synthase-like protein                       226   3e-66   
gb|KHN47459.1|  Secologanin synthase                                    226   3e-66   
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    225   3e-66   
gb|AAA17746.1|  cytochrome P450                                         225   6e-66   
dbj|BAP90521.1|  secologanin synthase                                   225   7e-66   
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase           225   7e-66   
gb|KFK38819.1|  hypothetical protein AALP_AA3G164600                    224   8e-66   
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             224   1e-65   
gb|AEI59770.1|  cytochrome P450                                         224   1e-65   
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              224   1e-65   
emb|CDX97589.1|  BnaA05g24900D                                          224   1e-65   
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          224   2e-65   
ref|XP_009116734.1|  PREDICTED: cytochrome P450 72A13-like isofor...    223   2e-65   
emb|CDP06075.1|  unnamed protein product                                226   2e-65   
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              223   2e-65   
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          223   3e-65   
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               223   3e-65   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          223   3e-65   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    223   4e-65   
emb|CDY32351.1|  BnaC01g36700D                                          223   4e-65   
gb|KFK38818.1|  hypothetical protein AALP_AA3G164500                    223   4e-65   
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      223   4e-65   
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    223   5e-65   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    223   5e-65   
gb|EPS65653.1|  hypothetical protein M569_09124                         222   6e-65   
gb|KJB12897.1|  hypothetical protein B456_002G043200                    222   7e-65   
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              222   8e-65   
ref|XP_009146337.1|  PREDICTED: cytochrome P450 72A13                   222   1e-64   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    222   1e-64   
emb|CDX82470.1|  BnaA03g33510D                                          213   2e-64   
ref|NP_001043632.1|  Os01g0627500                                       221   2e-64   
ref|XP_009404407.1|  PREDICTED: cytochrome P450 CYP72A219-like          221   2e-64   
ref|XP_006299313.1|  hypothetical protein CARUB_v10015468mg             220   3e-64   
gb|AFW83339.1|  putative cytochrome P450 superfamily protein            217   4e-64   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              220   5e-64   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    220   5e-64   
gb|AGX93045.1|  secologanin synthase-like protein                       220   6e-64   
gb|AAL38603.1|AF446870_1  AT3g14620/MIE1_12                             219   6e-64   
ref|NP_188080.1|  cytochrome P450, family 72, subfamily A, polype...    219   6e-64   
emb|CAN71976.1|  hypothetical protein VITISV_042685                     211   7e-64   
gb|EPS71634.1|  hypothetical protein M569_03124                         210   7e-64   
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          218   8e-64   
ref|XP_009116727.1|  PREDICTED: cytochrome P450 72A13-like isofor...    219   8e-64   
gb|EPS61172.1|  hypothetical protein M569_13627                         219   9e-64   
gb|EYU26272.1|  hypothetical protein MIMGU_mgv1a018891mg                219   1e-63   
emb|CDX97588.1|  BnaA05g24910D                                          219   1e-63   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              218   2e-63   
ref|XP_006307236.1|  hypothetical protein CARUB_v10008841mg             218   2e-63   
emb|CDX97590.1|  BnaA05g24890D                                          218   2e-63   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    219   2e-63   
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              218   2e-63   
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    218   4e-63   
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          218   4e-63   
gb|EYU26266.1|  hypothetical protein MIMGU_mgv1a0182362mg               214   4e-63   
dbj|BAJ98958.1|  predicted protein                                      218   5e-63   
gb|EYU26274.1|  hypothetical protein MIMGU_mgv1a004552mg                217   5e-63   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    217   5e-63   
gb|ADO16184.1|  cytochrome P450 mono-oxygenase                          217   6e-63   
emb|CAN63404.1|  hypothetical protein VITISV_001871                     216   6e-63   
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     217   6e-63   
ref|XP_008386423.1|  PREDICTED: cytochrome P450 CYP72A219-like          216   7e-63   
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   218   7e-63   
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            218   7e-63   
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        217   8e-63   
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               216   9e-63   
ref|XP_010273926.1|  PREDICTED: cytochrome P450 72A15-like              217   9e-63   
ref|XP_006299368.1|  hypothetical protein CARUB_v10015526mg             216   1e-62   
gb|EYU26264.1|  hypothetical protein MIMGU_mgv1a004586mg                216   1e-62   
emb|CDY70955.1|  BnaUnng04110D                                          208   1e-62   
ref|XP_010540131.1|  PREDICTED: cytochrome P450 72C1-like isoform X1    216   1e-62   
ref|XP_010501999.1|  PREDICTED: cytochrome P450 72A13-like              216   2e-62   
gb|EYU26273.1|  hypothetical protein MIMGU_mgv1a004412mg                216   2e-62   
emb|CBI39929.3|  unnamed protein product                                214   2e-62   
gb|EPS71635.1|  hypothetical protein M569_03125                         207   2e-62   
ref|XP_010098361.1|  Secologanin synthase                               216   2e-62   
gb|EPS68529.1|  hypothetical protein M569_06239                         211   2e-62   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    216   2e-62   



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 190/254 (75%), Gaps = 8/254 (3%)
 Frame = +1

Query  40   MEVIYTLLGVC---VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            M+ I  L+ +C   ++V L    W+VL WVWF+PKKLEK L++ GLKGN YRIL GDMK+
Sbjct  1    MDKIQILVTICCCVIAVALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKD  60

Query  211  LVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  387
               M  +A SKPM +S D+++PR++P++  +  KYGK C+ WMGP P + I DPEL+KEV
Sbjct  61   FSGMIKEANSKPMNISNDDLSPRLVPFFLEIIKKYGKKCFTWMGPRPQILIMDPELIKEV  120

Query  388  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSE  567
            L+K  ++QKP  NPLG   V+GLV+YEK++WAKHR+++NPAF+ EK K M PAF LSCSE
Sbjct  121  LSKTYVYQKPHANPLGTLFVQGLVTYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSE  180

Query  568  MLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMH  747
            MLSK E +V  +GS     E+DVWPHLQ LTCDVISRTAFGSSYEEG++IFEL +EQ  H
Sbjct  181  MLSKWEDVVQVEGSH----EIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQTQH  236

Query  748  LVETTRQVYIPGLR  789
             +E TR VYIPG R
Sbjct  237  FLEVTRSVYIPGWR  250



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 184/249 (74%), Gaps = 5/249 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            +I T+    +++ L    W+VL WVWF+PKKLEK L++ GL GN YR L GDMK+  KM 
Sbjct  1    MIVTIFCCAIAITLFVCLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMI  60

Query  226  SDAISKPMTLSD-NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  402
             +A SKPM + D ++APR++P++     KYGK C+ WMGP P + I DPEL+KEVL+K  
Sbjct  61   KEANSKPMNMDDHDLAPRMVPFFLETIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTY  120

Query  403  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*  582
            ++QKP  NPLG   V+GLVSYEK++WAKHR+++NPAF+ EK K M PAF LSCSEMLSK 
Sbjct  121  VYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLSKW  180

Query  583  EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETT  762
            E +V  +GS     E+DVWPHLQ LTCDVISRTAFGSSYEEG++IFEL KEQA H +E  
Sbjct  181  EDVVRVEGSH----EIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQHFLEVI  236

Query  763  RQVYIPGLR  789
            R VYIPG R
Sbjct  237  RSVYIPGWR  245



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/251 (59%), Positives = 186/251 (74%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            +E+I T+     ++ L    W+VL WVWF PKKLEK L++ GL GN YR+L GDMK+L  
Sbjct  4    IEMIVTICCCATAITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKDLSG  63

Query  220  MASDAISKPMTLSD-NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
            M  +A SKPM +SD N+APR++P++     KYGK  ++WMGP P + I DPEL+KEVL+K
Sbjct  64   MIKEANSKPMNMSDHNLAPRMVPFFLETIKKYGKKSFIWMGPRPQILIMDPELIKEVLSK  123

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
              ++QKP  NPLG   V+GLVSYEK++WAKHR+++NPAF+ EK K M PAF LSCSEMLS
Sbjct  124  NYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLS  183

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E +V  +GS     E+DVWPHLQ LTCDVISRTAFGSSYEEG++IFEL +EQA H +E
Sbjct  184  KWEDVVQVEGSH----EIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQAQHFLE  239

Query  757  TTRQVYIPGLR  789
              R VYIPG R
Sbjct  240  VIRSVYIPGWR  250



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   305 bits (782),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 187/250 (75%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            +++I T     + + L+   WRVL WVWF+PKKLEK L++ GLKGN Y+IL GDMKEL  
Sbjct  4    VQIIITASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKELSG  63

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+V I DPEL+KE+ +KY
Sbjct  64   MIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVLIMDPELIKEIFSKY  123

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             L+QKP  NP+ + LV+GLVS E+++WAKHR+++NPAF+ EK K M PAF LSC+EML K
Sbjct  124  YLYQKPHGNPVTKLLVQGLVSLEEDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLCK  183

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  KGS     E+DVWPHL+ L+ DVISRTAFGS++EEGKRIFEL KEQA + VE 
Sbjct  184  WEDIVSIKGSH----EIDVWPHLEQLSSDVISRTAFGSNFEEGKRIFELQKEQAQYFVEA  239

Query  760  TRQVYIPGLR  789
             R VYIPG R
Sbjct  240  IRSVYIPGWR  249



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 186/250 (74%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            +++  T     + + LL   WRVL W+WF+PKKLE  L++ GL+GN Y++L GDMKE   
Sbjct  5    LQMTVTASCAAIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSG  64

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM+LSD+VAPR++P++     KYGK  ++W GP P+V I DPEL+KEVL+K 
Sbjct  65   MIKEAYSKPMSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKI  124

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             L+QKP  NPL   LV+G+ +YE+++WAKHR+++NPAF+ EK KLM PAF LSCSEMLSK
Sbjct  125  HLYQKPGGNPLATLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSK  184

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV    S+  S E+DVW HL+ LTCDVISRTAFGSSYEEG++IFEL KEQA +LVE 
Sbjct  185  WEDIV----SADSSHEIDVWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEV  240

Query  760  TRQVYIPGLR  789
             R VYIPG R
Sbjct  241  FRSVYIPGRR  250



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 182/241 (76%), Gaps = 4/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
              + + LL   WRVL W+WF+PKKLE  L++ GL+GN Y++L GDMKE   M  +A SKP
Sbjct  8    AAIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKP  67

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            M+LSD+VAPR++P++     KYGK  ++W GP P+V I DPEL+KEVL+K  L+QKP  N
Sbjct  68   MSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGN  127

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL   LV+G+ +YE+++WAKHR+++NPAF+ EK KLM PAF LSCSEMLSK E IV    
Sbjct  128  PLATLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSKWEDIV----  183

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            S+  S E+DVW HL+ LTCDVISRTAFGSSYEEG++IFEL KEQA +LVE  R VYIPG 
Sbjct  184  SADSSHEIDVWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGR  243

Query  787  R  789
            R
Sbjct  244  R  244



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   300 bits (767),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 181/251 (72%), Gaps = 8/251 (3%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME I  ++ +C     +   W+VL WVWF PKKLE  L++ GLKGN YR+L GDMK++ +
Sbjct  1    METIQMIVTICCCAIAITLLWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTR  60

Query  220  MASDAISKPMTLSD-NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
            M  +A SKPM +SD ++APR++P++    +KYGK C+ WMGP P V I DPEL+KEVL+K
Sbjct  61   MIKEANSKPMNMSDHDLAPRMMPFFLETINKYGKKCFTWMGPKPQVLIMDPELIKEVLSK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
              L+QKP  NPLG   V+GLVSYEK++WAK+R+++NPAF+ EK K M PAF LSCSEMLS
Sbjct  121  TYLYQKPGGNPLGSLFVQGLVSYEKDKWAKNRKIINPAFHLEKLKHMLPAFYLSCSEMLS  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E +         S E+DVWPHLQ LT DVISRTAFGSSYEEG++IFEL  EQ  H +E
Sbjct  181  KWEDV-------EGSHEIDVWPHLQQLTSDVISRTAFGSSYEEGRKIFELQNEQVPHFIE  233

Query  757  TTRQVYIPGLR  789
              R VYIPG R
Sbjct  234  AMRSVYIPGWR  244



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 184/250 (74%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            +++  T     + + L+   WRVL WVWF+PKKLEK L++ GLKGN YRIL GDMKEL  
Sbjct  4    VQITVTASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKELSG  63

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+VF+ DPEL+KEV +K 
Sbjct  64   MIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFVMDPELIKEVFSKN  123

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             L+QKP +NPL + L +GLVS E+++WAKHR+++ PAF+ EK K M PAF LSC+EMLSK
Sbjct  124  YLYQKPHSNPLTKLLAQGLVSQEEDKWAKHRKIVTPAFHLEKLKHMLPAFCLSCTEMLSK  183

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  +GS     E+D+WP LQ LT DVISRTAFGSSYE G+RIFEL KEQA  L+E 
Sbjct  184  WEDIVAVEGSH----EIDIWPGLQQLTSDVISRTAFGSSYEAGRRIFELQKEQAQFLMEA  239

Query  760  TRQVYIPGLR  789
             R VYIPG R
Sbjct  240  IRSVYIPGWR  249



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 194/252 (77%), Gaps = 5/252 (2%)
 Frame = +1

Query  40   MEVI-YTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME++ Y L+   +++ ++ +AW++L W WF+P+KLEKCL++ GLKGN Y+++ GD+KEL 
Sbjct  1    MEIVAYYLVSFLLTITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  217  KMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
            K   DA SKP+ +SD+ + PR++PY+     K+GKNC++W+GP PMV +R+PE++++V N
Sbjct  61   KSFEDANSKPLKVSDDDICPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVREPEVIRDVFN  120

Query  394  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
            KY L+QKP++ P+ + L +G+ SYE+++W  HR++LNPAF+ EK K M PA  LSC+EM+
Sbjct  121  KYVLYQKPKSTPITKLLAQGVSSYEEDKWEMHRKILNPAFHMEKIKSMVPAVHLSCTEMV  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            S+ E  +  KG+   SCE+D+WP+LQ LT DVISRTAFGS+YEEG++IFEL KE A H++
Sbjct  181  SQWEESISTKGT---SCEIDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKELAQHVI  237

Query  754  ETTRQVYIPGLR  789
            E TR +YIPG R
Sbjct  238  EATRTLYIPGSR  249



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 183/250 (73%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            +++  T     + + L+   WRVL WVWF+PKKLEK  ++ GLKGN YRIL GDMKEL  
Sbjct  4    VQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSG  63

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+VFI DPEL+KEV +K 
Sbjct  64   MIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKN  123

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             L++KP +NPL + L +GLVS E ++WAKHR+++ PAF+ EK K M PAF LSC+EMLSK
Sbjct  124  YLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEMLSK  183

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  +GS     E+D+WP LQ L+ DVISRTAFGSSYEEG+RIFEL KEQA H ++ 
Sbjct  184  WEDIVAVEGSH----EIDIWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKA  239

Query  760  TRQVYIPGLR  789
             R +YIPG R
Sbjct  240  IRSIYIPGWR  249



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 183/250 (73%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            +++  T     + + L+   WRVL WVWF+PKKLEK  ++ GLKGN YRIL GDMKEL  
Sbjct  4    VQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSG  63

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM LSD++APR++P++     KYGK  +VW+GP P+VFI DPEL+KEV +K 
Sbjct  64   MIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKN  123

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             L++KP +NPL + L +GLVS E ++WAKHR+++ PAF+ EK K M PAF LSC+EMLSK
Sbjct  124  YLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEMLSK  183

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  +GS     E+D+WP LQ L+ DVISRTAFGSSYEEG+RIFEL KEQA H ++ 
Sbjct  184  WEDIVAVEGSH----EIDIWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKA  239

Query  760  TRQVYIPGLR  789
             R +YIPG R
Sbjct  240  IRSIYIPGWR  249



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 183/253 (72%), Gaps = 7/253 (3%)
 Frame = +1

Query  40   MEVIYTLLGVC---VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            M+ I  L+ VC   +++ L    W+VL WVW  PKKLE  L++ GL GN Y+IL GD+ +
Sbjct  1    MDEIQILVRVCCSAIAIALFVCLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
             + M  +A SKPM LSD++APR++P++     KYGK C++W+GP P V I DPEL+KEVL
Sbjct  61   FIGMIREASSKPMNLSDDIAPRLVPFFLETTKKYGKKCFIWLGPKPQVIIMDPELIKEVL  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            +K  L+QKP  NP    LV+GL +YE+++WAKHR+++NPAF+ EK K M PAF LSC+EM
Sbjct  121  SKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCTEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            LSK E  V   GSS    E+DVWPHLQ LTCDVISRTAFGSSYEEG++IFEL  EQA + 
Sbjct  181  LSKWEDAV-PLGSSR---EIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQTEQAQNF  236

Query  751  VETTRQVYIPGLR  789
            ++  R+VYIPG R
Sbjct  237  IDAVREVYIPGRR  249



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 190/247 (77%), Gaps = 4/247 (2%)
 Frame = +1

Query  52   YTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASD  231
            Y L+   +++  + +AWR+L W WF P+KLEKCL+Q GLKGN Y+++ GD+KEL K   D
Sbjct  6    YFLVLFLLAITFVIYAWRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELSKSIED  65

Query  232  AISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            A SKP+ +SD+ + PR++PY+     KYGKNC++W+GP P+V + DPE++++V NK+ L+
Sbjct  66   AESKPLNVSDDDLTPRILPYFVQTIKKYGKNCFIWIGPKPLVIVGDPEVIRDVFNKHALY  125

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            QKP++ PL + L +G+VSYE+++WAKHR++LNPAF+ EK K M  A LLSCSEM+++ E 
Sbjct  126  QKPKSTPLTKLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKDMLQAVLLSCSEMVNQWEE  185

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
             V  K SS+   E+D+WP+LQ LT DVISRTAFGS+YEEG++IFEL KEQA H++E +R 
Sbjct  186  AVSMKESST---ELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAEHVIEVSRT  242

Query  769  VYIPGLR  789
            +YIPG R
Sbjct  243  LYIPGWR  249



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 181/253 (72%), Gaps = 7/253 (3%)
 Frame = +1

Query  40   MEVIYTLLGVC---VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            M+ I  L+ VC   +++ L    W+VL WVWF PKKLE  L++ GL GN Y+IL GD+ +
Sbjct  1    MDKIQILVTVCCFAIAIALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
             + M  +A SKPM LSD++APR++P++     KYGK C++W+GP P V I DP+L+KEVL
Sbjct  61   FIGMIREATSKPMNLSDDIAPRLVPFFLETIKKYGKKCFIWLGPKPQVIIMDPKLIKEVL  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            +K  L+QKP  NP    LV+GL +YE+++WAKHR+++NPAF+ EK K M PAF L C+EM
Sbjct  121  SKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLCCTEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            L K E  +        S E+DVWPHLQ LTCDVISRTAFGSSYEEG++IFEL KEQA + 
Sbjct  181  LGKLEDAI----PVGSSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQNF  236

Query  751  VETTRQVYIPGLR  789
            ++  R+VY+PG R
Sbjct  237  IDAVREVYVPGRR  249



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 179/250 (72%), Gaps = 7/250 (3%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME++ T     +++ L    W+VL WVWF+PKKLEK L++ GL GN YR+L GDMK+  K
Sbjct  1    MELV-TACCCAITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSK  59

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM LS+++ PR++P++     KYGK  ++W+ P P V I DPEL+KEV +K 
Sbjct  60   MIKEANSKPMNLSNDITPRLVPFFLETIKKYGKKSFIWLCPKPQVLIMDPELIKEVFSKN  119

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              +QKP  NP    LV+GL +YE+++WAKHR+++NPAF+ EK K M PAF LSCSEMLSK
Sbjct  120  YFYQKPHGNPFAALLVQGLAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCSEMLSK  179

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E  V G      SCE+DVWPHLQ LTCDVISRTAFGSSYEEG++IFEL +EQA H ++T
Sbjct  180  WEDAVEG------SCEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQREQAQHFIDT  233

Query  760  TRQVYIPGLR  789
             R V IP  R
Sbjct  234  VRSVNIPRWR  243



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/252 (54%), Positives = 191/252 (76%), Gaps = 6/252 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLA-FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+ Y L+    +V LL  +AW++L W WF+P+KLE+CL+Q GL GN Y+++ GD+KEL 
Sbjct  1    MEMAYYLVLSLFAVTLLVIYAWKLLKWAWFRPRKLEQCLRQQGLIGNSYKLIFGDLKELS  60

Query  217  KMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
            K   +  SKP+ +SD+ + PR++PY+     KYGKNC+VW+GP P+VF+R+PE++K+VL 
Sbjct  61   KSIEEVKSKPLNVSDDDIPPRILPYFIEAIKKYGKNCFVWLGPNPLVFVREPEVIKDVLT  120

Query  394  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
            ++ L+QKP++ PL R L +G+VSYE+++WAKHR++LNPAF+ EK K M PAF LSCSEM+
Sbjct  121  RHALYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAFHLSCSEMV  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            S+ E     KG    SCE+D+WP+LQ L+ D ISRTAF S+YEEG++IFEL KEQA H++
Sbjct  181  SQWEEAASVKG----SCELDIWPYLQRLSSDAISRTAFESNYEEGRKIFELQKEQAEHVI  236

Query  754  ETTRQVYIPGLR  789
              +R +YIPG R
Sbjct  237  AISRTLYIPGWR  248



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/252 (52%), Positives = 187/252 (74%), Gaps = 5/252 (2%)
 Frame = +1

Query  40   MEVI-YTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME++ Y L+   +++  + +AW++L W WF+P+KLEKCL++ GLKGN Y+++ GD+KEL 
Sbjct  1    MEIVAYYLVSFLLTITSVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  217  KMASDAISKPMTL-SDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
            K   D  SKP+ +  D++ PR++PY+     K+GKNC++W+GP PMV + D E++++V N
Sbjct  61   KSFEDVKSKPLNVFDDDITPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVNDAEVIRDVFN  120

Query  394  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
            KY L+QKP+  PL + L +GL SYE+++WA HR++LNPAF+ EK K M PA  LSC+EM+
Sbjct  121  KYVLYQKPKPTPLTKLLAQGLASYEEDKWAMHRKILNPAFHMEKIKNMVPAIHLSCTEMV  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            S+ E  +  KG+   SCE+D+WP+LQ L+ DVISRTAFGS+YEEG+ IFEL KEQA H +
Sbjct  181  SQWEESISTKGT---SCEIDIWPYLQKLSSDVISRTAFGSNYEEGRMIFELQKEQAQHFI  237

Query  754  ETTRQVYIPGLR  789
            E TR +YI G R
Sbjct  238  EATRTLYILGSR  249



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 180/246 (73%), Gaps = 6/246 (2%)
 Frame = +1

Query  58   LLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            +  +C+ + L+  AW +L W+W KPKKLE CL++ GLKGN YR+  GDMKEL K   +  
Sbjct  9    IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEIN  68

Query  238  SKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
            SKP+  LS+ VAPR+IPYY  +  KYGK C+VW GP P + I +PEL+KE+  K  +FQK
Sbjct  69   SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  128

Query  415  PRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
            P N NPL + L RG+VSYE+E+WAKHR++LNPAF+ EK K M PAF LSCSEML+K E I
Sbjct  129  PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEI  188

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
            +  K S+    E+D+WPHLQ +T DVISR AFGSSYEEG+RIFEL +EQA +L +T   V
Sbjct  189  IPVKESN----ELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSV  244

Query  772  YIPGLR  789
            YIPG R
Sbjct  245  YIPGSR  250



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 180/246 (73%), Gaps = 6/246 (2%)
 Frame = +1

Query  58   LLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            +  +C+ + L+  AW +L W+W KPKKLE CL++ GLKGN YR+  GDMKEL K   +  
Sbjct  19   IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEIN  78

Query  238  SKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
            SKP+  LS+ VAPR+IPYY  +  KYGK C+VW GP P + I +PEL+KE+  K  +FQK
Sbjct  79   SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  138

Query  415  PRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
            P N NPL + L RG+VSYE+E+WAKHR++LNPAF+ EK K M PAF LSCSEML+K E I
Sbjct  139  PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEI  198

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
            +  K S+    E+D+WPHLQ +T DVISR AFGSSYEEG+RIFEL +EQA +L +T   V
Sbjct  199  IPVKESN----ELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSV  254

Query  772  YIPGLR  789
            YIPG R
Sbjct  255  YIPGSR  260



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 185/251 (74%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            MEV++ +L    +  +L ++WRV+ W + +PK+LEK L++ GL GN YR++ GD+KE++K
Sbjct  1    MEVVWQILAASSAFVVLMYSWRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEMLK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  D  SKP+ L D++ PRV+ +      KYG   ++W+GP P V I DPELVKEV+NKY
Sbjct  61   MMEDGRSKPINLDDDIKPRVLHFVFKTVQKYGTESFLWLGPRPTVTISDPELVKEVMNKY  120

Query  400  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
            +++QKP N NPL + L +G+VSYE ++WAKHR+L+NPAF+ EK KLM PAF LSC E+L+
Sbjct  121  DIYQKPNNPNPLTKLLAQGVVSYEMDKWAKHRKLINPAFHMEKLKLMIPAFYLSCDEVLN  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E  +  +G    SCEVDVWP+LQ LT D ISRTAFGSSY+EG RIFEL +EQA H+++
Sbjct  181  KWEKSLSPEG----SCEVDVWPYLQNLTSDAISRTAFGSSYQEGTRIFELQREQAEHVIK  236

Query  757  TTRQVYIPGLR  789
             ++ +YIPG R
Sbjct  237  ASQSIYIPGWR  247



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 189/251 (75%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME+ Y ++    +V  + + W++L W WF+P+KL++CL+Q GLKGN Y+++ GD+KEL K
Sbjct  1    MEMAYYIVLSLFAVTSVIYVWKLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSK  60

Query  220  MASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
               +A SKP+ +SD+ + PR++PY+     KYGKN ++W+GP P+VF+RDP+++K+VL K
Sbjct  61   SIEEAKSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVFVRDPDVLKDVLTK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
            + L+QKP++ PL R L +G+VSYE+++WAKHR++LNPAF+ EK K M PA  LSCSEM+S
Sbjct  121  HSLYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAIQLSCSEMVS  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + +     KG    SCE+D+WP+LQ L+ D ISRTAFGS+YEEG++IFEL KEQA H++ 
Sbjct  181  QWKEAASVKG----SCELDIWPYLQRLSSDAISRTAFGSNYEEGRKIFELQKEQAEHVIA  236

Query  757  TTRQVYIPGLR  789
             +  +YIPG R
Sbjct  237  ISSTLYIPGWR  247



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   287 bits (734),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 178/250 (71%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            MEV+Y+L+ V  +  L+  +WR+L W WFKPKK EKCL+Q GL+GN Y ++ GDMKE V+
Sbjct  1    MEVLYSLVAVLSASFLVILSWRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMKETVR  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKP+  ++++  RV+P+       YG+N Y W GPMP V + DPE +KEV+NK 
Sbjct  61   MTQEAKSKPINFTNDIVSRVMPFIDKTIKTYGENSYAWAGPMPAVLLMDPEHIKEVMNKS  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              + KP  NPL + L  GLVSYE ++W+KHR+L+NPAF+ EK KLM PAF LSC EM+SK
Sbjct  121  FNYLKPPGNPLSKLLATGLVSYETDKWSKHRKLINPAFHLEKVKLMLPAFRLSCFEMVSK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E ++  KG    SCE+DVWP LQ LT DVISRTAFGS+YEEG++IFEL KEQA  ++  
Sbjct  181  WEQLISEKG----SCELDVWPELQALTSDVISRTAFGSNYEEGQKIFELQKEQAELILLA  236

Query  760  TRQVYIPGLR  789
             R  Y+PG R
Sbjct  237  ARSPYVPGWR  246



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   287 bits (734),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 180/252 (71%), Gaps = 6/252 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLL--AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            M+  ++ + V VS  L+    AW+VL WVWFKP+KLEK LKQ G KGNPY++  GD KE+
Sbjct  1    MKTTHSFMIVLVSSCLVLSVLAWKVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDFKEI  60

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
              +  +A SKP++LSD++ PRVIP++    +KYGKN Y+W GP P + I DPEL ++V  
Sbjct  61   GTLFQEAYSKPISLSDDIVPRVIPHFLGTVNKYGKNAYLWFGPKPTMLIMDPELTRKVTQ  120

Query  394  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
            K E+FQKP+ +PL + L +G + YE ++WAKHR+LLN AF+ EK KLM PAF  S SEML
Sbjct  121  KMEIFQKPQFHPLSKLLAQGTLVYEGDKWAKHRKLLNQAFHMEKLKLMVPAFYTSASEML  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            SK E  +  KG    S E+DVWPHLQ +T D ISRTAFGS YE+G+RIFEL  EQA HLV
Sbjct  181  SKWEEGISAKG----SIELDVWPHLQTMTGDAISRTAFGSKYEKGRRIFELQTEQAQHLV  236

Query  754  ETTRQVYIPGLR  789
            +  + +YIPGLR
Sbjct  237  KAVQSMYIPGLR  248



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 179/246 (73%), Gaps = 6/246 (2%)
 Frame = +1

Query  58   LLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            +  +C+ + L+  AW +L W+W KPKKLE CL++ GLKGN Y +  GDMKEL K   +  
Sbjct  9    IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYGLFYGDMKELSKSLKEIN  68

Query  238  SKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
            SKP+  LS+ VAPR+IPYY  +  KYGK C+VW GP P + I +PEL+KE+  K  +FQK
Sbjct  69   SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  128

Query  415  PRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
            P N NPL + L RG+VSYE+E+WAKHR++LNPAF+ EK K M PAF LSCSEML+K E I
Sbjct  129  PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEI  188

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
            +  K S+    E+D+WPHLQ +T DVISR AFGSSYEEG+RIFEL +EQA +L +T   V
Sbjct  189  IPVKESN----ELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSV  244

Query  772  YIPGLR  789
            YIPG R
Sbjct  245  YIPGSR  250



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 190/252 (75%), Gaps = 5/252 (2%)
 Frame = +1

Query  40   MEVI-YTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME++ Y L+   +++  + +AWR+L W WF+P+KL+KCL+Q GLKGN Y+++ GD+KEL 
Sbjct  1    MEIVAYFLVLFLLAITFVIYAWRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELS  60

Query  217  KMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
            K   DA SKP+ +SD+ + PR++PY+     KYGKNC++W+G  P+V + DPE++++V N
Sbjct  61   KSIEDAESKPLDVSDDDLTPRILPYFVQTIKKYGKNCFIWIGTKPLVIVGDPEVIRDVFN  120

Query  394  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
            K+ L+QKP++ PL + L +G+VSYE+ +WAKHR++LNPAF+ EK K M  A  LSCSEM+
Sbjct  121  KHALYQKPKSTPLTKLLAQGIVSYEEVKWAKHRKILNPAFHMEKIKDMLQAVHLSCSEMV  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            S+ E  V  K SS+   E+D+WP+LQ LT DVIS TAFGS+YEEG++IFEL KEQA H++
Sbjct  181  SQWEEAVSMKESST---ELDIWPYLQRLTSDVISHTAFGSNYEEGRKIFELQKEQAEHVI  237

Query  754  ETTRQVYIPGLR  789
              +R +YIPG R
Sbjct  238  AVSRTLYIPGWR  249



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 177/254 (70%), Gaps = 9/254 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +S    + +L +AW++L WVWFKPK+LEKCL+Q G KGN YR L GD+ 
Sbjct  1    MEISYYSLKIAISSFVVIFILKWAWKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVN  60

Query  208  ELVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  387
            E++KM  +A+SKP+  S N+ PRV+P++      YGKNC  W GP P + I DPEL++EV
Sbjct  61   EMMKMGKEALSKPIDFSHNIWPRVMPFFHKTITTYGKNCLAWYGPRPAIVIVDPELIREV  120

Query  388  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSE  567
            L K  +FQKP   PL +    GL  YE ++WAKHRRL+NPAF+ +K K M PAFLL+ SE
Sbjct  121  LTKNYIFQKPPGTPLTKLAANGLAGYEADKWAKHRRLINPAFHLDKLKHMLPAFLLTASE  180

Query  568  MLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMH  747
            MLSK E +V   GS     E+DVWP+LQ LT D ISRTAFGSSYEEG++IFEL KEQ   
Sbjct  181  MLSKWEKVVSTGGS-----EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQMEL  235

Query  748  LVETTRQVYIPGLR  789
            L++  R +YIPG R
Sbjct  236  LLQIARSLYIPGWR  249



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 180/247 (73%), Gaps = 7/247 (3%)
 Frame = +1

Query  58   LLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            L+ V +S   + LL +AWR+L WVW +PKKLE+CL+Q G+ GN YR+L GD++E+++M S
Sbjct  3    LISVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMIS  62

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            +A S+P++LSD +  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  +Y  F
Sbjct  63   EANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAF  122

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
             KP  +PLG+ L  GLV+ E EQW KHR+++NPAF+ EK K M PAF LSC +M++K E 
Sbjct  123  HKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVNKWE-  181

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
                K S   SCE+D+WP L+ LT D ISRTAFGSSYEEG+RIF+L KEQA   V+  R 
Sbjct  182  ---KKLSKDGSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRS  238

Query  769  VYIPGLR  789
            VYIPG R
Sbjct  239  VYIPGWR  245



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 180/253 (71%), Gaps = 6/253 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            ME  ++ +   VS   V L   AWR L W WF+PKKL+K LKQ G KGNPY+++ GD K+
Sbjct  1    MEAAHSFMIALVSSCCVVLSVLAWRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQ  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
            +  +  +A SKP++LSD++ PR++P++    +KYGKN Y+W GP PM+ I DPEL+++V 
Sbjct  61   ISSLFQEANSKPISLSDDIVPRIVPHFLEAVNKYGKNTYLWFGPRPMMLIMDPELIRKVT  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            +K ++FQK R  P  R L+ G++ YE E+WAK R+LLN AF++EK KLM PAF  S SEM
Sbjct  121  HKMDIFQKVRFRPQARLLIGGILVYEGEKWAKQRKLLNQAFHTEKLKLMVPAFYKSASEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            LSK E ++  KGS      VDVWP++Q +T D ISRTAFGS YEEG++IFEL +EQA HL
Sbjct  181  LSKWEEMISVKGSFEV---VDVWPNIQTMTSDAISRTAFGSRYEEGRKIFELQREQARHL  237

Query  751  VETTRQVYIPGLR  789
            VE TR +YIPG R
Sbjct  238  VEATRSIYIPGSR  250



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 180/247 (73%), Gaps = 7/247 (3%)
 Frame = +1

Query  58   LLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            L+ V +S   + LL +AWR+L WVW +PKKLE+CL+Q G+ GN YR+L GD++E+++M S
Sbjct  16   LISVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMIS  75

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            +A S+P++LSD +  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  +Y  F
Sbjct  76   EANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAF  135

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
             KP  +PLG+ L  GLV+ E EQW KHR+++NPAF+ EK K M PAF LSC +M++K E 
Sbjct  136  HKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVNKWE-  194

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
                K S   SCE+D+WP L+ LT D ISRTAFGSSYEEG+RIF+L KEQA   V+  R 
Sbjct  195  ---KKLSKDGSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRS  251

Query  769  VYIPGLR  789
            VYIPG R
Sbjct  252  VYIPGWR  258



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 188/253 (74%), Gaps = 6/253 (2%)
 Frame = +1

Query  40   MEVI-YTLLGV-CVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            ME++ Y  L +  +++  + +AWR+L W WF+P+KLEKCL++ GLKGN Y+++ GD+KEL
Sbjct  1    MEIVTYHFLALFLLAITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKEL  60

Query  214  VKMASDAISKPMTLSDN-VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
             K   DA SKP+  SD+ + PR++PY+     KYGKNC++W+GP P+V + DPE++++V 
Sbjct  61   SKSIEDAKSKPLNASDDDLTPRILPYFVQTIKKYGKNCFIWVGPKPLVIVGDPEVIRDVF  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            NK+ L+QKP+  P  + L +G++SYE ++WAKHRR+LNPAF+ EK K M     LSCSEM
Sbjct  121  NKHALYQKPKYPPQTKLLAKGILSYEDDKWAKHRRILNPAFHMEKIKDMLHTVHLSCSEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            +S+ E  V  K SS+   E+D+WP+LQ LT DVISRTAFGS+YEEG++IFEL KEQA H+
Sbjct  181  VSQWEEAVSMKESST---ELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAKHV  237

Query  751  VETTRQVYIPGLR  789
            +E +R +YI G R
Sbjct  238  IEVSRTLYILGWR  250



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 177/239 (74%), Gaps = 4/239 (2%)
 Frame = +1

Query  73   VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  252
            V + LL +AWR+L WVW +PKKLE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++
Sbjct  11   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  70

Query  253  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  432
             SD++  RV+P++ H   KYGKN ++W+GP P+V I  PEL+++VL K+  FQKP  +PL
Sbjct  71   FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAFQKPPRHPL  130

Query  433  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSS  612
            G+ L  G+ S E EQW K R+++NPAF+ EK K M  AF LSCS+M++K E  +   G  
Sbjct  131  GKLLASGVASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKQLSLDG--  188

Query  613  SCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
              SCE+D+WP+LQ LT DVISRTAFGSSYEEG+RIF+L KEQA+  V+ TR VY+PG R
Sbjct  189  --SCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSVYVPGWR  245



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 170/235 (72%), Gaps = 6/235 (3%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
            A +W+ L WVWF+PKKLEK LK+   +GNPY++L GD KE+  + ++A SK + LSD++ 
Sbjct  24   AVSWKALNWVWFRPKKLEKRLKEQRFRGNPYKLLHGDFKEMSTLYTEAQSKNLNLSDDIV  83

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRVIP Y     KYGKN Y+W GP P + I DP L+K V  K ++FQKPR NPLGR L +
Sbjct  84   PRVIPQYLGAVKKYGKNTYLWFGPRPALVIMDPNLIKAVTQKVDVFQKPRVNPLGRLLAQ  143

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GLVSYE E+WAK R+LLNPAF+ EK KLM PAF  S SEM++K E +V  KG +    EV
Sbjct  144  GLVSYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVTKWENVVSPKGLA----EV  199

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY--IPGLR  789
            DVWP+LQ LT D ISRTAFGS+YEEG+RIFEL +EQ  HL++  R VY  IPG R
Sbjct  200  DVWPNLQALTSDAISRTAFGSNYEEGRRIFELQREQTEHLMQLARSVYINIPGFR  254



>gb|EYU43426.1| hypothetical protein MIMGU_mgv1a018638mg, partial [Erythranthe 
guttata]
Length=361

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 178/251 (71%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            MEV+Y +        +L + WR+L W + +PK+LEK L   GL GN Y+ L GD+KE+ K
Sbjct  1    MEVVYKIFAASFGFVVLFYTWRILNWAYIQPKRLEKSLGNQGLTGNTYKFLYGDLKEMSK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M + A S P+ L D++ PRV+ +     +KYG+  ++W+GP P V I +PELVKEV+ K+
Sbjct  61   MFNHAKSTPINLHDDIKPRVLAFLHKTFEKYGQESFIWLGPRPTVMITEPELVKEVMTKF  120

Query  400  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
             L+QKP+N NPL + L +GL SYE ++W+KHR+++NPAF+ EK KLM PAF LSC E+L+
Sbjct  121  NLYQKPKNSNPLTKLLAQGLFSYEGDKWSKHRKIINPAFHFEKLKLMIPAFYLSCEEVLN  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E  +  +G    SCE+DVWP+LQ L+ D ISRTAFGSSY+EG+++FEL KEQA ++++
Sbjct  181  KWETSISQQG----SCEMDVWPYLQNLSSDAISRTAFGSSYKEGRKVFELQKEQAEYIIK  236

Query  757  TTRQVYIPGLR  789
              + +YIPG R
Sbjct  237  ALQTIYIPGWR  247



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 175/245 (71%), Gaps = 6/245 (2%)
 Frame = +1

Query  58   LLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            +L  C  + +L +AWR+L WVWFKPKKLEKCL+Q G KGN Y+ L GD+KE++KM  +A+
Sbjct  13   VLFSCAIILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEAL  72

Query  238  SKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
            SKP+  S D + PRV+P++    + YGKNC+ W GP P V I DPEL++EVL K  ++QK
Sbjct  73   SKPIDFSHDMIWPRVMPFFHKTINNYGKNCFAWYGPRPAVVIVDPELIREVLTKNYIYQK  132

Query  415  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIV  594
            P  NPL R    GL  YE ++WAKHRR++NPAF+ +K K M PAF L+ SE+L K + I+
Sbjct  133  PPGNPLTRLAANGLAGYEADKWAKHRRIVNPAFHLDKLKHMLPAFQLTSSELLKKWKEII  192

Query  595  YGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY  774
              +GS     E+DVWP+LQ LT D ISRTAFGSSYEEGK+IFEL KEQ   L++  R +Y
Sbjct  193  SKEGS-----EIDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMGLLLQVARSLY  247

Query  775  IPGLR  789
            IPG R
Sbjct  248  IPGWR  252



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 174/237 (73%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + LL +AWR+L WVW +PKKLE+CL+Q GL GN YR+L GD +E+++M S+A S+ ++LS
Sbjct  13   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISLS  72

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  KY  F+KP  +PLG+
Sbjct  73   DDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAFRKPPPHPLGK  132

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             L  GLV+ E EQW K R+++NPAF+ EK K M PAF LSCS+M++K E     K S   
Sbjct  133  LLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSDMVNKWE----KKLSKDG  188

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+D+WP L+ L  D ISRTAFGSSYEEG+RIF+L KEQA   V+  R VYIPG R
Sbjct  189  SCELDIWPDLENLAGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWR  245



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   277 bits (709),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 171/235 (73%), Gaps = 4/235 (2%)
 Frame = +1

Query  85   LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  264
            ++ +AWRVL WVW +PKKLE+CL+Q GL GN YR+L GD KE   M  +A SKPM L  +
Sbjct  19   IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLFHD  78

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  444
            +APRV+P+     + YGKN ++W+GP P V I +PE +K++  KYE FQKP  NPL + L
Sbjct  79   LAPRVLPFVHQSMNTYGKNSFIWIGPTPRVNISNPEDMKDIFAKYEDFQKPVKNPLVKLL  138

Query  445  VRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSC  624
              GL +YE E+WAKHR+++NPAF+SEK K M PAF  SCSE++ + E +   +G    SC
Sbjct  139  ATGLANYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSELIEEWESLASKEG----SC  194

Query  625  EVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            E+DVWP+LQ LT DVISRTAFGSSYEEG++IF+LLK+QA   ++  + VYIPG R
Sbjct  195  ELDVWPYLQNLTADVISRTAFGSSYEEGRKIFQLLKDQAQLTIKAIQSVYIPGWR  249



>emb|CBI22139.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 176/246 (72%), Gaps = 9/246 (4%)
 Frame = +1

Query  64   GVCVSVGLLAFA----WRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASD  231
             V +S G L       WR+L WVW +PK+LE+CL++ GL GN YR+L GD KE+  M  +
Sbjct  5    SVAISFGFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSMMLKE  64

Query  232  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  411
            A S+P++LSD++APRV+P++ H   KYGKN + W GP PMV I +PEL++++L K  +FQ
Sbjct  65   AYSRPISLSDDIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNIMEPELIRDILLKSNVFQ  124

Query  412  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
            KP  +PLG+ LV GLV+ E E+WAK R+ +NPAF+ EK K M PAF LSCS+M++K + +
Sbjct  125  KPPPHPLGKLLVSGLVTLEGERWAKRRKNINPAFHLEKLKNMLPAFHLSCSDMVTKWKML  184

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
              G      SCE+DVWP+L+ LT DVISRTAFGSSYEEG+RIF+L KEQ    ++ T  V
Sbjct  185  SVGG-----SCELDVWPYLENLTGDVISRTAFGSSYEEGRRIFQLQKEQTHLAIQVTMSV  239

Query  772  YIPGLR  789
            YIPG R
Sbjct  240  YIPGWR  245



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 170/239 (71%), Gaps = 5/239 (2%)
 Frame = +1

Query  70   CVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  249
             +++ LL   W VL W+WF+PKKLEK LK+ G+KGN Y IL GD KEL     +  SK M
Sbjct  14   VIAITLLLCIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIKEVTSKSM  73

Query  250  TL-SDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++  D++APR +P++     KYGK  ++W+GP P+VFI DP+L+KEV  K  ++QK + N
Sbjct  74   SVYDDDIAPRSLPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTN  133

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL + L +GLV  E ++WAKHR+++NPAF+ EK K M PAF LSC+EMLSK E +V    
Sbjct  134  PLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFYLSCTEMLSKWEDVV----  189

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            S   S E+DVWPHLQ LT DVISRTAFGSSYEEG+RIFEL  EQA + +E  R VYIPG
Sbjct  190  SVERSHEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPG  248



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 168/233 (72%), Gaps = 4/233 (2%)
 Frame = +1

Query  85   LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  264
            ++ +AWRVL WVW +PKKLE+CL+Q GL GN YR+L GD KE   M  +  SKPM L  +
Sbjct  19   IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMVKETKSKPMDLCHD  78

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  444
            +APRV+P+     + YGKN ++W+GP P V I +P+ +K++  KYE FQKP  NPL   L
Sbjct  79   LAPRVLPFVHQSMNTYGKNFFIWIGPTPRVNISNPDDMKDIFAKYEDFQKPATNPLVNLL  138

Query  445  VRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSC  624
              GL SYE E+WAKHR+++NPAF+SEK K M PAF  SCSEM+ K E +   +G    SC
Sbjct  139  ATGLSSYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSEMIEKWESLASKEG----SC  194

Query  625  EVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            E+DVWP+LQ LT DVISRTAFGSSYEEG++IF+LLK+Q    ++T + VYIPG
Sbjct  195  ELDVWPYLQNLTADVISRTAFGSSYEEGRKIFQLLKDQGQLTMKTIQSVYIPG  247



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 174/250 (70%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME++Y+L+ V  +  L+  +WR+L W WFKPKKLEKCL+Q GL+GN Y ++ GDMKE V+
Sbjct  1    MEILYSLVAVLSASFLVILSWRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMKETVR  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM  ++++  RV+P+       YG+N Y W GPMP V +  PE +KEV+NK 
Sbjct  61   MTQEAKSKPMNFTNDIVSRVMPFIDKTIKTYGENSYTWAGPMPAVLLMYPEHIKEVMNKS  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              + KP  NPL + L  GL +YE ++W+KHR+L++PAF+ EK K M PAF  SC EM+SK
Sbjct  121  FNYLKPPGNPLTKLLATGLANYETDKWSKHRKLISPAFHLEKVKFMLPAFRWSCFEMVSK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +V    S   SCE+DVWP LQ LT DVISRTAFGS+YEEG++IFEL KEQA  ++  
Sbjct  181  WEQLV----SEKESCELDVWPELQTLTSDVISRTAFGSNYEEGQKIFELQKEQAELILLA  236

Query  760  TRQVYIPGLR  789
             R  Y+PG R
Sbjct  237  ARSPYVPGWR  246



>ref|NP_001291324.1| cytochrome P450 CYP72A219-like [Sesamum indicum]
 gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 169/250 (68%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME + + L +      L +AW++L WVWF+P+KLEK L+Q G KGN Y++  GD  EL  
Sbjct  1    METLLSSLALISCAVALVYAWKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKA  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM+ S  + PRV P        YG+  ++W GP P V + DPE+V+E+L+K 
Sbjct  61   MTKEAKSKPMSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKS  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +FQ P  NP  R L RG+ SYE ++WAKHRRL+NPAF+ EK K M PAF LSC++MLSK
Sbjct  121  YVFQMPGGNPTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADMLSK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  +G     CE+DVWP+LQ LT D ISRTAFGSSYEEG+RIFEL KEQA  ++E 
Sbjct  181  WEKIVPREG----LCELDVWPYLQTLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEA  236

Query  760  TRQVYIPGLR  789
             R V IPG R
Sbjct  237  LRTVCIPGSR  246



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 180/247 (73%), Gaps = 7/247 (3%)
 Frame = +1

Query  58   LLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            L  V VS   + LL FAWR+L WVW +PKKLE+CL++ GL GN YR+L GD +E+ +M +
Sbjct  3    LSSVAVSFAFITLLIFAWRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRMNN  62

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            +A S P++ SD++  RV+P++ H   KYGKN + W+GP P+V I +PEL+++VL K+ +F
Sbjct  63   EANSGPISFSDDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHNVF  122

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            QKP  +PLG+ L  G+V+ E EQW K R+++NPAF+ EK K M  AF LSCS+M++K E 
Sbjct  123  QKPPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWE-  181

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
                K S   SCE+D+WP+LQ LT DVISRTAFGSSYEEG+RIF+L KEQA  + + T+ 
Sbjct  182  ---KKLSMDDSCELDIWPYLQILTGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQS  238

Query  769  VYIPGLR  789
            VY+PG R
Sbjct  239  VYVPGWR  245



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 173/241 (72%), Gaps = 6/241 (2%)
 Frame = +1

Query  70   CVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  249
            C  + +L +AWR+L WVWFKPK LEKCL+Q G KGN Y+ L GD+KE++KM  +A+SKP+
Sbjct  19   CAIILVLIWAWRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPI  78

Query  250  TLSDNVA-PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
              S ++  PRV+P++    + YGKNC+ W GP P V I DPEL++EVL+K  ++QKP  N
Sbjct  79   DFSHDMTWPRVMPFFHKTINNYGKNCFGWYGPRPAVVIVDPELIREVLSKNYIYQKPPGN  138

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL R    GL  YE ++WAKHRR++NP F+ +K K M PAF L+ SEML+K + I+  +G
Sbjct  139  PLTRLAANGLAGYEADKWAKHRRIINPGFHLDKLKHMLPAFQLTSSEMLNKWKEIISKEG  198

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            S     E+DVWP+LQ LT D ISRTAFGSSYEEGK+IFEL KEQ   L++  R +YIPG 
Sbjct  199  S-----EIDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMELLLQVARSLYIPGW  253

Query  787  R  789
            R
Sbjct  254  R  254



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 175/248 (71%), Gaps = 6/248 (2%)
 Frame = +1

Query  52   YTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASD  231
            YT+   C+ + ++  +W+ L WVWF+P+KLEK LK+ G +GNPY++L GD+KE+  +  +
Sbjct  9    YTVYSSCLLLVVVGVSWKALNWVWFRPRKLEKRLKEQGFRGNPYKLLHGDIKEMSTLHKE  68

Query  232  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  411
            A SK + LSD++ PRVIP Y     KYGK  Y+W+GP P + I DPE VKE+  K  +FQ
Sbjct  69   AQSKNLNLSDDIVPRVIPQYLGAVKKYGKKTYLWLGPKPAMVIMDPEQVKEITQKVYVFQ  128

Query  412  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
            KP  NPL R L  G+V YE ++W +HR+LLNPAF+ EK KLM PAF  S SE+++K E +
Sbjct  129  KPHGNPLRRMLTPGIVMYEGDKWTQHRKLLNPAFHIEKLKLMLPAFHKSASEVVNKWEKV  188

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
            V  KGS+    EVDVWP+LQ LT D ISRTAFGS+YEEG+RIFEL +EQA H+VE    V
Sbjct  189  VSPKGSA----EVDVWPNLQALTSDAISRTAFGSNYEEGRRIFELQREQAEHIVEAGGSV  244

Query  772  --YIPGLR  789
              YIPG R
Sbjct  245  YIYIPGFR  252



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 175/249 (70%), Gaps = 7/249 (3%)
 Frame = +1

Query  46   VIYTLLGVC--VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            V + ++  C  +++ LL   WRVL W+WF+PKKLEK LK+ G+KGN Y IL GD KEL  
Sbjct  4    VQFIVISSCSAIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSL  63

Query  220  MASDAISKPMTL-SDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
               +  SK M+L  D++A R +P++     KYGK  ++W+GP P+VFI DP+L+KEV  K
Sbjct  64   RIKEVTSKSMSLYDDDIAQRSMPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTK  123

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
              ++QK + NPL + L +GLV  E ++WAKHR+++NPAF+ EK K M PAF LSC+EMLS
Sbjct  124  TYIYQKTKTNPLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLS  183

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E IV    S   + E+DVWPHLQ LT DVISRTAFGSSYEEG+RIFEL  EQA + +E
Sbjct  184  KWEDIV----SVERAYEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIE  239

Query  757  TTRQVYIPG  783
              R VYIPG
Sbjct  240  AVRSVYIPG  248



>emb|CAN72247.1| hypothetical protein VITISV_024665 [Vitis vinifera]
Length=288

 Score =   267 bits (682),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 174/246 (71%), Gaps = 9/246 (4%)
 Frame = +1

Query  64   GVCVSVG----LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASD  231
             V +S G    L++  WR+L WVW +PK+LE+CL + GL GN YR+L GD KE+  M  +
Sbjct  46   SVAISFGFLTVLISCLWRLLNWVWLRPKRLERCLXEQGLAGNSYRLLHGDFKEMSMMLKE  105

Query  232  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  411
            A S+P++LSD++APRV+P++ H   KYGKN + W GP PMV I +PEL+++ L K  +FQ
Sbjct  106  AYSRPISLSDDIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNIMEPELIRDXLLKSNVFQ  165

Query  412  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
             P  +PLG+ LV GLV+ E E+WAK R+ +NPAF+ EK K M PAF LSCS+M++K + +
Sbjct  166  XPPPHPLGKLLVSGLVTLEGERWAKRRKNINPAFHLEKLKNMLPAFHLSCSDMVTKWKML  225

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
              G      SCE+DVWP+L+ LT DVISRTAFGSSYEEG+RIF+L KEQ     + T  V
Sbjct  226  SVGX-----SCELDVWPYLENLTGDVISRTAFGSSYEEGRRIFQLQKEQTHLAXQVTMSV  280

Query  772  YIPGLR  789
            YIPG R
Sbjct  281  YIPGWR  286



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 173/250 (69%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME    + G  + + +L +AW++L W+W +PKKLEK L++ GLKGNPYR+L GDMKE  K
Sbjct  1    MEATSAIFGCIILLIMLVWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
                A SKPM LSD++  RV PY      K+GKN ++W GP P V + DPELVK+V NK 
Sbjct  61   SEMKARSKPMNLSDDIVSRVFPYGQQTVTKHGKNSFIWFGPTPRVILTDPELVKDVFNKM  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              FQKP +NPL R L  GL+++E+E+W  HR+++NPAF+ EK K+M P    SC++M++K
Sbjct  121  YDFQKPNSNPLIRLLATGLITHEEEKWRMHRKIINPAFHLEKLKMMLPVIFESCNDMINK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E ++    SS  SCE+DVWP +Q L  DVI+RTAFGSSYEEG RIF+L KEQA   +E 
Sbjct  181  WERML----SSDGSCEIDVWPSIQNLASDVIARTAFGSSYEEGIRIFQLQKEQAEITMEI  236

Query  760  TRQVYIPGLR  789
              +VYIPG R
Sbjct  237  LMKVYIPGWR  246



>emb|CAN72443.1| hypothetical protein VITISV_032856 [Vitis vinifera]
Length=245

 Score =   265 bits (678),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 172/239 (72%), Gaps = 4/239 (2%)
 Frame = +1

Query  73   VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  252
            V + LL +AWR+L WVW +PKKLE+CL+Q GL GN Y  L GD KE+ +M ++A S+P++
Sbjct  11   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPIS  70

Query  253  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  432
             SD++  RV+P++ H   KYGKN + W+GP P+V I +PEL+++V  K+  FQK   +PL
Sbjct  71   FSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAFQKVPPHPL  130

Query  433  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSS  612
            G+ L  G+V+ E EQW K R+++NPAF+ EK K M  AF LSCS+M++K E     K S 
Sbjct  131  GKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWE----KKLSL  186

Query  613  SCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
              SCE+DVWP+L+ L  DVISRTAFGSSYEEG+RIF+L +EQA   ++ TR +Y+PG R
Sbjct  187  DGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWR  245



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 179/249 (72%), Gaps = 6/249 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            +++TLL  C  + + ++AW+   WVW  P+KLEKCL++ G+KG  Y+ LSG++K++V   
Sbjct  5    ILFTLLVTCAVIYISSWAWKAFVWVWLNPRKLEKCLREQGIKGPSYKFLSGNLKDIVSAT  64

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYE  402
             +A +KPM LS  + PRV+P+     +KYGK  ++W GP   V I DP++++++L NK+ 
Sbjct  65   QEARAKPMELSHKIVPRVMPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDMIRDILSNKFG  124

Query  403  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*  582
             F+K R NPLG+ L+ G+VSYE E+W KHRR+LNPAF+ EK K+M PA   SCSEM++K 
Sbjct  125  HFEKIRTNPLGKLLISGVVSYEGEKWVKHRRILNPAFHLEKLKMMLPAIYTSCSEMVNKW  184

Query  583  EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETT  762
            E +V     S  SCE+DVWPHLQ LT DVISRTAFGSSYEEG+RIF+L  EQA  +++  
Sbjct  185  EMMV-----SQDSCELDVWPHLQNLTADVISRTAFGSSYEEGRRIFQLQSEQAGLVIKAL  239

Query  763  RQVYIPGLR  789
            + +YIPGLR
Sbjct  240  QSIYIPGLR  248



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 174/239 (73%), Gaps = 4/239 (2%)
 Frame = +1

Query  73   VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  252
            V + LL +AWR+L WVW +PKKLE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++
Sbjct  22   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  81

Query  253  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  432
             SD++  RV+P++ H   KYGKN ++W+GP P+V I  PEL+ +VL K+  FQK   +PL
Sbjct  82   FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELISDVLLKHNAFQKAPRHPL  141

Query  433  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSS  612
             + L  G+ S E EQW K R+++NPAF+ EK K M  AF LSCS+M++K E  +   G  
Sbjct  142  RKLLASGIASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKQLSLDG--  199

Query  613  SCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
              SCE+D+WP+LQ LT DVISRTAFGSSYEEG+RIF+L KEQA+  V+ TR VY+PG R
Sbjct  200  --SCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLAVQVTRSVYVPGWR  256



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/254 (50%), Positives = 184/254 (72%), Gaps = 8/254 (3%)
 Frame = +1

Query  40   MEVI---YTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            MEVI   Y ++G C++  +L + WR+L W + +PK+LEK L++ GL GN Y  L GD+KE
Sbjct  1    MEVILILYKIIGACLAFVVLFYTWRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDLKE  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
            ++ M + A S P+ L D++ PRV+ +      KYGK  ++W+GP P V I +PEL+KEV+
Sbjct  61   MLNMINHAKSHPINLDDDIKPRVLAFIHKTFLKYGKGSFIWLGPRPAVMITEPELIKEVM  120

Query  391  NKYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSE  567
             K  L+QKP+N NPL + L +G+V+YE ++WAKHR+++NPAF+ EK KLM PAF LSC E
Sbjct  121  TKINLYQKPKNSNPLTKLLAQGVVAYEGDKWAKHRKIINPAFHFEKLKLMIPAFYLSCDE  180

Query  568  MLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMH  747
            +L+K E  + GKGS     EVDVWP+LQ L+ D ISRTAFGSSY+EG+++FEL +EQA +
Sbjct  181  VLNKWEKSLSGKGSG----EVDVWPYLQNLSSDAISRTAFGSSYKEGRKVFELQREQAEY  236

Query  748  LVETTRQVYIPGLR  789
            +++ ++ +YIPG R
Sbjct  237  IIKASQTIYIPGWR  250



>ref|XP_004295683.1| PREDICTED: cytochrome P450 CYP72A219-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 177/243 (73%), Gaps = 6/243 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            V VS+ ++ +AW +L WVWFKPKKLE+CL+Q G +GN YR+  GDMKE   M  +A SKP
Sbjct  14   VFVSI-IVRWAWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMKENAIMVKEAKSKP  72

Query  247  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            M LS   +++PRVIP        YGKN +VW+GP+P V I +PE +K+V  K   F KP 
Sbjct  73   MNLSTSHDISPRVIPLLDQTVKTYGKNSFVWVGPLPRVNIMNPEDLKDVFAKPSDFPKPV  132

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
            +NPL + L  GL +YE E+WAKHRR++NP F+SEK K M PAF  SC++M+ + E +V  
Sbjct  133  SNPLIKLLSTGLANYEGEKWAKHRRIINPTFHSEKVKRMLPAFYQSCNDMIKEWETVVSK  192

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
            +GS   SCE+DVWP LQ LT DVISRTAFGSSY+EG++IFELLKEQA++ ++T ++VYIP
Sbjct  193  EGS---SCEIDVWPSLQNLTADVISRTAFGSSYQEGQKIFELLKEQAVYAMKTVQRVYIP  249

Query  781  GLR  789
            G R
Sbjct  250  GWR  252



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 179/251 (71%), Gaps = 6/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME++Y+L+ V   V +   AWR L WVW +P+K+EK L++ G  GN YR L GD KE+  
Sbjct  1    MEILYSLVAVIFGVFVSVNAWRFLNWVWLEPRKVEKRLREQGFNGNSYRFLVGDSKEMSS  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKP+  S+++  RV+P+  H   KYG+NC++W GP P   I DPE++KE+++K 
Sbjct  61   MGEEAQSKPINFSNDIVHRVMPFIHHSLHKYGENCFIWFGPKPAALISDPEMIKEIMSKN  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +FQK  +NPL + L +G+ +YE ++W KHRRL+NPAF+ EK K M P+F LSC++MLSK
Sbjct  121  YVFQKI-SNPLDQLLAKGVAAYEADKWDKHRRLINPAFHLEKLKHMVPSFYLSCADMLSK  179

Query  580  -*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
              E IV  +G    SCEVDVWP+LQ ++ DVISRTAFGS+YEEG++IFEL +EQ  HL++
Sbjct  180  WDEKIVAKEG----SCEVDVWPYLQSMSSDVISRTAFGSNYEEGRKIFELQREQEEHLLQ  235

Query  757  TTRQVYIPGLR  789
              + +YIPG R
Sbjct  236  ALQTLYIPGWR  246



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + LL +AWR+L WVW +PKKLE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++ S
Sbjct  13   IVLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEMINEANSRPISFS  72

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  RV+P++ H   KYGKN + W GP P+V+I +PEL+++VL K+ +FQKP  +PL +
Sbjct  73   DDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHNVFQKPPPHPLSK  132

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             L  G+V+ E EQW K R+++NPAF+ EK K M  AF LSCS+M++K E     K S   
Sbjct  133  LLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWE----KKLSLDG  188

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+DVWP+L+ L  DVISRTAFGSSYEEG+RIF+L +EQA   ++ TR +Y+PG R
Sbjct  189  SCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWR  245



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 168/234 (72%), Gaps = 4/234 (2%)
 Frame = +1

Query  88   LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  267
            L +AW++L W+W KPKKLEK L++ GLKGN YR+L GD+++L+KM  +  SKPM LSD++
Sbjct  17   LIWAWKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLKMRKETTSKPMNLSDDI  76

Query  268  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  447
            APRV  Y+ H   KYGKN ++W GP P V I DPEL+K VLNK   FQKP  +PL R L 
Sbjct  77   APRVFSYFHHSVAKYGKNSFMWFGPTPRVNISDPELIKYVLNKIYDFQKPNASPLVRLLA  136

Query  448  RGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCE  627
             GLV+ E E+W+KHR+L+NPAF  EK K+M P F  SC ++++K E ++    SS  SCE
Sbjct  137  NGLVNLEGEKWSKHRKLINPAFNIEKLKIMLPIFFKSCDDLITKWERML----SSDGSCE  192

Query  628  VDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +DVWP LQ L  DVISRTAFGSSYEEGKRIF+L  EQA    +   QV+IPG R
Sbjct  193  LDVWPFLQNLASDVISRTAFGSSYEEGKRIFQLQIEQAELTKKVMIQVFIPGWR  246



>emb|CBI39916.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + LL +AWR+L  VW KPKK+E+ L+Q GL GN YR+L GD +E+ +M  +A S+P++LS
Sbjct  13   ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISLS  72

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  RV+P++ H   KYGKNC++WMGP P+V I +PEL+++VL K+  FQKP  +PLG+
Sbjct  73   DDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPVHPLGK  132

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             L  G+++ E EQW K R+++NPAF+ EK K M PAF LSCSEM++K E     K S   
Sbjct  133  LLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSEMVNKWE----KKLSKDG  188

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+D+WP L+ L  DVISRTAFGSSYEEG+RIF+L KEQA   V+ ++ +YIPG R
Sbjct  189  SCELDIWPDLENLAGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSIYIPGWR  245



>emb|CBI22133.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 174/237 (73%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + LL +AWR+L WVW +PKKLE+CL+Q GL GN YR+L GD +E+++M S+A S+ ++LS
Sbjct  83   ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISLS  142

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  RV+P++ H   KYGKN ++WMGP P+V I DPEL+++V  KY  F+KP  +PLG+
Sbjct  143  DDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAFRKPPPHPLGK  202

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             L  GLV+ E EQW K R+++NPAF+ EK K M PAF LSCS+M++K E     K S   
Sbjct  203  LLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSDMVNKWE----KKLSKDG  258

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+D+WP L+ L  D ISRTAFGSSYEEG+RIF+L KEQA   V+  R VYIPG R
Sbjct  259  SCELDIWPDLENLAGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWR  315



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + LL +AWR+L  VW KPKK+E+ L+Q GL GN YR+L GD +E+ +M  +A S+P++LS
Sbjct  13   ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISLS  72

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  RV+P++ H   KYGKNC++WMGP P+V I +PEL+++VL K+  FQKP  +PLG+
Sbjct  73   DDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPVHPLGK  132

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             L  G+++ E EQW K R+++NPAF+ EK K M PAF LSCSEM++K E     K S   
Sbjct  133  LLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSEMVNKWE----KKLSKDG  188

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+D+WP L+ L  DVISRTAFGSSYEEG+RIF+L KEQA   V+ ++ +YIPG R
Sbjct  189  SCELDIWPDLENLAGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSIYIPGWR  245



>ref|XP_010645072.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=390

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 172/233 (74%), Gaps = 4/233 (2%)
 Frame = +1

Query  73   VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  252
            V + LL +AWR+L WVW +PKKLE+CL+Q GL GN YR+L GD +E+ +M ++A S+P++
Sbjct  22   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  81

Query  253  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  432
             SD++  RV+P++ H   KYGKN ++W+GP P+V I  PEL+++VL K+  FQKP  +PL
Sbjct  82   FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAFQKPPPHPL  141

Query  433  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSS  612
            G+ L  G+ S + EQW K R+++NPAF+ EK K M  AF LSCS+M++K E  +   G  
Sbjct  142  GKLLASGISSLDGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKQLSLDG--  199

Query  613  SCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
              SCE+D+WP+LQ LT DVISRTAFGSSYEEG+RIF+L KEQA+  V+ TR V
Sbjct  200  --SCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSV  250



>emb|CDP19607.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 166/235 (71%), Gaps = 6/235 (3%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
            A +W+ L WVWF+PKKLEK LK+ G +GNPY++L GD KE+  + ++A SK + LSD++ 
Sbjct  24   AVSWKALNWVWFRPKKLEKLLKEQGFRGNPYKLLHGDFKEMSTLYTEAQSKNLNLSDDIV  83

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRVIP Y     KYGKN Y+W GP P V I DP L+K V  K + F+K   NPLGR + +
Sbjct  84   PRVIPQYLGAVKKYGKNTYLWFGPAPAVVIMDPNLIKAVTQKIDDFRKLPVNPLGRLVAQ  143

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GLVSYE E+WAK R+LLNPAF+ EK KLM PAF  S SEM++K E +V  KG      EV
Sbjct  144  GLVSYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVTKWENVVSPKG----LAEV  199

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY--IPGLR  789
            DVWP+L+ LT D ISRTAFGS+YEEG+RIFEL +EQ   ++E  R VY  IPG R
Sbjct  200  DVWPNLKALTSDAISRTAFGSNYEEGRRIFELQREQTEDVMEAARSVYINIPGFR  254



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 178/251 (71%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+ Y  +    S   +L  AWRVL W W +PKKLEK LK+ GLKGNPYR+L GD KE+ 
Sbjct  1    MEIGYIRIAAISSCAVILVLAWRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEIS  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             +  +A SKP+ LSD++ PR++P +     KYGK+ YVW+GP PMV+I +PEL++EV+ K
Sbjct  61   TLIREAQSKPINLSDDILPRILPAFPDALKKYGKSTYVWLGPTPMVYILEPELIREVMQK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
              LFQKPR NPL   L+ GLV+Y+ ++WAK R+L+NPAF+ EK K M P+F  S S++L+
Sbjct  121  IYLFQKPRLNPLSLLLIEGLVNYDGDKWAKQRKLINPAFHVEKLKHMLPSFYTSASDILN  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K + +V   GSS    E+DVWP L+ LT D ISRTAFGS+YEEG+RIFEL +EQ+ + ++
Sbjct  181  KWKEVVAPNGSS----ELDVWPDLETLTSDAISRTAFGSNYEEGRRIFELQREQSEYWLK  236

Query  757  TTRQVYIPGLR  789
              + V IPG R
Sbjct  237  VVQSVDIPGWR  247



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 167/231 (72%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
            +W+VL W+W +PK+LEK L++ G +GNPY +  GD KE +KM  +A+SKPMTLSD++ PR
Sbjct  20   SWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPR  79

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            V  Y  H  +K+GKN ++W GPMP V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATGL  139

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
              YE E+W+KHRR++NPAF  EK K+M P FL SC++++SK EG++    SS  SCE+D 
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGML----SSEGSCEMDA  195

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            WP LQ LT DVI+R+AFGSSYEEG+RIF+L +EQ  HL++   ++ IPG R
Sbjct  196  WPFLQNLTSDVIARSAFGSSYEEGRRIFQLQREQTEHLMKVILKIQIPGWR  246



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 172/253 (68%), Gaps = 7/253 (3%)
 Frame = +1

Query  40   MEVIYTLLGV---CVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            ME+ Y+ + V   C+ + +   AWR   W W  PKKLEK LK+ GL+GNPY++L GD KE
Sbjct  1    MEIAYSPIAVFSSCILLLISVLAWRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKE  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
            +     +A SKP+ +S++  PRVIP++     KYG+N Y+W GP PMV I +PE ++E+ 
Sbjct  61   IATHFKEAHSKPINVSEDFIPRVIPHFCAAVKKYGENTYIWHGPKPMVLILNPEHIREIT  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
             K  +FQK   NPL + L  GLVSY+ ++WAKHR+L+ PAF+ EK K M P+F  S SEM
Sbjct  121  TKLYIFQKAPANPLTKLLATGLVSYDGDKWAKHRKLITPAFHVEKLKHMVPSFYASASEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            L K E IV    S++ SCE+DVWP +Q LT D ISRTAFGS+Y+EGKRIFEL +EQA H 
Sbjct  181  LDKWEAIV----STNGSCELDVWPDIQTLTSDAISRTAFGSNYQEGKRIFELQREQAEHF  236

Query  751  VETTRQVYIPGLR  789
            ++    VYIPG R
Sbjct  237  LKAVESVYIPGWR  249



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + +L +AWR+L W+W +PK+LE+CLKQ GL GN YR+L GD KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEATSRPISIS  75

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  R+ P++ H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             LV GL+  + E+WAKHR+++NPAF  EK K M PAF LSCS+M+SK E    GK S+  
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKVKNMLPAFHLSCSDMISKWE----GKLSTEG  191

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+DVWP+LQ LT D ISRTAFGS+YEEG+ IFEL +EQA  LV+ +   +IPG R
Sbjct  192  SCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWR  248



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + +L +AWRVL W+W +PK+LE+CLKQ GL GN YR+L GD KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISIS  75

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  RV P++ H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRVAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             LV GL+  + E+WAKHR+++NPAF  EK K M PAF LSCS+M+SK E    GK S+  
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWE----GKLSTEG  191

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+DVWP+LQ LT D ISRTAFGS+YEEG+ IFEL +EQA  LV+ +   +IPG R
Sbjct  192  SCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWR  248



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 175/253 (69%), Gaps = 7/253 (3%)
 Frame = +1

Query  40   MEVIYTLLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            ME  ++ +   VS   V L   AWRVL W WF+PKKL+K LKQ G KGNPY+++ GD+K+
Sbjct  1    MEEAHSFMIALVSSCCVVLSVLAWRVLNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDLKQ  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
            +  +  +A SKP++LSD + PR+ P++    +KYGKN Y+W GP PM+ I DPEL+++V 
Sbjct  61   ISSLFQEANSKPISLSDGIVPRIAPHFLEAVNKYGKNTYLWSGPRPMMLIMDPELIRKVT  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
             K ++FQK + +P    LV G++ YE E+W K R+LLN AF+ EK KLM PAF  S  EM
Sbjct  121  QKMDIFQKVKFHPQASLLVAGILGYEGEKWVKQRKLLNQAFHMEKLKLMVPAFYKSACEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            LSK E ++  KG    S EVDVWP +Q +T D ISRTAFGS YEEG++IFEL +EQA HL
Sbjct  181  LSKWEEMISVKG----SFEVDVWPTIQTMTSDAISRTAFGSRYEEGRKIFELQREQAGHL  236

Query  751  VETTRQVYIPGLR  789
            V  TR +YIPG R
Sbjct  237  VLATRSIYIPGSR  249



>emb|CBI22131.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + +L +AWR+L W+W +PK+LE+CLKQ GL GN YR+L GD+KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISIS  75

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  R+ P+  H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             LV GL+  + E+WAKHR+++NPAF  EK K M PAF LSCS+M+SK E    GK S+  
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWE----GKLSTEG  191

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+DVWP+LQ LT D ISRTAFGS+YEEG+ IFEL +EQA  LV+ +   +IPG R
Sbjct  192  SCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWR  248



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 169/248 (68%), Gaps = 4/248 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            V    L V +   ++  AWRVL WVW +PKKLE+CL+Q GL GN YR+L GD KE   M 
Sbjct  6    VASVALRVFLVSTVITLAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMV  65

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A SKPM LS ++ PRV+P+       YGKN ++W+GP P V I +P  VK+V   YE 
Sbjct  66   KEAKSKPMNLSHDITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYED  125

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            FQKP  NPL + L  GL +YE E+WAKHR+++NPAF+ EK K M PAF LSCSEM+ + E
Sbjct  126  FQKPVINPLVKLLATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHLSCSEMIEEWE  185

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTR  765
             +V  +G    SCE+DVWP+L+ L  DVISR +FGSSY+EG++IF+LLKEQA   +   +
Sbjct  186  RLVSKEG----SCELDVWPYLESLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQ  241

Query  766  QVYIPGLR  789
             VYIPG R
Sbjct  242  SVYIPGWR  249



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 175/245 (71%), Gaps = 4/245 (2%)
 Frame = +1

Query  55   TLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
            +++ V V + L ++AWR+L W+W +PK+LE+ L++ GL+GNPYRIL GD+KE+VK+  +A
Sbjct  11   SIVFVIVILALTSWAWRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEA  70

Query  235  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
             SKPM LS ++ PRV  +      K+GKN ++W GP P V + DPEL+K+VLNK   F+K
Sbjct  71   RSKPMNLSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRK  130

Query  415  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIV  594
            P  NPL + L  GLV+Y+ E+W KHRRL+NPAF  EK K+M P F  SC++++ K EG++
Sbjct  131  PEANPLAKLLATGLVNYDGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWEGML  190

Query  595  YGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY  774
               G    SCE+DVWP LQ L  DVI+RTAFGSS+EEGKRIF+L KE A   ++   +VY
Sbjct  191  SYDG----SCEMDVWPFLQNLASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVY  246

Query  775  IPGLR  789
            IPG R
Sbjct  247  IPGWR  251



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 174/255 (68%), Gaps = 10/255 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +S    + +L +AW++L +VW KPK+LEK L+Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKIAISSFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMK  60

Query  208  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  384
            E+ KM  +A+SKP+  S D + PRV+P+       YGKNC VW GP P V I DPELVKE
Sbjct  61   EMKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKE  120

Query  385  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCS  564
            VL K  ++QKP  NPL +    G+  YE ++WA HRRLLNPAF+ +K K M PAF  + S
Sbjct  121  VLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTAS  180

Query  565  EMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            EMLSK E +V   G+     E+DVWP+LQ LT D ISRTAFGSSYEEG++IF+L KEQ  
Sbjct  181  EMLSKLEKVVSPNGT-----EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLS  235

Query  745  HLVETTRQVYIPGLR  789
             ++E +R +YIPG R
Sbjct  236  LILEVSRTIYIPGWR  250



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 175/237 (74%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + +L +AWR+L W+W +PK+LE+CLKQ GL GN YR+L GD+KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISIS  75

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  R+ P+  H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+KPR + L +
Sbjct  76   DDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             LV GL+  + E+WAKHR+++NPAF  EK K M PAF LSCS+M+SK E    GK S+  
Sbjct  136  LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWE----GKLSTEG  191

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+DVWP+LQ LT D ISRTAFGS+YEEG+ IFEL +EQA  LV+ +   +IPG R
Sbjct  192  SCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIPGWR  248



>gb|EYU31631.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=380

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 173/241 (72%), Gaps = 5/241 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME+I++ L +C +V ++ +AW+++ +VWF+PKK+EK L+Q G  G PYR L GD+ E+  
Sbjct  1    MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M ++A+SKP+  SD+  PR+IP+       +G+NC++W+GP P V I DP++V+EVL+K 
Sbjct  61   MGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKT  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +FQKP  NPL   L RGL SYE ++WAKHRRL+NPAF+ +K K M P+F   C+EMLSK
Sbjct  121  YVFQKPY-NPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCAEMLSK  179

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  +G      E+DVWP+LQ +T D IS TAFG+SYE+G++IFEL KEQA  + ++
Sbjct  180  WEKIVPSEG----CFELDVWPYLQTMTSDAISLTAFGTSYEQGRKIFELQKEQATLITKS  235

Query  760  T  762
             
Sbjct  236  N  236



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 176/253 (70%), Gaps = 7/253 (3%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME +  ++   +SV  LL + W+VL W WF+PKKLEK L+Q GL GN YR+L GD+KE  
Sbjct  1    METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  60

Query  217  KMASDAISKPM-TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
            K   +A SKP+  LS+++APR+IPY+     KYGK C+VW GP PM+ I + E ++E+  
Sbjct  61   KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKYGKKCFVWFGPKPMILIMESEQIREIFA  120

Query  394  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K  ++QKP + NP+   L RG+ +YE+++WAKHR++L PAF+ EK KLM PAF LSC EM
Sbjct  121  KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            L + E IV  + S     E+D+WP  Q LT D+ISRTAFGSSYEEG+RIFEL KEQA  +
Sbjct  181  LKEWEKIVPDERSK----ELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEII  236

Query  751  VETTRQVYIPGLR  789
            ++    +YIPG R
Sbjct  237  MKQFNSIYIPGSR  249



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 170/241 (71%), Gaps = 4/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            V ++V ++A AWR+L W+W +PKKLE+ L+Q GL GN YR  +GDMKE+  M   A SKP
Sbjct  13   VGITVIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEISTMIKQAYSKP  72

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++LS ++APRVIP+   L + YGKN +VWMGP P V I DPE +K +L K + F KP  N
Sbjct  73   VSLSHDIAPRVIPFDYQLVNTYGKNYFVWMGPTPRVNITDPEDMKTILTKMDDFPKPXAN  132

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL + L  G+   E E+WAKHRR++NP F+ EK K M P F  SCSEM+ + E +V  +G
Sbjct  133  PLXKLLXTGIALCEGEKWAKHRRIINPVFHIEKLKRMLPEFYQSCSEMIVEWESLVLKEG  192

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
                SCE+DVWP+ + +T DVISRTAFGSSY+EG++IF+LLKEQA   ++  + VYIPG 
Sbjct  193  ----SCELDVWPYFENMTADVISRTAFGSSYKEGRKIFQLLKEQAKLAIKVVQSVYIPGA  248

Query  787  R  789
            R
Sbjct  249  R  249



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 171/241 (71%), Gaps = 4/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
              V V  + +AWR+L W+W +PKKLE+ L++ GL+GNPYR++ GD+K+L+KM  +A SKP
Sbjct  14   TLVIVLAVTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKSKP  73

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            M LSD++ PRV PY      K+GKN ++W GP+P V + DPE +K+VLNK   F K   +
Sbjct  74   MNLSDDILPRVFPYVQQSVTKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFPKSDGD  133

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
             L + L  GLVSYE E+W+KHRR++NPAF  EK K+M P F  SC+++++K EG++    
Sbjct  134  RLVKLLATGLVSYEGEKWSKHRRIINPAFNLEKLKIMLPIFFQSCNDLITKWEGML----  189

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            SS  SCE+D+WP LQ L  DVI+R AFGSSYEEG+RIF+L KEQ  H +    +VYIPG 
Sbjct  190  SSDGSCEMDIWPFLQNLASDVIARAAFGSSYEEGRRIFQLQKEQVEHTMSVLVKVYIPGW  249

Query  787  R  789
            R
Sbjct  250  R  250



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 179/251 (71%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME++Y+++       +L + W+VL W WF PKK+EKCL+Q GLKGNPY++L GD+ EL K
Sbjct  1    MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
               +A SKP+  SD++A R+IP++    +K GKN +VW+GP P+V I DPE +KE+  K 
Sbjct  61   SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  400  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
             ++QK  + NP  + L  GLVS E+++WAKHR++++PAF+ EK K M PAF LSCSEM+S
Sbjct  121  YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMIS  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E +V        S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA ++++
Sbjct  181  KWEEVV----PKETSFELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMD  236

Query  757  TTRQVYIPGLR  789
              R +YIPG R
Sbjct  237  IGRSIYIPGSR  247



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 179/251 (71%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME++Y+++       +L + W+VL W WF PKK+EKCL+Q GLKGNPY++L GD+ EL K
Sbjct  1    MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
               +A SKP+  SD++A R+IP++    +K GKN +VW+GP P+V I DPE +KE+  K 
Sbjct  61   SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  400  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
             ++QK  + NP  + L  GLVS E+++WAKHR++++PAF+ EK K M PAF LSCSEM+S
Sbjct  121  YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMIS  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E +V        S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA ++++
Sbjct  181  KWEEVV----PKETSFELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMD  236

Query  757  TTRQVYIPGLR  789
              R +YIPG R
Sbjct  237  IGRSIYIPGSR  247



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 173/255 (68%), Gaps = 10/255 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +S    + +L +AW++L +VW KPK+LEK L+Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKIAISSFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMK  60

Query  208  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  384
            E  KM  +A+SKP+  S D + PRV+P+       YGKNC VW GP P V I DPELVKE
Sbjct  61   ETKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKE  120

Query  385  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCS  564
            VL K  ++QKP  NPL +    G+  YE ++WA HRRLLNPAF+ +K K M PAF  + S
Sbjct  121  VLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTAS  180

Query  565  EMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            EMLSK E +V   G+     E+DVWP+LQ LT D ISRTAFGSSYEEG++IF+L KEQ  
Sbjct  181  EMLSKLEKVVSPNGT-----EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLS  235

Query  745  HLVETTRQVYIPGLR  789
             ++E +R +YIPG R
Sbjct  236  LILEVSRTIYIPGWR  250



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/250 (51%), Positives = 173/250 (69%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            M++ Y+++GV  SV L  +AW +L WVWFKPKKLEK L+Q GL G+ YR+L GDMKE  +
Sbjct  1    MDMFYSIIGVLCSVFLTIWAWIILNWVWFKPKKLEKYLRQQGLGGSHYRLLFGDMKETAQ  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M   A SKP+  ++++ PR++P+   L    G N   WMGP P + + DPELVKEVL K 
Sbjct  61   MVKQAYSKPINFTNDIVPRILPFVDKLIRSSGTNTLTWMGPSPALLLIDPELVKEVLTKN  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             ++QKPRNNPLG+ L  G  +Y+ ++WAK+RR+++PAF+ EK K M PAF LSCSEMLSK
Sbjct  121  YVYQKPRNNPLGKLLAEGFATYDTDKWAKNRRIISPAFHLEKLKHMVPAFCLSCSEMLSK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E      G    S E+DVWP ++ L  D+ISRTAFGS+YEEG++IFEL  +Q+    + 
Sbjct  181  WENGALADG----SLELDVWPDIRTLAGDMISRTAFGSNYEEGRKIFELQMQQSELFEQA  236

Query  760  TRQVYIPGLR  789
             + +Y+PG R
Sbjct  237  IQSIYVPGWR  246



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 165/233 (71%), Gaps = 4/233 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
             +AWRV+ W+W +PKKLE+ L+Q GL GN YR +SGDMKE+      A SKPM+LS ++A
Sbjct  18   TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRVIP++  L + YGKN +VWMG +P V I +PE +K +L K E+F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLAT  137

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            G+  YE E+WAKHRR++NP F+ EK K M PAF  SCSEM+ + E +V        SCE+
Sbjct  138  GIAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVL----KESSCEL  193

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DVWP+ Q LT DVISRTAFGSSY+EG++IF+LLKEQ   + +  + VYIPG R
Sbjct  194  DVWPYFQNLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYIPGWR  246



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 166/233 (71%), Gaps = 4/233 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
            A AWRVL WVW +PK LEKCL+Q GL GN YR+ SGD++E   M  +A+SKPM LS + A
Sbjct  21   ACAWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMNLSHDTA  80

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRV+P+       YGKN ++W+GP P V I +PE +K++  K+E F KP  NPL + L  
Sbjct  81   PRVLPFVHQSVSTYGKNSFMWIGPTPRVNITNPEDLKDIFTKHEDFPKPALNPLVKLLAT  140

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL +YE ++WAKHRR++NPAF+SEK K M P+F  SCSEM+ + E +V    S   SCE+
Sbjct  141  GLANYEGDKWAKHRRIVNPAFHSEKLKRMLPSFYQSCSEMIEEWESLV----SKDSSCEL  196

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DVWP+LQ +T DVISRT+FGSSY+EG+ IF+LLK Q    ++T + VYIPG R
Sbjct  197  DVWPYLQNVTADVISRTSFGSSYKEGREIFQLLKVQTELAIKTIQSVYIPGWR  249



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 170/248 (69%), Gaps = 4/248 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            M+  Y+L+GV   + LL  AWR L W W  PKK+EK L++ GL+GN YR L GD +++ +
Sbjct  1    MDFFYSLIGVSSVIVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGR  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKP++L+D++ PR++P         GKN + W+GP P + I DPE VKEV  K 
Sbjct  61   MLEEAKSKPISLTDDIFPRIMPLINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTKN  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              +QKPR NP+ + L  GL S + E+WAKHRRLLNPAF+ EK K M PAF LSC+EMLSK
Sbjct  121  FTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFHVEKLKYMVPAFYLSCNEMLSK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +   +G    S E+DVWP+LQ  T DVISRTAFGS+YE+G+RIFEL  EQA++  + 
Sbjct  181  WENLAPAEG----SFELDVWPYLQIFTSDVISRTAFGSNYEKGRRIFELQSEQALYFEQV  236

Query  760  TRQVYIPG  783
             + +Y+PG
Sbjct  237  MQSIYLPG  244



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 178/252 (71%), Gaps = 6/252 (2%)
 Frame = +1

Query  40   MEVIY-TLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME++Y T++ +     LL + WRVL W WF+PKKLE  L+Q GLKGNPY++L GD+ EL 
Sbjct  1    MEILYNTIIAIICVAILLVYTWRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNELT  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
            K   +A SK + +SD++  R+IP++    +K GK+ ++W+GP P V I +PE VKE+L K
Sbjct  61   KSIVEAKSKSINISDDITQRLIPFFLDSINKNGKSSFMWLGPYPTVLITNPEHVKEILTK  120

Query  397  -YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
             Y   ++   NP  + L +GLV  E+++WAKHR+++NPAF+ EK K M PAF +SCSEM+
Sbjct  121  NYVYLKQTHPNPFAKLLAQGLVLVEEDKWAKHRKIINPAFHVEKLKHMLPAFYMSCSEMI  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            SK E IV    S   S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL +EQA H++
Sbjct  181  SKWEDIV----SKETSYELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQQEQAEHIM  236

Query  754  ETTRQVYIPGLR  789
            + +R +YIPG R
Sbjct  237  DISRSIYIPGSR  248



>emb|CBI39884.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 173/248 (70%), Gaps = 4/248 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME+ Y  + +  +  LL+ AWR    VW +P++LE+CL++ GL GN YR L GD K++  
Sbjct  1    MEIAYDSVLIFCAFALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSI  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A S+P+ LSD++ PRVIP+      +YGKN + W+GP+P V I  PEL++EV  + 
Sbjct  61   MLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEA  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              FQK + NPL   L+ GLVSYE E+WAKHR+LLNPAF+ EK KLM PAF LSC +M+SK
Sbjct  121  GRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSCRQMISK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +V  +G    SCE+DVWP L+ LT D +SRTAFGSSYEEG+R+F+LL+EQ    +E 
Sbjct  181  MEEMVSPEG----SCELDVWPFLKNLTADALSRTAFGSSYEEGRRLFQLLQEQTYLTMEV  236

Query  760  TRQVYIPG  783
             + VYIPG
Sbjct  237  FQSVYIPG  244



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 172/239 (72%), Gaps = 4/239 (2%)
 Frame = +1

Query  73   VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  252
            V + LL +AWR+L WVW +PKKLE+CL+Q GL GN Y  L GD KE+ +M ++A S+P++
Sbjct  11   VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPIS  70

Query  253  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPL  432
             SD++  RV+P++ H   KYGKN + W+GP P+V I +PEL+++V  K+  FQK   +PL
Sbjct  71   FSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAFQKVPPHPL  130

Query  433  GRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSS  612
            G+ L  G+V+ E EQW K R+++NPAF+ EK K M  AF LSCS+M++K E     K S 
Sbjct  131  GKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWE----KKLSL  186

Query  613  SCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
              SCE+DVWP+L+ L  DVISRTAFGSSYEEG+RIF+L +EQA   ++ TR +Y+PG R
Sbjct  187  DGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWR  245



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 173/255 (68%), Gaps = 10/255 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +     + +L +AW++L +VW KPK+LEKC++Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKLTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMK  60

Query  208  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  384
            E+ KM  +A+SKP+  S D + PRV+P+       YGKNC+VW GP P V I DPELVKE
Sbjct  61   EIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKE  120

Query  385  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCS  564
            VL K  ++QKP   PL +    G+  YE ++WA HRRLLNPAF+ +K K M PAF  +  
Sbjct  121  VLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTAC  180

Query  565  EMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            EMLSK E +V   G+     E+DVWP+LQ LT D ISRTAFGSSYEEG++IFEL KEQ  
Sbjct  181  EMLSKLEKVVSPNGT-----EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQLS  235

Query  745  HLVETTRQVYIPGLR  789
             ++E +R +YIPG R
Sbjct  236  LILEVSRTIYIPGWR  250



>gb|AJD25172.1| cytochrome P450 CYP72A331 [Salvia miltiorrhiza]
Length=516

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 174/250 (70%), Gaps = 6/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME++Y++L +  +  L   AW+ L  VWF+P+KLEK L+Q G  GN YR + GD K+ + 
Sbjct  3    MEILYSILALFCAAFLSHNAWKFLTRVWFEPRKLEKRLRQEGFSGNSYRFMIGDSKQ-IA  61

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
             A  A SKP+  S+++APRVIP+  H   KYG+NC++W G  P + I D E+ KE+L+K 
Sbjct  62   AAKQANSKPIAFSNDIAPRVIPFIHHSLLKYGENCFIWYGSKPTIVILDQEMTKEILSKN  121

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +FQK  + PL + L +G+ +YE ++WAKHRRLLNPAF+ EK KLM P F LSC EMLSK
Sbjct  122  YVFQKT-STPLDKLLAQGVATYEADKWAKHRRLLNPAFHLEKLKLMLPLFYLSCGEMLSK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E I+  +G     CEVDVWPHLQ LT DVISRTAFGS+YEEG +IFELLKEQ   L + 
Sbjct  181  LEKIIPSEGV----CEVDVWPHLQALTSDVISRTAFGSNYEEGGKIFELLKEQGALLFKA  236

Query  760  TRQVYIPGLR  789
             + +YIPG R
Sbjct  237  FQMLYIPGWR  246



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   266 bits (681),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 166/231 (72%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
            +W+VL W+W +PK+LEK L++ G +GNPY +  GD KE +KM  +A+SKPMTLSD++ PR
Sbjct  20   SWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPR  79

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            V  Y  H  +K+GKN ++W GPMP V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATGL  139

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
              YE E+W+KHRR++NPAF  EK K+M P FL SC++++SK EG++    SS  SCE+D 
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGML----SSEGSCEMDA  195

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            WP LQ LT DVI+R+AFGSSYEEG+RIF+L +EQ   L++   ++ IPG R
Sbjct  196  WPFLQNLTSDVIARSAFGSSYEEGRRIFQLQREQTELLMKVILKIQIPGWR  246



>emb|CBI22129.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 171/235 (73%), Gaps = 4/235 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + +L +AWR+L W+W +PK+LE+CLKQ GL GN YR+L GD KE+  M  +A S+P+++S
Sbjct  16   ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEASSRPISIS  75

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  R+ P++ H   KYGK+ ++WMGP P V I +PEL+++VL+ + +F+K R +   +
Sbjct  76   DDIVQRITPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKSRVHAFVK  135

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             LV GL   + E+WAKHR+++NPAF  EK K M PAF LSCS+M+SK E    GK S+  
Sbjct  136  LLVSGLPFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWE----GKLSTEG  191

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            SCE+DVWP+LQ LT D ISRTAFGS+YEEG+ IFEL +EQA  LV+ +   YIPG
Sbjct  192  SCELDVWPYLQNLTSDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSDSAYIPG  246



>emb|CDP15986.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   265 bits (677),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 164/235 (70%), Gaps = 6/235 (3%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
            A +W+ L WVWF+PKKLEK LK+ G +GNPY++L GD KE+  M ++A SK + LSD++ 
Sbjct  24   AVSWKALNWVWFRPKKLEKRLKEQGFRGNPYKLLHGDFKEMSTMHTEAGSKNLNLSDDIV  83

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRVIP Y     KYGKN Y+W GP P V I DP L+K V  K ++F K   NPLGR L +
Sbjct  84   PRVIPQYLGAVKKYGKNTYLWFGPRPAVVIMDPNLIKAVTQKVDVFHKLGVNPLGRLLAQ  143

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL +YE E+WAK R+LLNPAF+ EK KLM PAF  S SEM++K E +V  KG +    EV
Sbjct  144  GLRTYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVTKWENVVSPKGLA----EV  199

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY--IPGLR  789
            DVWP+LQ L+ D ISR AFGS+YEEG+R FEL +EQ  H+++  R V   IPG R
Sbjct  200  DVWPNLQALSSDAISRAAFGSNYEEGRRTFELQREQTEHVMQAARSVSINIPGFR  254



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 173/248 (70%), Gaps = 4/248 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME+ Y  + +  +  LL+ AWR    VW +P++LE+CL++ GL GN YR L GD K++  
Sbjct  1    MEIAYDSVLIFCAFALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSI  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A S+P+ LSD++ PRVIP+      +YGKN + W+GP+P V I  PEL++EV  + 
Sbjct  61   MLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEA  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              FQK + NPL   L+ GLVSYE E+WAKHR+LLNPAF+ EK KLM PAF LSC +M+SK
Sbjct  121  GRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSCRQMISK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +V  +G    SCE+DVWP L+ LT D +SRTAFGSSYEEG+R+F+LL+EQ    +E 
Sbjct  181  MEEMVSPEG----SCELDVWPFLKNLTADALSRTAFGSSYEEGRRLFQLLQEQTYLTMEV  236

Query  760  TRQVYIPG  783
             + VYIPG
Sbjct  237  FQSVYIPG  244



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 178/253 (70%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYT--LLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            ME+ Y   L  +CV++ LL + W+VL W WF+PKKLEK L++ GLKGNPY++L GD+KEL
Sbjct  1    MEISYNTILTAICVAI-LLVYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKEL  59

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
                ++A SKP+  SD +A R+ P++A+  DK GK+ +VW+GP P+V I +PE VKE+L 
Sbjct  60   KNKLNEAKSKPINFSDGIAQRINPFFANAIDKNGKSSFVWLGPYPIVLITEPEHVKEILT  119

Query  394  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K  ++Q+  + NP  +KL  GL   E+++WAKHR+++ PAF  EK K M PAF  SCSEM
Sbjct  120  KNYVYQRQTHANPFAKKLALGLAKLEEDKWAKHRKIIQPAFQVEKLKHMLPAFYQSCSEM  179

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            +SK E I+          E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA ++
Sbjct  180  ISKWEEII----PKETPFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYV  235

Query  751  VETTRQVYIPGLR  789
            ++  R VYIPG R
Sbjct  236  IDIIRSVYIPGTR  248



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/243 (51%), Positives = 173/243 (71%), Gaps = 5/243 (2%)
 Frame = +1

Query  61   LGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  240
            +   + +  L + W+ L WVW +PKK+EK LK  G KG+ Y++L GDMKE+  M  +A +
Sbjct  10   VSFVIMIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLLGDMKEINTMVEEAKT  69

Query  241  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            KPM  +++   RV+P++  L  +YGKNC++W+GP P +FI DPEL++E+L+K  ++QK +
Sbjct  70   KPMNFTNDYVARVLPHFTKLMLQYGKNCFMWLGPKPTMFITDPELIREILSKSYIYQKIQ  129

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
             NP+ + L +GL SYE E+WAKHRR++NPAF+ +K K M P+F LSC +ML K E IV  
Sbjct  130  GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIVSS  189

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
            +GS     E+DVWP LQ LT D ISRTAFGS+YEEG++IFEL KEQA  +++  R +YIP
Sbjct  190  EGS-----EIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQAELILQAARWLYIP  244

Query  781  GLR  789
            G R
Sbjct  245  GWR  247



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 175/253 (69%), Gaps = 7/253 (3%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME +  ++   + V  LL   W+VL W WF+PKKLEK  +Q GL GN YR+L GD+KE  
Sbjct  1    METLNNIIIATIFVTILLVHTWKVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFS  60

Query  217  KMASDAISKPMT-LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
            K   +A SKP+  LS+++APR+IPY+     KYGKNC+VW GP PM+ I + E ++E+  
Sbjct  61   KSIKEAQSKPINNLSNDIAPRIIPYFIQTISKYGKNCFVWFGPKPMILIMESEQIREIFA  120

Query  394  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K  ++QKP + NP+   L RG+ +YE+++WAKHR++L PAF+ EK KLM PAF LSC EM
Sbjct  121  KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            L + E I+  +GS     E+D+WP  Q LT D+ISRTAFGSSYEEG+RIFEL KEQA  +
Sbjct  181  LKEWEQIIPYEGSK----ELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEII  236

Query  751  VETTRQVYIPGLR  789
            ++    +YIPG R
Sbjct  237  MKQFNSIYIPGSR  249



>ref|XP_006598136.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Glycine 
max]
Length=389

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 166/231 (72%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
            AW+VL W+W +PK+LEK L++ GL+GNPY +  GD KE +KM  +A+SKPM LSD++ PR
Sbjct  20   AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            V  Y  H  +K+GKN ++W+GP+P V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
              YE E+W+KHRR++NPAF  EK K+M P F  SC++++SK EG++    SS  SCE+D 
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGML----SSEGSCEMDA  195

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            WP LQ L  DVI+R+AFGSSYEEG+RIF+L +EQA  L++   ++ IPG R
Sbjct  196  WPFLQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWR  246



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 169/244 (69%), Gaps = 6/244 (2%)
 Frame = +1

Query  67   VCVSVGLLA---FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            V VSV ++A   + WR L WVWFKPKKLE  L++ GL G PY  L GD++    M+ +A 
Sbjct  8    VTVSVAIVAVLWWVWRTLNWVWFKPKKLESYLRRQGLSGTPYTPLVGDVRRDYTMSMEAR  67

Query  238  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            SKP+ ++D++ PRV+P+ +H+   YG   + W GP+P + I DPE +KEV NK   FQKP
Sbjct  68   SKPIRITDDIVPRVVPFPSHMLKTYGMTFFTWRGPIPTITITDPEQIKEVFNKIYDFQKP  127

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
             + PLGR +  GL SY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ K + IV 
Sbjct  128  HSFPLGRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGKWDNIVV  187

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
             KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  L +  R+++I
Sbjct  188  DKGS---SCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLLTQAFRRIFI  244

Query  778  PGLR  789
            PG R
Sbjct  245  PGYR  248



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 164/235 (70%), Gaps = 4/235 (2%)
 Frame = +1

Query  85   LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  264
            ++ +AWRVL WVW +PKKLE+CL+Q GL GN YR+L GD KE   M  +A SKPM LS +
Sbjct  6    IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNLSHD  65

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  444
            + PRV+P+       YGKN ++W+GP P V I +P  VK+V   YE FQKP  NPL + L
Sbjct  66   ITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKFL  125

Query  445  VRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSC  624
              GL +YE E+WAKHR+++NPAF+ EK K M PAF  SCSEM+ K E +V  +G    SC
Sbjct  126  ATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHQSCSEMIEKWERLVSKEG----SC  181

Query  625  EVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            E+DVWP+L+ L  DVISR +FGSSY+EG++IF+LLKEQA   +   +  YIPG R
Sbjct  182  ELDVWPYLESLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSFYIPGWR  236



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 164/233 (70%), Gaps = 4/233 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
             +AWRV+ W+W +PKKLE+ L+Q GL GN YR +SGDMKE+      A SKPM+LS ++A
Sbjct  18   TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRVIP++  L + YGKN +VWMG +P V I +PE +K +L K E+F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLAT  137

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            G+  YE E+WAKHRR++NP F+ EK K M PAF  SCSEM+ + E +V        SCE+
Sbjct  138  GIAFYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVL----KESSCEL  193

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DVWP+ Q LT DVISRTAFGSSY+EG++IF+LLKEQ   + +  + VY PG R
Sbjct  194  DVWPYFQNLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYTPGWR  246



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/255 (52%), Positives = 173/255 (68%), Gaps = 10/255 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +     + +L +AW++L +VW KPK+LEKC++Q G KGN Y+ L GDMK
Sbjct  1    MEIPYYSLKLTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMK  60

Query  208  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  384
            E+ KM  +A+SKP+  S D + PRV+P+       YGKNC+VW GP P V I DPELVKE
Sbjct  61   EIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKE  120

Query  385  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCS  564
            VL K  ++QKP   PL +    G+  YE ++WA HRRLLNPAF+ +K K M PAF  +  
Sbjct  121  VLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTAC  180

Query  565  EMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            EMLSK E +V   G+     E+DVWP+LQ LT D ISRTAFGSSYEEG+++FEL KEQ  
Sbjct  181  EMLSKLEKVVSPNGT-----EIDVWPYLQTLTSDAISRTAFGSSYEEGRKLFELQKEQLS  235

Query  745  HLVETTRQVYIPGLR  789
             ++E +R +YIPG R
Sbjct  236  LILEVSRTIYIPGWR  250



>ref|XP_007022099.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13624.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=518

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 172/246 (70%), Gaps = 5/246 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            VI TLL   V VG+L   WR+L WVW KPK+LE+CL++ GL+GN YR LSGD+KE   M+
Sbjct  6    VIGTLLSFLV-VGILIGGWRILDWVWLKPKRLERCLRKQGLRGNSYRFLSGDIKESSDMS  64

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
              A SKPM LSD++A  V P+       YGKN +VW+GP P V I +PE ++E+  K+  
Sbjct  65   KQARSKPMPLSDDIAQYVSPFLHQTVKNYGKNSFVWIGPRPRVTIMEPEQIREIFTKFND  124

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            FQKPR+ P+G  LV GL + + E+WAKHR ++NPAF+ +K K M PAF  SC EM+SK E
Sbjct  125  FQKPRSYPVGNLLVCGLANLQGEEWAKHRNIINPAFHQDKLKNMLPAFYQSCIEMISKWE  184

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTR  765
             +V+ +GSS    E+DVWP+L  LT DVISR AFGSSYEEG+RIF+LL +Q    ++  +
Sbjct  185  KMVFVEGSS----ELDVWPYLINLTRDVISRAAFGSSYEEGRRIFQLLDDQINLTMQVIQ  240

Query  766  QVYIPG  783
             VYIPG
Sbjct  241  SVYIPG  246



>ref|XP_004294188.2| PREDICTED: cytochrome P450 72A15-like [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 169/243 (70%), Gaps = 7/243 (3%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            V VS+ ++ +AW VL W+W KPKKLE+CL++ GL+GN YRI  GDMKE   M + A SKP
Sbjct  33   VFVSI-IVRWAWSVLDWLWLKPKKLERCLREQGLQGNSYRIFHGDMKENSVMLTQAKSKP  91

Query  247  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            M LS   ++A R IP+       YG N +VWMGP P V I DPE VK+V  K E F++P 
Sbjct  92   MILSSSHDIASRFIPFLNQTVKTYGTNSFVWMGPTPRVNIMDPEDVKDVFTKLEDFRRP-  150

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
            +NPL + L+ GL SYE E+WAKHRR++NP F+ EK K M PAF  SC EM+ + E  V  
Sbjct  151  SNPLMKLLITGLASYEDEKWAKHRRIINPTFHVEKLKRMLPAFHQSCDEMIKEWESCVSK  210

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
            +GSS   CE+DVWP LQ LT D ISRTAFGSSY EG++IF+L+KEQ  H +++ + VYIP
Sbjct  211  QGSS---CELDVWPSLQNLTADAISRTAFGSSYLEGRKIFKLIKEQTAHTIKSVQSVYIP  267

Query  781  GLR  789
            G R
Sbjct  268  GWR  270



>gb|KEH38473.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=416

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 166/250 (66%), Gaps = 9/250 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            M  I +++   +       AWR+L W+W KPKKLEK L++ GLKGN YR+L GDM +L+K
Sbjct  1    MATITSIILFTLLTLFFILAWRILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDMNDLLK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM LSD++ PRV  +      K+GKN ++W GP P V I DP+++++V NK 
Sbjct  61   MRKEATSKPMNLSDDIVPRVFSFVQQSVAKHGKNSFIWFGPTPRVNITDPDMIRDVFNKM  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              FQKP  NPLG+ L  GL S+E EQW+KHR+++NPAF+     +M P +L  C +++SK
Sbjct  121  YDFQKPNANPLGKLLANGLASHEGEQWSKHRKIINPAFH-----IMLPIYLKRCDDLISK  175

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E ++   G    SCE++VWP LQ L  DVISR AFGSSYEEGKRIF+L  EQA   +  
Sbjct  176  WEKMLASDG----SCEMEVWPFLQNLARDVISRAAFGSSYEEGKRIFQLQTEQAKLTMSI  231

Query  760  TRQVYIPGLR  789
              +VYIPG R
Sbjct  232  MTKVYIPGWR  241



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 172/248 (69%), Gaps = 9/248 (4%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            +++TL+ +      L +AWR+L W+W KPKKLEK L++ GLKGN YR+L GD+K+L+K+ 
Sbjct  8    ILFTLMTLS-----LIWAWRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDIKDLLKIR  62

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A SKPM LSD++ PRV  +      K+GKN ++W GP P V I DPE +K+V+NK   
Sbjct  63   KEATSKPMNLSDDIVPRVYSFVQQTVAKHGKNSFIWFGPTPRVNITDPEQIKDVINKIYD  122

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            FQKP  NPL R L  GLV  E EQW+KHR+++NPAF+ EK K++ P F  SC +++SK E
Sbjct  123  FQKPNVNPLVRLLGCGLVCLEGEQWSKHRKIINPAFHLEKLKIILPIFHKSCDDLISKWE  182

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTR  765
             ++    SS  SCE+DVWP LQ L  D+ISR AFGSSYEEGKRIF+L  EQA    +   
Sbjct  183  KML----SSDGSCEMDVWPFLQNLASDLISRAAFGSSYEEGKRIFQLQTEQAELTTKIIE  238

Query  766  QVYIPGLR  789
            +VYIPG R
Sbjct  239  KVYIPGWR  246



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 167/232 (72%), Gaps = 4/232 (2%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            +AW++L W W KPK++EK L++ G KGN YR L GD++E   ++  A SKP++  D++AP
Sbjct  39   WAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSKQAKSKPISFEDDIAP  98

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            RV+P Y  L   YGK CY W+GP+PM+ I DP+ +KEV  K   FQKP++NPLG+ L  G
Sbjct  99   RVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTG  158

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            L S+E E+WAKHR+++NPAF+ EK KLM PAF  SCSE++SK E ++  +G    SCE+D
Sbjct  159  LASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEG----SCELD  214

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            VWP++  LT DVISRTAFGS+YEEG RIF+L  E A   ++  + VYIPG R
Sbjct  215  VWPYIVNLTSDVISRTAFGSNYEEGIRIFQLQTELADLALQALQSVYIPGWR  266



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 175/246 (71%), Gaps = 6/246 (2%)
 Frame = +1

Query  55   TLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
            T+  V V++  L + W+VL WVWF+PKKLEKCL+Q GLKGNPY++L GD+ EL K   +A
Sbjct  5    TIAVVSVAI-FLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEA  63

Query  235  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK-YELFQ  411
             SKP+  SD++A R+IP++ +  +K GK  +VW+GP P+V I  PE VKE+L K Y   +
Sbjct  64   KSKPINFSDDIAQRLIPFFLNAINKNGKTSFVWLGPYPVVLITAPEHVKEILTKSYVYLK  123

Query  412  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
            +   NPL + L + LV+ E+E+WAKHR+++NPAF+ EK K M PAF  SCSEMLSK E I
Sbjct  124  QTHPNPLTKLLAQSLVNLEEEKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEMLSKWEEI  183

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
            V        S E DVWP LQ +T +VISRTAFGSSY+EG+ +FEL KEQA +++E  R +
Sbjct  184  V----PKETSFEFDVWPDLQVMTSEVISRTAFGSSYQEGRIVFELQKEQAEYVMEKGRSI  239

Query  772  YIPGLR  789
            Y+PG R
Sbjct  240  YVPGSR  245



>ref|XP_004294187.1| PREDICTED: cytochrome P450 CYP72A219-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 170/250 (68%), Gaps = 8/250 (3%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            V  +L+ V + V L   AW VL WVW KPKKLE+CL++ G KGN YRIL GD KE V M 
Sbjct  9    VALSLVFVSIVVRL---AWSVLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIML  65

Query  226  SDAISKPMTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
              A SKPM LS   ++APRV P        YGKN  VWMGP+P V I +PE +K+V  + 
Sbjct  66   KKAKSKPMNLSTSHDIAPRVTPLLHQTVKTYGKNSLVWMGPIPQVNIMNPEDLKDVFTEL  125

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              FQKP +NPL + L  GLV +E E+WAKHRR++NP F+ EK K M PAF  SC EM+ +
Sbjct  126  SDFQKPHSNPLVKFLATGLVIHEGEKWAKHRRIINPTFHFEKLKRMLPAFYQSCDEMIKE  185

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +V      S S E+DVWP LQ +T DVISRTAFGSSY+EG++IFELLKEQA++ +++
Sbjct  186  WETVV---SKESSSHEIDVWPSLQNVTADVISRTAFGSSYQEGRKIFELLKEQAVYAMKS  242

Query  760  TRQVYIPGLR  789
             + VYIPG R
Sbjct  243  IQSVYIPGWR  252



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 177/253 (70%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYT--LLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            ME+ Y   +  +CV++ LL + W+VL W WFKPKKLEK L++ GLKGNPY++L GD KEL
Sbjct  1    MEISYNRIIAAICVAI-LLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKEL  59

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
                ++A SKP+  +D++A R+IP++    +K GKN +VW+GP P+V I DPE VK +  
Sbjct  60   TNKLNEARSKPINFNDDIAQRLIPFFLDSINKNGKNSFVWLGPYPIVLITDPEHVKVIFT  119

Query  394  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K   +QK  + NP  + L  GL   E+++WAKHR+++NPAF+ EK K M PAF  SCSEM
Sbjct  120  KNYGYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEM  179

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            +SK E IV        S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA ++
Sbjct  180  ISKWEDIV----PKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYV  235

Query  751  VETTRQVYIPGLR  789
            ++ TR VYIPG R
Sbjct  236  IDITRSVYIPGSR  248



>gb|KJB12900.1| hypothetical protein B456_002G043400 [Gossypium raimondii]
Length=391

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 163/229 (71%), Gaps = 4/229 (2%)
 Frame = +1

Query  103  RVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVI  282
            R L WVW  PK+LE CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++ P V+
Sbjct  25   RTLNWVWLAPKRLESCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDIGPYVV  84

Query  283  PYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLVS  462
            P+    A++YGKN + W GP P V I DPE ++E+LNK+  FQK   NPL   LV GL +
Sbjct  85   PFQHQTANQYGKNSFTWFGPRPRVNITDPEKIREILNKFNDFQKIHTNPLLNLLVSGLAN  144

Query  463  YEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDVWP  642
             + ++W+K R+++NPAF+ +K K M PAF  SCS+MLSK E +V  KG S    E+DVWP
Sbjct  145  LDGDRWSKRRKIINPAFHQDKLKNMLPAFYQSCSDMLSKWEKMVCTKGYS----ELDVWP  200

Query  643  HLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +L  LT DVISR+AFGSS+EEGKRIF+LL++Q +H+++  + VYIPG R
Sbjct  201  YLVDLTRDVISRSAFGSSFEEGKRIFQLLEDQLVHIIKLIQTVYIPGWR  249



>gb|EYU31630.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=517

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 173/241 (72%), Gaps = 5/241 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME+I++ L +C +V ++ +AW+++ +VWF+PKK+EK L+Q G  G PYR L GD+ E+  
Sbjct  1    MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M ++A+SKP+  SD+  PR+IP+       +G+NC++W+GP P V I DP++V+EVL+K 
Sbjct  61   MGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKT  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +FQKP  NPL   L RGL SYE ++WAKHRRL+NPAF+ +K K M P+F   C+EMLSK
Sbjct  121  YVFQKPY-NPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCAEMLSK  179

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  +G      E+DVWP+LQ +T D IS TAFG+SYE+G++IFEL KEQA  + ++
Sbjct  180  WEKIVPSEG----CFELDVWPYLQTMTSDAISLTAFGTSYEQGRKIFELQKEQATLITKS  235

Query  760  T  762
             
Sbjct  236  N  236



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 170/253 (67%), Gaps = 7/253 (3%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLL---AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            ME++Y  + V  S  LL     AW+V   VW  PKKLEK LK+ G +GNPY++L GD KE
Sbjct  1    MEIVYNPIAVLSSCILLLILVLAWKVFNQVWLTPKKLEKRLKEQGFRGNPYKLLYGDFKE  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
            +  +  +A+SKP+ L+D+  PRVIP++     KYGK+ Y+W G    V I DPE ++EV 
Sbjct  61   ISTLFKEALSKPINLTDDFVPRVIPHFYAATKKYGKHTYLWQGTELTVVIMDPEHIREVT  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
             K  +FQ+P +NPL + LV+GL SY  ++W KHR+L+NPAF+ EK K M P+F  S SEM
Sbjct  121  QKVYIFQRPHSNPLLKLLVQGLASYNGDKWTKHRKLINPAFHVEKLKHMLPSFYTSASEM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            + K E IV   GSS    E+DVWP LQ LTCD ISRTAFGS+Y+EG RIFEL +EQ  H 
Sbjct  181  MCKWEDIVSSNGSS----ELDVWPDLQTLTCDAISRTAFGSNYKEGSRIFELQREQTEHF  236

Query  751  VETTRQVYIPGLR  789
            +E  R +YIPG R
Sbjct  237  IEAARSLYIPGWR  249



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 173/249 (69%), Gaps = 2/249 (1%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            M+V Y  + V  +   L  AW++L W W KPKKLEK L+QLGLKGN YR+L GD+ E  +
Sbjct  18   MDVFYRGISVLGTCFFLLLAWKMLNWAWIKPKKLEKRLRQLGLKGNSYRLLIGDLGETSQ  77

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKP+  ++++ PR++P+   +   +GKN ++W GP P V I DPEL+KEVL K 
Sbjct  78   MDKEAKSKPINFTNHIIPRIMPFLHKIIQSHGKNPFIWQGPNPAVIITDPELIKEVLTKN  137

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              +QKP ++ LG+ + +G+ +Y+K++WAKHRRLLNPAF+ EK K M PAF LSCSEML K
Sbjct  138  YTYQKPPSDDLGKLISQGVAAYDKDKWAKHRRLLNPAFHIEKLKHMLPAFHLSCSEMLKK  197

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +     S+  S E+DVWP+LQ +T DVISRTAFGS+ EEGK IF+L KE   H+++ 
Sbjct  198  WEKL--ASASAEGSFELDVWPYLQDMTSDVISRTAFGSNLEEGKNIFKLQKEILEHILQI  255

Query  760  TRQVYIPGL  786
             +  Y PG+
Sbjct  256  LQSFYFPGM  264



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 179/258 (69%), Gaps = 14/258 (5%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGL------LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGD  201
            ME+  +++ VCV++ +      +A+AWRVL WVW +P KLE+CL++ GL GN YR+L GD
Sbjct  1    MEI--SIIQVCVALSVVLVSIVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGD  58

Query  202  MKELVKMASDAISKPMTLS--DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPEL  375
             KE+  M   A SKP+ LS   ++APRVIP+   +   YG+N +VWMGP P V I +PE 
Sbjct  59   TKEISMMVEQAQSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPED  118

Query  376  VKEVLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLL  555
            +K+  NK + FQ+  +NP+ + + +GL S E E+WAKHR+++NPAF+ EK K M P F  
Sbjct  119  LKDAFNKSDEFQRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQ  178

Query  556  SCSEMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKE  735
            SCSEM++K E +V+ +GS     E+DVWP+L+ LT DVISR AFGSSYEEG++IF+LL+E
Sbjct  179  SCSEMINKWESLVFKEGSR----EMDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLRE  234

Query  736  QAMHLVETTRQVYIPGLR  789
            +A       R VYIPG R
Sbjct  235  EAKFYTIAARSVYIPGWR  252



>ref|XP_004151605.1| PREDICTED: secologanin synthase-like, partial [Cucumis sativus]
Length=336

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 164/231 (71%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W++  W+WF+PKKLEK L+Q G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  20   GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPR  79

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            VIP   H   +YGKN ++W+GP+P V I DPE +K V + Y  FQKP  NP  + LV+G+
Sbjct  80   VIPSIYHTIQRYGKNSFMWLGPLPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGI  139

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
            V+ + E+W KHR+++NPAF+ EK K M PAF  SC+EM+SK E +V  +G    SCE+DV
Sbjct  140  VNLDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSREG----SCELDV  195

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             P+L+ +  DVISRTAFGSSYE+GK+IF+L  E    +++TT  +YIPG R
Sbjct  196  MPYLKNMASDVISRTAFGSSYEKGKKIFKLQTELTNFVIQTTLGIYIPGWR  246



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 171/236 (72%), Gaps = 5/236 (2%)
 Frame = +1

Query  85   LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  264
            LL + W+VL W WF PKKLE CL+Q GLKGNPY++L GD+ EL K   +A SKP+  SD+
Sbjct  26   LLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKPINFSDD  85

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK-YELFQKPRNNPLGRK  441
            +A R+IP++ +  +K GK+ ++W+GP P+V I  PE VKE+  K Y   ++   NP  + 
Sbjct  86   IAQRLIPFFLNSINKNGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKL  145

Query  442  LVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCS  621
            L +GLVS E+++WAKHR+++NP F+ EK K M PAF + CSEM+SK E IV  KG+S+  
Sbjct  146  LAKGLVSLEEDKWAKHRKIINPTFHVEKLKHMLPAFYVCCSEMISKWEEIV-PKGTST--  202

Query  622  CEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             E+DVWP L+ +T +VISRTAFGSSYEEG+ +FEL KEQA H++E  R +YIPG R
Sbjct  203  -EIDVWPDLEKMTSEVISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSR  257



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 176/252 (70%), Gaps = 6/252 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLL--AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            MEV +  L   V   LL   +AWRVL WVW +PK+LE CL++ GLKGN YR+ SGD+KE 
Sbjct  1    MEVSFLKLSSVVFAILLITTWAWRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKES  60

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
              M  +A SKP+ LS+++  R+ P+  H  + YGK+ ++W+GP P V I +PE +K++ N
Sbjct  61   SLMIKEASSKPINLSEDITARIFPFGLHTVNNYGKDSFMWIGPTPRVSITNPEYIKDIFN  120

Query  394  KYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
            K   F KP++ PL + L  G+ +YE E+W +HR+++NPAF+ EK K + PAF LSCSEML
Sbjct  121  KLGDFPKPQSIPLVKLLATGVATYEGEKWTRHRKIINPAFHMEKLKRLVPAFYLSCSEML  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            +K E ++  +G    SCE+DVW +LQ +T DVISRTAFGSSYEEG+RIF+L KEQ    +
Sbjct  181  NKWERLLNSEG----SCELDVWSYLQNMTGDVISRTAFGSSYEEGRRIFQLQKEQGELAI  236

Query  754  ETTRQVYIPGLR  789
            ++ + VYIPG R
Sbjct  237  KSLQTVYIPGWR  248



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 173/248 (70%), Gaps = 9/248 (4%)
 Frame = +1

Query  58   LLGVCVSVGLLAF----AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            L  V +S G L       WR+L WVW +PK+LE+CL++ GL GN YR+L GD KE+ +M 
Sbjct  3    LSSVAISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMM  62

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A S+P++LSD++  RV+P++ H   KYGKN + W+GP P V I +PEL+++VL K  +
Sbjct  63   KEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNI  122

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            FQK  ++PL + LV GLV+ E EQWAK R+++NPAF+ EK K M  AF LSCS+M++K  
Sbjct  123  FQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMVNK--  180

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTR  765
               + K S   SCE+DVWP+L+ LT DVISRTAFGSSYEEG RIF+L KEQ    ++   
Sbjct  181  ---WKKLSVEGSCELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAM  237

Query  766  QVYIPGLR  789
             VYIPG R
Sbjct  238  SVYIPGWR  245



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 169/232 (73%), Gaps = 5/232 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W+VL W WF+PKK+E CL+Q GLKGNPY++L GD+ EL K   +A SKP+  SD++A R
Sbjct  29   TWKVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPINFSDDIAQR  88

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-NPLGRKLVRG  453
            +IP++ +  +K GKN +VW+GP P+V I DPE +KE+  K  ++QK  + NP  + L  G
Sbjct  89   LIPFFLNAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHG  148

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            L+S E+++WAKHR+++NPAF+ +K K M P+F LSCSEM+SK E +V        S E+D
Sbjct  149  LISLEEDKWAKHRKIINPAFHVQKLKHMLPSFYLSCSEMISKWEEVV----PKETSFELD  204

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +WP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA +++E  R +YIPG R
Sbjct  205  IWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMEIGRSIYIPGSR  256



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 169/247 (68%), Gaps = 4/247 (2%)
 Frame = +1

Query  49   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            ++T L   +++    +AWR++ WVW +PK +EK L+  G  GNPYRIL GD  ++ KM  
Sbjct  5    LFTFLFFAIAI----WAWRIVNWVWIRPKNIEKRLRAQGFGGNPYRILYGDTNDMAKMIK  60

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            +A SKP+ LSD+V PRVIP + H+  KYGK C+VW+GP+  V I +PEL+KEVLN   +F
Sbjct  61   EANSKPIKLSDDVLPRVIPLHHHIVRKYGKACFVWIGPVARVVIMEPELIKEVLNNNHIF  120

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            +KP  NPL R LV G+  YE ++W+KHR+++NPAFY EK + M PA   SC EM+ K E 
Sbjct  121  KKPTPNPLARFLVCGINGYEDDKWSKHRKIINPAFYVEKLRHMVPAMHRSCVEMIEKWEK  180

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            +V  +G      E+DV P+ + LT  VISRTAFGSSYEEG+RIFEL KEQA    +  + 
Sbjct  181  LVEIEGGKRKGIEIDVGPYFEDLTGQVISRTAFGSSYEEGRRIFELQKEQAELTRQVLQS  240

Query  769  VYIPGLR  789
            VY+PG R
Sbjct  241  VYVPGWR  247



>ref|XP_010327256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=399

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 177/255 (69%), Gaps = 10/255 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +     + +L + WR+L  VWFKPKKLEK L+Q GLKGN Y++L GDMK
Sbjct  20   MEISYYNLKIAIFSFAIIFVLRWTWRILNHVWFKPKKLEKQLRQQGLKGNSYKLLYGDMK  79

Query  208  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  384
            E+ KM  +A SKP+ LS D + PR+ P+       YGKNC+VW+GP P V I +P+L++E
Sbjct  80   EMKKMIEEATSKPINLSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIRE  139

Query  385  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCS  564
            VL K  ++QK R +PL + ++ GL ++EK++WA HRR+LNPAF+ +K K M PAF L+ +
Sbjct  140  VLTKNYVYQKARGSPLSKLVISGLAAHEKDKWATHRRILNPAFHLDKLKHMLPAFKLTIN  199

Query  565  EMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            EML+  + +V   G+     E+DVWP+LQ LT D ISRTAFGS+YEEGK+IFEL KEQ  
Sbjct  200  EMLNTWKEVVSKDGT-----EIDVWPYLQTLTSDAISRTAFGSNYEEGKKIFELQKEQIE  254

Query  745  HLVETTRQVYIPGLR  789
             + +  R +YIPG R
Sbjct  255  LISKMARSIYIPGWR  269



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 166/231 (72%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
            AW+VL W+W +PK+LEK L++ GL+GNPY +  GD KE +KM  +A+SKPM LSD++ PR
Sbjct  20   AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            V  Y  H  +K+GKN ++W+GP+P V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
              YE E+W+KHRR++NPAF  EK K+M P F  SC++++SK EG++    SS  SCE+D 
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGML----SSEGSCEMDA  195

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            WP LQ L  DVI+R+AFGSSYEEG+RIF+L +EQA  L++   ++ IPG R
Sbjct  196  WPFLQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWR  246



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 174/247 (70%), Gaps = 4/247 (2%)
 Frame = +1

Query  49   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            +Y  +GV  +V L  FAWRVL  +W +PKKLEK L+ LGL GN YR++ GD K++  M  
Sbjct  9    MYYSIGVSCAVALAVFAWRVLNCMWLRPKKLEKRLRNLGLNGNSYRLVCGDFKDIAVMLK  68

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            +A SKP+ LSD++ PRVIP++  +  KYGKN +VW+G  P V I DP L++E+L K  +F
Sbjct  69   EANSKPINLSDDIVPRVIPFFIEIIKKYGKNSFVWLGLNPSVVILDPVLMREILLKNYIF  128

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            +KPR +P+ + L +G++  E ++WAKHR++++ AF+ +K K M PAF  S SEMLSK E 
Sbjct  129  KKPRPHPIVKLLAQGVIFSEGDKWAKHRKIISSAFHLQKLKHMLPAFYSSASEMLSKWEE  188

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
             V  +G    SCE+DVWP+LQ L  D ISRTAFGS+YEEG+RIFEL  EQA + V  TR 
Sbjct  189  RVSPEG----SCELDVWPYLQTLGADSISRTAFGSNYEEGRRIFELQMEQAQYAVRATRS  244

Query  769  VYIPGLR  789
            VY PGLR
Sbjct  245  VYFPGLR  251



>ref|XP_006477947.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=263

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 167/241 (69%), Gaps = 4/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
              V V +L +AWRVL WVW +P+KLEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++L DN+A RV P+   L + YGKN ++W GP P V I +P+ +KE+  +   FQK  + 
Sbjct  71   LSLDDNIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKEIFTRINDFQKVNSI  130

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL R L+ GL + E E+WAKHR+L+NPAF+ EK KLM PAF LSC E+++K E  +  +G
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEG  190

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            SS    E+DVWP+L  LT DVISRTAFGSSYEEG+RIF+L  E A   ++  R V+IPG 
Sbjct  191  SS----ELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGW  246

Query  787  R  789
            R
Sbjct  247  R  247



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 166/231 (72%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
            AW+VL W+W +PK+LEK L++ GL+GNPY +  GD KE +KM  +A+SKPM LSD++ PR
Sbjct  20   AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            V  Y  H  +K+GKN ++W+GP+P V I DPE +K+V NK   F KP  NPL + L  GL
Sbjct  80   VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
              YE E+W+KHRR++NPAF  EK K+M P F  SC++++SK EG++    SS  SCE+D 
Sbjct  140  AGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGML----SSEGSCEMDA  195

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            WP LQ L  DVI+R+AFGSSYEEG+RIF+L +EQA  L++   ++ IPG R
Sbjct  196  WPFLQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWR  246



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 169/247 (68%), Gaps = 6/247 (2%)
 Frame = +1

Query  55   TLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
             +L V     ++A+AWRVL WVW +PKKLEKCL++ GL GN YR+L GD K+L KM    
Sbjct  6    AVLSVVWVSMVIAWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQT  65

Query  235  ISKPMTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
             SKP+ LS   ++AP V P++    + YGKN +VWMGP+P V I +PE +K+  N+++ F
Sbjct  66   QSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDF  125

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
             K   NP+ + L +G+V  E EQWAKHR+++NPAF+ EK K M P F  SCSEM++K E 
Sbjct  126  HKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINKWES  185

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            +V    S   SCE+DVWP+L+  T DVISR AFGSSYEEG++IF+LL+E+A       R 
Sbjct  186  LV----SKESSCELDVWPYLENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRS  241

Query  769  VYIPGLR  789
            VYIPG R
Sbjct  242  VYIPGWR  248



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 173/248 (70%), Gaps = 9/248 (4%)
 Frame = +1

Query  58   LLGVCVSVGLLAF----AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            L  V +S G L       WR+L WVW +PK+LE+CL++ GL GN YR+L GD KE+ +M 
Sbjct  3    LSSVAISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMM  62

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A S+P++LSD++  RV+P++ H   KYGKN + W+GP P V I +PEL+++VL K  +
Sbjct  63   KEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNI  122

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            FQK  ++PL + LV GLV+ E EQWAK R+++NPAF+ EK K M  AF LSCS+M++K  
Sbjct  123  FQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMVNK--  180

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTR  765
               + K S   SCE+DVWP+L+ LT DVISRTAFGSSYEEG RIF+L KEQ    ++   
Sbjct  181  ---WKKLSVEGSCELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAM  237

Query  766  QVYIPGLR  789
             VYIPG R
Sbjct  238  SVYIPGWR  245



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 173/242 (71%), Gaps = 5/242 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            +CV++ L+ + W+VL W WF+PKK EK L++ GL GNPY++L GD+KEL    ++A SKP
Sbjct  15   ICVAILLVIYTWKVLNWAWFRPKKFEKYLRKSGLNGNPYKLLYGDLKELTNKLNEAKSKP  74

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-  423
            ++ S +V  R+IP++    +K GKN + W+GP P+VFI +P L+K++  K+ ++ K ++ 
Sbjct  75   ISFSGDVPQRLIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKKIFEKHYVYHKNKHS  134

Query  424  NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGK  603
            NP  + LV+GLV+ E+++WAKHR+++NPAF+ EK K M PAF  SCSEML K E  V   
Sbjct  135  NPFAKLLVQGLVTLEEQKWAKHRKIINPAFHFEKLKHMVPAFYQSCSEMLRKWEEAV---  191

Query  604  GSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
                 S E+DVWPH Q +T DVISRTAFGSSYEEG+ IFEL KEQA +++E    +YIPG
Sbjct  192  -PKETSAELDVWPHFQLMTGDVISRTAFGSSYEEGRIIFELQKEQAEYVMEQIFSIYIPG  250

Query  784  LR  789
             R
Sbjct  251  SR  252



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 174/253 (69%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYTLL--GVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            ME+ Y  +   +CV++ LL + WRVL W WFKPKKLEK L++ GLKGNPY++  GD+ EL
Sbjct  1    MEISYNRIIEAICVAI-LLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEL  59

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
                ++A SKP+  SD++A R+IP++     K GK+ +VW+GP P V I DPE VKE+  
Sbjct  60   TNKLNEARSKPINFSDDIAQRLIPFFLDSIYKNGKSSFVWLGPYPAVLITDPEHVKEIFT  119

Query  394  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K   +QK  + NP  +   +GL   E+++WAKHR+++NPAF+ E  K M PAF  SCSEM
Sbjct  120  KNYGYQKIAHPNPFAKSFAKGLAFLEEDKWAKHRKIINPAFHFENLKHMLPAFYQSCSEM  179

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            +SK E IV        S E+DVWP LQ +T +VISRTAFGSSYEEG+++FEL KEQA ++
Sbjct  180  ISKWEDIV----PKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRKVFELQKEQAEYV  235

Query  751  VETTRQVYIPGLR  789
            ++ T  VYIPG R
Sbjct  236  MDMTHSVYIPGSR  248



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 172/243 (71%), Gaps = 7/243 (3%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            V VS+ ++A+AWRVL WVW +P KLE+CL++ GL GN YR+L GD KE+  M   A SKP
Sbjct  14   VLVSI-VIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQAQSKP  72

Query  247  MTLS--DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            + LS   ++APRVIP+   +   YG+N +VWMGP P V I +PE +K+  NK + FQ+  
Sbjct  73   IKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNKSDEFQRAI  132

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
            +NP+ + + +GL S E E+WAKHR+++NPAF+ EK K M P F  SCSEM++K E +V+ 
Sbjct  133  SNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEMINKWESLVFK  192

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
            +GS     E+DVWP+L+ LT DVISR AFGSSYEEG++IF+LL+E+A       R VYIP
Sbjct  193  EGSR----EMDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIAARSVYIP  248

Query  781  GLR  789
            G R
Sbjct  249  GWR  251



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 169/243 (70%), Gaps = 7/243 (3%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            V VS+ ++ +AWRVL WVW +PKKLEKCL++ GL GN YR+L GD K+L KM     SKP
Sbjct  14   VWVSI-VITWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKP  72

Query  247  MTLS--DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            + LS   ++AP V P++    + YGKN +VWMGP+P V I +PE +K+  N+++ F K  
Sbjct  73   IKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDFHKVV  132

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
             NP+ + L +G+V  E EQWAKHR+++NPAF+ EK K M P F  SCSEM++K E +V  
Sbjct  133  KNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINKWESLV--  190

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
              S   SCE+DVWP+L+  T DVISR AFGSSYEEG++IF+LL+E+A       R VYIP
Sbjct  191  --SKESSCELDVWPYLENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYIP  248

Query  781  GLR  789
            G R
Sbjct  249  GWR  251



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   261 bits (667),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 178/253 (70%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYTL---LGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            ME ++ +   + + + +  L + W+ L WVW +PKK+EK LK  G KG+ Y++L GDMKE
Sbjct  1    METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
            +  M  +A +KPM  +++   RV+P++  L  +YGKN ++W+GP P +FI DPEL++E+L
Sbjct  61   INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            +K  ++QK + NP+ + L +GLVSYE E+WAKHR+++NPAF+ +K K M P+F LSC +M
Sbjct  121  SKSYIYQKIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            L K E I   +GS     E+DVWP L+ LT D ISRTAFGS+YE+G++IFEL KEQA  +
Sbjct  181  LRKWESIASSEGS-----EIDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELI  235

Query  751  VETTRQVYIPGLR  789
            ++  R +YIPG R
Sbjct  236  LQAARWLYIPGWR  248



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 176/253 (70%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYTLL--GVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            ME+ Y  +   +CV V LL + WRVL W WFKPKKLEK L++ GLKGNPY++L GD KEL
Sbjct  1    MEISYNRIIEAICV-VTLLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKEL  59

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
                ++A SKP+  SD++A R++P++    +K GK+ +VW+GP P+V I  PE VKE+  
Sbjct  60   TNKLNEARSKPINFSDDIAQRLVPFFIDSINKNGKSSFVWLGPCPIVLITYPEHVKEIFT  119

Query  394  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K   +QK  + NP  + L  GL   E+++WAKHR+++NPAF+ EK K M PAF  SC+EM
Sbjct  120  KNCAYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCTEM  179

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            LSK E I+        S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA ++
Sbjct  180  LSKWEEII----QKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYV  235

Query  751  VETTRQVYIPGLR  789
            ++ TR VYIPG R
Sbjct  236  IDITRSVYIPGSR  248



>gb|KJB12898.1| hypothetical protein B456_002G043200 [Gossypium raimondii]
Length=518

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 165/234 (71%), Gaps = 4/234 (2%)
 Frame = +1

Query  88   LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  267
            + + WR L WVW  PK+LE CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRTLNWVWLAPKRLESCLRQQGFAGNPYRFLSGDIKELFTMSRQTRAKPMPLSDDI  79

Query  268  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  447
             P V+P+    A++YGKN + W GP P   I DPE ++E+LNK+  FQK R NPL   LV
Sbjct  80   GPYVVPFQHQTANQYGKNSFTWFGPRPRANITDPEKIREILNKFNDFQKIRTNPLLNLLV  139

Query  448  RGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCE  627
             GLV+ E ++W+K R+++NPAF+ +K K M PAF  SCS+MLSK E +V  +G S    E
Sbjct  140  SGLVNLEGDRWSKRRKIINPAFHQDKLKNMLPAFYQSCSDMLSKWEKMVCTEGYS----E  195

Query  628  VDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +DVWP+L  LT DVISR+AFGSS+EEGKRIF+LL++Q +  ++  + VYIPG R
Sbjct  196  LDVWPYLVDLTRDVISRSAFGSSFEEGKRIFQLLEDQLVVTIKLIQTVYIPGWR  249



>ref|XP_010694547.1| PREDICTED: cytochrome P450 72A15-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 173/249 (69%), Gaps = 9/249 (4%)
 Frame = +1

Query  58   LLGVCVSVGL-----LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKM  222
            ++G+ +++G+     L + W++L WVWF+PKKLEK L++ GLKGN Y+ L GDMKE  +M
Sbjct  1    MIGLFIAIGIALCVILTWVWKILNWVWFRPKKLEKQLRKQGLKGNSYKWLVGDMKETFRM  60

Query  223  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  402
             ++A  KP+  +++   RV+P+     +KYG+NC+ W GP+P + I +PEL++E   +  
Sbjct  61   RAEARGKPIPFTNDYYSRVLPFLDQHVNKYGENCWTWFGPVPAINIAEPELIREAFTRMN  120

Query  403  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*  582
             FQK R NPL   LV GLV YE E+WAKHR+L+NPAF+ EK KLM PAF  S +E+++K 
Sbjct  121  EFQKTRLNPLIGLLVPGLVGYEGEKWAKHRKLVNPAFHMEKLKLMIPAFGASVTEIINKW  180

Query  583  EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETT  762
            E IV   GSS    E+DVWP+L  L+ DVISR AFGSSYEEGKRIFELLKEQ    +   
Sbjct  181  EKIVPESGSS----EIDVWPYLMSLSADVISRAAFGSSYEEGKRIFELLKEQTQITLRLF  236

Query  763  RQVYIPGLR  789
            + VYIPG R
Sbjct  237  QSVYIPGWR  245



>ref|XP_011469476.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=363

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 166/245 (68%), Gaps = 8/245 (3%)
 Frame = +1

Query  67   VCVSVGLLAFA----WRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
            + +S+ LL+ A    WRVL WVW KPKKLEKCL+Q GL GN YR+L GD+KE  ++  +A
Sbjct  32   IALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMKEA  91

Query  235  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
             SKPM LSD+ APRV+P+      K+GKN + W G  P V I +P+ + E+L KY+ F++
Sbjct  92   CSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDFRR  151

Query  415  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIV  594
            P   P+ + L  GL + E E+W K R+++NPAF+ EK K M PA   SC++M++K E +V
Sbjct  152  PHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCTDMITKWEIMV  211

Query  595  YGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY  774
              +G    SCE+D+WP LQ L+ DVISRTAFGSSYEEG+ IFEL KEQ   L++     Y
Sbjct  212  SKEG----SCELDIWPFLQNLSGDVISRTAFGSSYEEGRTIFELQKEQTELLIKALFSAY  267

Query  775  IPGLR  789
            IPG R
Sbjct  268  IPGFR  272



>ref|XP_011469477.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=362

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 166/245 (68%), Gaps = 8/245 (3%)
 Frame = +1

Query  67   VCVSVGLLAFA----WRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
            + +S+ LL+ A    WRVL WVW KPKKLEKCL+Q GL GN YR+L GD+KE  ++  +A
Sbjct  32   IALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMKEA  91

Query  235  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
             SKPM LSD+ APRV+P+      K+GKN + W G  P V I +P+ + E+L KY+ F++
Sbjct  92   CSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDFRR  151

Query  415  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIV  594
            P   P+ + L  GL + E E+W K R+++NPAF+ EK K M PA   SC++M++K E +V
Sbjct  152  PHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCTDMITKWEIMV  211

Query  595  YGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY  774
              +G    SCE+D+WP LQ L+ DVISRTAFGSSYEEG+ IFEL KEQ   L++     Y
Sbjct  212  SKEG----SCELDIWPFLQNLSGDVISRTAFGSSYEEGRTIFELQKEQTELLIKALFSAY  267

Query  775  IPGLR  789
            IPG R
Sbjct  268  IPGFR  272



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 170/247 (69%), Gaps = 5/247 (2%)
 Frame = +1

Query  49   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            I   +   + +  L + W+ L WVW  PKKLEK LK  GLKG+ Y+ L GDMKE+  M  
Sbjct  6    IKIAISFVIVIIFLRWIWKFLDWVWIHPKKLEKRLKLEGLKGSSYKFLLGDMKEINSMVE  65

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            +A SKP+  +++   RV P++  L  +YGKNCY W+GP P + I +PE V+E+L+K  ++
Sbjct  66   EAKSKPINFTNDYISRVFPHFNKLMMQYGKNCYTWLGPKPTMLISEPEFVREILSKSYIY  125

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            QK + NP+ + L +GL SYE ++WAKHRR++NPAF+ +K K M P+F LSC +M++K + 
Sbjct  126  QKIQGNPITKLLAQGLASYETDKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMINKLDN  185

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            IV  KGS     E+DVWP LQ LT D ISRTAFGS+YEEG++IFEL KEQA  +++  R 
Sbjct  186  IVSSKGS-----EIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARW  240

Query  769  VYIPGLR  789
            +YIPG R
Sbjct  241  IYIPGWR  247



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 170/237 (72%), Gaps = 4/237 (2%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + +L +AWRVL W+W +PK+LE+CLKQ GL GN YR+L GD KE+  M  +A S+P++ S
Sbjct  16   ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISFS  75

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++  RV P++ H   KYGK+ ++WMG  P V I +PEL+++VL+ + +F+KPR + LG+
Sbjct  76   DDILQRVAPFHYHSIKKYGKSSFIWMGLKPRVNIMEPELIRDVLSMHTVFRKPRVHALGK  135

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
            +   GL   E E+WAKHR+++NPAF  EK K M PAF LSCS+M+SK E     K S+  
Sbjct  136  QPASGLFFLEGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWE----XKLSTXG  191

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE DVWP+LQ LT D ISRTAFGS+YEEG+ IFEL +EQA  LV+ ++   IPG R
Sbjct  192  SCEXDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSQSACIPGWR  248



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 169/243 (70%), Gaps = 5/243 (2%)
 Frame = +1

Query  61   LGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  240
            + + + +  L + W+ L WVW  PKK+EK LK  G KG+ Y+ L GDMKE+  M  +A S
Sbjct  10   ISLVIVIIFLRWIWKFLDWVWIHPKKMEKRLKLEGFKGSSYKFLLGDMKEMNSMVEEAKS  69

Query  241  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            KP+  +++   RV P++     +YGKNCY+W+GP P + I +PE ++E+L+K  ++QK +
Sbjct  70   KPINFTNDYISRVFPHFNKFMMQYGKNCYIWLGPKPTMLISEPEFIREILSKSYIYQKIQ  129

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
             NP+ + L +GL SYE E+WAKHRR++NPAF+ +K K M P+F LSC +M++K + IV  
Sbjct  130  GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMINKWDNIVSS  189

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
            KGS     EVDVWP LQ LT D ISRTAFGS+YEEG++IFEL KEQA  +++  R +YIP
Sbjct  190  KGS-----EVDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARWIYIP  244

Query  781  GLR  789
            G R
Sbjct  245  GWR  247



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 163/233 (70%), Gaps = 4/233 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
            A AWRVL WVW +PKKLEKCL+Q GL GN YR+ SGD+KE+  M  +A+SKPM  S + A
Sbjct  34   ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNHSHDTA  93

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRV+PY       YGKN ++W+GP P V I +PE +K +  K+E F K   NPL + L+ 
Sbjct  94   PRVLPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKLTANPLVKLLLT  153

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL +Y  E+WAKHR+++NPAF+SEK K M PA   SCSEM+ + E +V    S   S E+
Sbjct  154  GLANYGGEKWAKHRKIINPAFHSEKLKRMLPAIYQSCSEMIEEWESLV----SKESSYEL  209

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DVWP+LQ +T DVISRT+FGSSY+EG+ IF+LLK Q    ++T + VYIPG R
Sbjct  210  DVWPYLQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTMKTKQSVYIPGWR  262



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 178/253 (70%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYTL---LGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            ME ++ +   + + + +  L + W+ L WVW +PKK+EK LK  G KG+ Y++L GDMKE
Sbjct  1    METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  211  LVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL  390
            +  M  +A +KPM  +++   RV+P++  L  +YGKN ++W+GP P +FI DPEL++E+L
Sbjct  61   INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  391  NKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            +K  ++Q+ + NP+ + L +GLVSYE E+WAKHR+++NPAF+ +K K M P+F LSC +M
Sbjct  121  SKSYIYQEIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDM  180

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            L K E I   +GS     E+DVWP L+ LT D ISRTAFGS+YE+G++IFEL KEQA  +
Sbjct  181  LRKWESIASSEGS-----EIDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELI  235

Query  751  VETTRQVYIPGLR  789
            ++  R +YIPG R
Sbjct  236  LQAARWLYIPGWR  248



>ref|XP_006377672.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa]
 gb|ERP55469.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa]
Length=396

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 171/249 (69%), Gaps = 5/249 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
             + ++L   V V +L +AWRVL WVWF+PKK+E+CL+Q G  G PYR+L GD KE   M 
Sbjct  4    TVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKENSDML  63

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A +KP+ LSD + PRV+P+   L   YGKN ++W+GP P V I +P+ +++V  K   
Sbjct  64   KEARTKPIGLSDALLPRVMPFLHQLVKDYGKNSFMWIGPKPRVNIMNPDQIRDVFMKINE  123

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            +QKP ++PL + L  GL S+E E+WAKHR+++NPAF+ EK KLM PAF  SCS M++K E
Sbjct  124  YQKP-SHPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCSGMINKWE  182

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTR  765
             +V        SCE+DVWP LQGLTCD ISRT+FGS+YEEGKRIF+LLKE     V    
Sbjct  183  KLV---SVDEGSCELDVWPDLQGLTCDAISRTSFGSNYEEGKRIFDLLKELTDLTVHVII  239

Query  766  QVY-IPGLR  789
            + + IPG R
Sbjct  240  KAFVIPGYR  248



>ref|XP_010327096.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=250

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 173/255 (68%), Gaps = 10/255 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +     + +L + WR+L +VWFKPKKLEK L+Q GLKGN Y++L GDMK
Sbjct  1    MEISYYNLKIAIFSFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGLKGNSYKLLYGDMK  60

Query  208  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  384
            E+  M  +A SKP+  S D + PR+ P+       YGKNC+VW+GP P V I +P+L++E
Sbjct  61   EMKMMIEEATSKPINFSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIRE  120

Query  385  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCS  564
            VL K  ++ K R +PL +  + GL ++EK++WA HRR+LNPAF+ +K K M PAF L+  
Sbjct  121  VLTKNYVYHKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFHFDKLKHMLPAFKLTVG  180

Query  565  EMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            EML+  + IV   G+     E+DVW +LQ LT D+ISRTAFG++YEEGK+IFEL KEQ  
Sbjct  181  EMLNTWKEIVSKDGT-----EIDVWSYLQTLTSDIISRTAFGNNYEEGKKIFELQKEQIE  235

Query  745  HLVETTRQVYIPGLR  789
             + + T  +YIPG R
Sbjct  236  LISKMTHSIYIPGWR  250



>ref|XP_006442294.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 ref|XP_006442295.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55534.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
 gb|ESR55535.1| hypothetical protein CICLE_v10024650mg [Citrus clementina]
Length=266

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 165/239 (69%), Gaps = 4/239 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
              V V +L +AWRVL WVW +PKKLEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENFIELKEAKARP  70

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++L D++A RV P+   L + YGKN ++W GP P V I +P+ +K +  +   FQK  + 
Sbjct  71   LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTRINDFQKVNSI  130

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL R L+ GL + E E+WAKHR+L+NPAF+ EK KLM PAF LSC E+++K E  +  +G
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEG  190

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            SS    E+DVWP+L  LT DVISRTAFGSSYEEG+RIF+L  E A   ++  R V+IPG
Sbjct  191  SS----ELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPG  245



>gb|KJB12901.1| hypothetical protein B456_002G043400 [Gossypium raimondii]
Length=518

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 163/229 (71%), Gaps = 4/229 (2%)
 Frame = +1

Query  103  RVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVI  282
            R L WVW  PK+LE CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++ P V+
Sbjct  25   RTLNWVWLAPKRLESCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDIGPYVV  84

Query  283  PYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLVS  462
            P+    A++YGKN + W GP P V I DPE ++E+LNK+  FQK   NPL   LV GL +
Sbjct  85   PFQHQTANQYGKNSFTWFGPRPRVNITDPEKIREILNKFNDFQKIHTNPLLNLLVSGLAN  144

Query  463  YEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDVWP  642
             + ++W+K R+++NPAF+ +K K M PAF  SCS+MLSK E +V  KG S    E+DVWP
Sbjct  145  LDGDRWSKRRKIINPAFHQDKLKNMLPAFYQSCSDMLSKWEKMVCTKGYS----ELDVWP  200

Query  643  HLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +L  LT DVISR+AFGSS+EEGKRIF+LL++Q +H+++  + VYIPG R
Sbjct  201  YLVDLTRDVISRSAFGSSFEEGKRIFQLLEDQLVHIIKLIQTVYIPGWR  249



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 4/233 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
            A AWRVL WVW +PKKLEKCL+Q GL GN YR+ SGD+KE+  M  +A+SKPM LS + A
Sbjct  21   ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNLSHDTA  80

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRV+PY       YGKN ++W+GP P V I +PE +K +  K+E F KP  +PL + L+ 
Sbjct  81   PRVVPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKPALSPLVKLLLT  140

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL +Y  E+WAKHR+++ PAF+SEK K M PA   SCSEM+ + E +V    S   S E+
Sbjct  141  GLANYGGEKWAKHRKIIKPAFHSEKLKRMLPAIYQSCSEMIEEWESLV----SKESSYEL  196

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DVWP+LQ +T DVISRT+FGSSY+EG+ IF+LLK Q    V+    VYIPG R
Sbjct  197  DVWPYLQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTVKMKHSVYIPGWR  249



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 162/240 (68%), Gaps = 5/240 (2%)
 Frame = +1

Query  73   VSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  249
            ++VG+L    W++L W W  PKKLEKCL+Q G  GN YR+L G++KE+  M   A S+PM
Sbjct  15   LAVGVLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRPM  74

Query  250  TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNP  429
            +L+D++AP VIPYY      YGKN   W GP P V I DPEL++E+ NK+  FQKPR NP
Sbjct  75   SLTDDIAPYVIPYYHQTVTNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNEFQKPRINP  134

Query  430  LGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGS  609
            L   L  G+++ E E+WAKHR+++ P+F+ +K K M PAF   C+EM+ K E  V   GS
Sbjct  135  LITLLFSGILTLEGERWAKHRKIITPSFHLDKLKNMLPAFYECCTEMIEKWEEAVSVNGS  194

Query  610  SSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            S    EVDVWP L  LT DVISR AFGSSYEEG+RIF LL EQ   L ET + +Y+PG R
Sbjct  195  S----EVDVWPCLVNLTRDVISRAAFGSSYEEGRRIFLLLDEQTNLLTETVQSLYVPGWR  250



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 174/253 (69%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYTLL--GVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            ME+ Y  +   +CV++ LL +  RVL W WFKPKKLEK L++ GLKGNPY++  GD+ E+
Sbjct  1    MEISYNRIIEAICVAI-LLVYTLRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEI  59

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
                ++A SKP+  SD++A R+IP++    +K GK+ +VW GP P+V I DPE VKE+  
Sbjct  60   TNKLNEARSKPINFSDDIAQRLIPFFIDSINKNGKSSFVWQGPCPIVLITDPEHVKEIFT  119

Query  394  KYELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K  ++QK  + NP  + L  G++  E+ +WAKHR+++NP F  EK K M PAF  SCSEM
Sbjct  120  KNYVYQKDTHPNPFSKFLAVGILKLEENKWAKHRKIINPVFQVEKLKHMLPAFYQSCSEM  179

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            +SK E IV        S E+DVWP LQ +T ++ISRTAFGSS+EEG+ +FEL KEQA H+
Sbjct  180  ISKWEDIV----PKETSVELDVWPDLQLMTAEIISRTAFGSSFEEGRIVFELQKEQAEHV  235

Query  751  VETTRQVYIPGLR  789
            +E +R +YIPG R
Sbjct  236  MEISRTIYIPGSR  248



>ref|XP_007022096.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13621.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=482

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 170/247 (69%), Gaps = 7/247 (3%)
 Frame = +1

Query  58   LLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            ++G+ +S   VG+L + WR++ WVW KPK+LE+CL+Q GL GN YR LSGD+KE   M+ 
Sbjct  6    VIGISLSFLVVGILIWGWRIVDWVWVKPKRLERCLRQQGLTGNSYRFLSGDIKESFAMSR  65

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
             A S+PM L D++   V P+       YGKN + W+GP+P V I +PE ++E+  K+  F
Sbjct  66   QARSQPMPLGDDITQYVGPFLHQTVKNYGKNSFSWVGPIPRVTIMEPEDIREIFTKFNDF  125

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            QKP  NPL   LV GLV+ + E+WAKHR+++NPAF+ +K K M PAF  SC EM+SK E 
Sbjct  126  QKPHTNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEK  185

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            +V+ +GS     E+DVWP+L  LT DVISR AFGSSYEEG+RIF+LL++Q    ++  + 
Sbjct  186  LVFLEGSR----ELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTNLTMQVVQS  241

Query  769  VYIPGLR  789
             YIPG R
Sbjct  242  AYIPGWR  248



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 175/251 (70%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLG-VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME++  L+   C  V ++   WR+  WVW +P+KLEK L+  G  GN YR+  GD+KE++
Sbjct  1    MELVLKLISSFCAIVVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMI  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M  +A SKP+ L D++ PR+IP    +   YGKN ++W+GP PMV I +P+ +K+VL+K
Sbjct  61   VMLKEAKSKPINLYDDIIPRIIPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKDVLSK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
            +  FQKPR+NPL + L  G+   E ++WAKHR+L+NPAF+ EK K M PA  LS SE+++
Sbjct  121  FYQFQKPRHNPLTKLLATGVADAEGDRWAKHRKLINPAFHLEKLKNMLPAIYLSSSEIVT  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E +V  KG      E+DV P+L+ LT DVISRTAFGSSYEEG++IF+L +EQA  +++
Sbjct  181  KWEEMVSTKG----QFELDVLPYLETLTSDVISRTAFGSSYEEGRKIFQLQREQAELIIQ  236

Query  757  TTRQVYIPGLR  789
             ++ +Y+PG+R
Sbjct  237  ASQTIYLPGMR  247



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 164/228 (72%), Gaps = 4/228 (2%)
 Frame = +1

Query  106  VLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVIP  285
            +L W+W +PK+LE+ L++ GL+GNPYRIL GD+KE+VK+  +A SKPM LS ++ PRV  
Sbjct  1    MLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFA  60

Query  286  YYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGLVSY  465
            +      K+GKN ++W GP P V + DPEL+K+VLNK   F+KP  NPL + L  GLV+Y
Sbjct  61   HLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLVNY  120

Query  466  EKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDVWPH  645
            + E+W KHRRL+NPAF  EK K+M P F  SC++++ K EG++    SS  SCE+DVWP 
Sbjct  121  DGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWEGML----SSDGSCEMDVWPF  176

Query  646  LQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            LQ L  DVI+RTAFGSS+EEGKRIF+L KE A   ++   +VYIPG R
Sbjct  177  LQNLASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWR  224



>ref|XP_011082818.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=521

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 169/237 (71%), Gaps = 3/237 (1%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            VGL+ +A R+L WVWF+PKKLEK L++ GL+GNPYR L GDMK L+ +  +  +K + LS
Sbjct  17   VGLITWAVRILNWVWFRPKKLEKLLRKQGLQGNPYRFLLGDMKTLISVTKEEQTKSIQLS  76

Query  259  DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
            D++AP ++PYY  + ++YG+N ++W GP P + I DP+L+KE+L K E+F KP  +P+G 
Sbjct  77   DHLAPHILPYYHQIINEYGQNSFIWFGPSPRLNITDPQLMKEILTKPEVFHKPLPDPIGE  136

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             +  GL+  E E+WA+HR+++NPAF+ EK K M  A  LSCS M+ K E +      S  
Sbjct  137  TIAGGLLFLEDEKWAQHRKIINPAFHMEKLKNMVSAIRLSCSNMVEKWESMF---SRSER  193

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            S E+DVWPHL+ L+ DVISRTAFGSS+EEG+RIFEL +EQ   ++E  +  +IPG R
Sbjct  194  SLEIDVWPHLESLSGDVISRTAFGSSHEEGRRIFELHREQVKLVLELLKFFFIPGWR  250



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 174/251 (69%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME   +   + V+   +   +R+  W+WFKPKK+EK L++ GL G  Y+ + GD+KELV+
Sbjct  1    MESPTSFFALGVASIFIYLIYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQ  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M+++A SKPM+L+ ++A RV+P+Y +    +GK C+ W+G  P+V + +P +++EVLN Y
Sbjct  61   MSNEAKSKPMSLNHDIANRVLPFYYNALSTHGKTCFTWLGIKPVVHLSEPTMIREVLNNY  120

Query  400  ELFQKPR-NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
              +QKPR  NPL + L RG+   E +QW KHR+++NPAF+ EK K M PAF +SCSEML 
Sbjct  121  NQYQKPRAGNPLTKLLARGVADAEADQWVKHRKIINPAFHVEKLKHMVPAFYVSCSEMLD  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K    V    +   S EVDVW +L   + DVISRTAFGSSYEEG++IFEL +EQA+ +++
Sbjct  181  KWGETV----TKESSGEVDVWTYLSTFSADVISRTAFGSSYEEGRKIFELQREQAVLIIK  236

Query  757  TTRQVYIPGLR  789
             ++ VYIPGLR
Sbjct  237  ASQSVYIPGLR  247



>emb|CDY32348.1| BnaC01g36670D [Brassica napus]
Length=512

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 167/242 (69%), Gaps = 6/242 (2%)
 Frame = +1

Query  67   VCVSVGLLA---FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            V VSV + A   + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A 
Sbjct  8    VTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEAR  67

Query  238  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            SKP+ L+D++ PRV+P+ +H+   YG+  + W GP+P + I +PE +KEVLNK   FQKP
Sbjct  68   SKPIKLTDDIVPRVLPFPSHMLKTYGRTFFTWRGPIPTITITNPEQIKEVLNKIYDFQKP  127

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
               PL R +  GL SY+ ++WAKHRR++NPAF+ +K K M PAF  SCSE++ K + IV 
Sbjct  128  NTFPLSRLVASGLFSYDGDKWAKHRRIINPAFHLDKIKNMVPAFHQSCSEVVVKWDNIVM  187

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
             KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG RIFEL  E +  ++++ R+ +I
Sbjct  188  DKGS---SCEVDVWPWLMNMTADVISRTAFGSSYKEGHRIFELQAELSELIIQSFRKAFI  244

Query  778  PG  783
            PG
Sbjct  245  PG  246



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 169/243 (70%), Gaps = 6/243 (2%)
 Frame = +1

Query  64   GVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISK  243
             +CV+V LL + WRVL W W KPKKLEK L++ GLKGNPY++  GD+KE     ++A SK
Sbjct  11   AICVAV-LLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFTNKLNEAKSK  69

Query  244  PMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN  423
            P+  SD++A R+IP++    +K GK+ +VW+GP P+V I DPE VKE+  K  ++QK  +
Sbjct  70   PINFSDDIAQRLIPFFCDSINKNGKSSFVWLGPYPVVLITDPEHVKEIFTKNYVYQKETH  129

Query  424  -NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
             NP  + L  GL   E+++WAKHR+++NPAF +EK K M PAF  SCSE++SK E I+  
Sbjct  130  PNPFSKLLAIGLAKLEEDKWAKHRKIINPAFQTEKLKHMLPAFYQSCSEIISKWEEII--  187

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
                  S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL  EQA ++ +  R +YIP
Sbjct  188  --PKETSFELDVWPDLQLMTAEVISRTAFGSSYEEGRIVFELQNEQAEYVTDINRSIYIP  245

Query  781  GLR  789
            G R
Sbjct  246  GSR  248



>ref|XP_010465361.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 161/230 (70%), Gaps = 2/230 (1%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            + WR L WVWFKPK LE  L++ GL G PY  L GD+K    M ++A SKP+ L+D++ P
Sbjct  20   WVWRTLNWVWFKPKMLESYLRRQGLAGTPYTPLVGDVKRNSSMLAEARSKPIQLTDDITP  79

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            RV+P++ H+   +G+  + W+GP+P V I DPEL+KEV N    FQK  +NPLGR +  G
Sbjct  80   RVVPFHLHMLKTHGRTFFTWLGPIPTVTIMDPELIKEVFNNVNDFQKAHSNPLGRLIATG  139

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            LVSY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ + + +V  K     SCE+D
Sbjct  140  LVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGQWDKLVLDK--EGLSCEMD  197

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            VWP L  LT DVISRTAFGSSY+EG+RIFEL  E A  L++  R+ +IPG
Sbjct  198  VWPWLVSLTADVISRTAFGSSYKEGQRIFELQAELARLLIQNFRKAFIPG  247



>gb|AJD25170.1| cytochrome P450 CYP72A329 [Salvia miltiorrhiza]
Length=512

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 167/248 (67%), Gaps = 4/248 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            M+V  + + +  +   L + W++L WVWF PKKLEK L+Q G  GN Y++  GD KE+  
Sbjct  1    MDVFISTVEISCAAVALIYLWKLLNWVWFTPKKLEKILRQQGFNGNSYKLFYGDFKEIRS  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            +A +A+SKPM  S+++APR IP Y     +YG+  + W GP P + I +PE+++E+ +K 
Sbjct  61   IAKEAVSKPMNFSNDIAPRAIPIYHQTCKRYGEKSFTWFGPKPAINITEPEMIREITSKN  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +F KP  NP G+ L +G+  YE ++WAKHR+L+NPAF+ +K K M PAF +S ++ML K
Sbjct  121  YVFLKPTGNPFGKMLAKGVALYETDKWAKHRKLINPAFHVQKLKHMVPAFHVSTADMLKK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             + +V   G    SCEVDVWP LQ +T DVISRTAFGSSYEEG +IF+L +EQ   ++E 
Sbjct  181  WDELVPDGG----SCEVDVWPGLQTMTSDVISRTAFGSSYEEGTKIFQLQREQVERIIEA  236

Query  760  TRQVYIPG  783
             R + +PG
Sbjct  237  GRHMPVPG  244



>gb|KEH28455.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=415

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 172/250 (69%), Gaps = 6/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME   +++ + V+VGL+ +AWR+L W+W +PKKLEK L++ GL+GNPYRIL GD+K+L+K
Sbjct  1    MEWYSSIIPIIVTVGLI-WAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLK  59

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SK M L+D++ PRVIPY  H    +GKN ++W G  P V + +PE + +VLN  
Sbjct  60   MEKEARSKSMNLTDDIMPRVIPYIQHNVKIHGKNSFMWFGTKPRVILTEPEQIIDVLNNI  119

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              F K  N+ + + LV GL S E E+W+KHRRL+NPAF+SEK K+M P F  SC++++ K
Sbjct  120  SDFPK-NNHKIFKLLVSGLASLEGEKWSKHRRLINPAFHSEKLKVMTPTFFTSCNDLIRK  178

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E ++   G    SCE+D+WP LQ L  DVISRT FGSSYEEG+RIF+L  EQA  + + 
Sbjct  179  WEEMLSPDG----SCEIDIWPSLQNLASDVISRTTFGSSYEEGRRIFQLQIEQAELMTKV  234

Query  760  TRQVYIPGLR  789
                YIP  R
Sbjct  235  QMNFYIPLWR  244



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 164/231 (71%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W++  W+WF+PKKLEK L+Q G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  20   GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPR  79

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            VIP   H   +YGKN ++W+GP+P V I DPE +K V + Y  FQKP  NP  + LV+G+
Sbjct  80   VIPSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGI  139

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
            V+ + E+W KHR+++NPAF+ EK K M PAF  SC+EM+SK E +V  +G    SCE+DV
Sbjct  140  VNLDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSKEG----SCELDV  195

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             P+L+ +  DVISRTAFGSSYE+GK+IF+L  E    +++TT  +YIPG R
Sbjct  196  MPYLKXMASDVISRTAFGSSYEKGKKIFKLQTELTNFVIQTTLGIYIPGWR  246



>ref|XP_006348982.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=860

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 174/242 (72%), Gaps = 5/242 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
             CV++ L+ + W+VL W WF+PKKLEK L++ GLKGNPY++L GD+KEL    ++A SKP
Sbjct  32   TCVAILLVIYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELTNKLNEAKSKP  91

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-  423
            +  SD+V  R+IP++    +K GKN + W+GP P+VFI +P L+K +  K+ ++ K ++ 
Sbjct  92   INFSDDVPQRIIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHS  151

Query  424  NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGK  603
            NP  + LVRGLV+ E+++WAK+R+++NPAF+ EK K M PAF  SCSEMLSK E  V   
Sbjct  152  NPFAKLLVRGLVTLEEQKWAKYRKIINPAFHFEKLKHMVPAFYQSCSEMLSKWEEAV---  208

Query  604  GSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
                 S E+DVWPH Q +T +VISRTAFGSSYEEG+ +FEL KEQA +++E    +YIPG
Sbjct  209  -PKETSVELDVWPHFQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVMEQVFSIYIPG  267

Query  784  LR  789
             R
Sbjct  268  SR  269


 Score =   169 bits (428),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 116/166 (70%), Gaps = 7/166 (4%)
 Frame = +1

Query  301  ADKY--GKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-NPLGRKLVRGLVSYEK  471
             DKY  GKN + W+GP P+VFI +P L+K +  K+ ++ K ++ NP  + LVRGLV+ E+
Sbjct  430  TDKYSAGKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHSNPFAKLLVRGLVTLEE  489

Query  472  EQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDVWPHLQ  651
            ++WAK+R+++NPAF+ EK K M  AF  SCSEMLSK E  V        S E+DVWPH Q
Sbjct  490  QKWAKYRKIINPAFHFEKLKHMVLAFYQSCSEMLSKWEEAV----PKETSVELDVWPHFQ  545

Query  652  GLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             +  +VISR AFGSSYEEG+++FEL KEQA +++E    +YIPG R
Sbjct  546  LMIGEVISRIAFGSSYEEGRKVFELQKEQAEYVMEQVFSIYIPGSR  591



>ref|XP_011082969.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 175/251 (70%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME ++ ++   +   +L +AWRV+ W + +PK++EK L++ G  G+ YR+++ ++KE +K
Sbjct  1    MEGVWQIIAASLGFVVLIWAWRVVKWAYMRPKRVEKLLRKQGFNGSSYRLVNRELKERLK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A S P+ L D++ PR++P+Y      YG   ++W+G  P V I DPEL+KEV+ K 
Sbjct  61   MVKEAKSNPINLDDDIKPRILPFYTKTIQTYGTESFMWLGLSPTVIISDPELIKEVMTKT  120

Query  400  ELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
             +++K +N NPL R L +GL SY+ ++WAKH++++NPAF+ EK KLM PAF LSC E+L+
Sbjct  121  HIYKKIKNANPLTRLLAQGLFSYDLDKWAKHKKIINPAFHMEKLKLMIPAFYLSCDEVLN  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E  +  +G    SCEVDVWP LQ L+ D ISRTAFGSSY+EG+RIFEL +EQA H   
Sbjct  181  KWEKSLSPEG----SCEVDVWPFLQNLSSDAISRTAFGSSYQEGRRIFELQREQAGHFFI  236

Query  757  TTRQVYIPGLR  789
             +R +YIPG R
Sbjct  237  ASRSMYIPGWR  247



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 171/245 (70%), Gaps = 8/245 (3%)
 Frame = +1

Query  67   VCVSV--GLLAFAW--RVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
            +C+     ++AF +  ++L WVWF+P+ LEK L++ G  GN YR+L GD+K++  M+ +A
Sbjct  5    ICLQTLSAIVAFTYVCKILNWVWFRPRNLEKRLRRQGFTGNSYRVLYGDLKDMRLMSKEA  64

Query  235  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
             SKP+  S +   R++P +     KYG+NC+VW GP P + + +PE V+EV++K  +FQK
Sbjct  65   SSKPLDFSHDFVHRIMPIFHFALKKYGENCFVWFGPSPAILVMNPESVREVVSKSNVFQK  124

Query  415  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIV  594
            P   P  R + +GLV+ E ++WAKHRRL+NPAF+  K + M P+F LSC EMLSK + IV
Sbjct  125  PPGRPFIRLMSKGLVTLETDKWAKHRRLINPAFHVHKLEHMVPSFYLSCDEMLSKWDKIV  184

Query  595  YGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY  774
               G+  C CEVDVWP+LQ LT DVISRTAFGSSY EG++IFEL +E A H++E  R VY
Sbjct  185  ---GNEGC-CEVDVWPYLQTLTSDVISRTAFGSSYLEGRKIFELQRELAQHVMEGNRSVY  240

Query  775  IPGLR  789
            IPG R
Sbjct  241  IPGYR  245



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 169/237 (71%), Gaps = 8/237 (3%)
 Frame = +1

Query  88   LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT-LSDN  264
            + +AW+VL WVWF+P+ LEK L+QLG +GN YR+L GD KE+  M  +A SKP++  S++
Sbjct  17   IVYAWKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSND  76

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  444
            +  RVIP   H    YG+ C +W GP P V + D EL++E+L+K  +FQK  +NPLGR+L
Sbjct  77   IVARVIPAIHHAVSMYGEKCILWFGPKPAVLVTDTELIREILSKSYVFQK-NSNPLGRQL  135

Query  445  VRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSC  624
             RG+ +YE ++WAKHRRL+NPAF  +K K M P+F LSC +MLSK E  +  +GSS    
Sbjct  136  ARGVATYETDKWAKHRRLINPAFQPDKIKQMLPSFYLSCCDMLSKWEEKLAKEGSS----  191

Query  625  EVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV--YIPGLR  789
            EVDVWP+LQ LT D ISRTAFGSSYEEG++IFEL KEQA  +++  + +   IPG R
Sbjct  192  EVDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQAELIMQAVQSINFQIPGWR  248



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 172/247 (70%), Gaps = 7/247 (3%)
 Frame = +1

Query  58   LLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            ++G+ +S   VG+L + WR+L WVW +PK+LE+CL++ GL GN YR LSGD+KE   M+ 
Sbjct  6    VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
             A SKPM LSD++   V P+        GK+ + W+GP+P V I +PE ++E+  K+  F
Sbjct  66   QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            QKP +NPL   LV GLV+ + E+WAKHR+++NPAF+ +K K M PAF  SC EM+SK E 
Sbjct  126  QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEK  185

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            +V+ +GSS    E+DVWP+L  LT DVISR AFGSSYEEG+RIF+LL++Q    ++  + 
Sbjct  186  LVFLEGSS----ELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQS  241

Query  769  VYIPGLR  789
             YIPG R
Sbjct  242  AYIPGWR  248



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 173/252 (69%), Gaps = 6/252 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVG-LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+ Y  +   +SV  LL + W+VL W WFKPKKLEK L++ GLKGN Y++L GD+KEL 
Sbjct  1    MEISYNRIIAAISVAILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELT  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
               ++A SKP+  S +V  R+IP++    +K GK+ ++W+GP P+V I DPE VKE+L K
Sbjct  61   NKLNEAKSKPIHFSGDVPQRLIPFFCDSINKNGKSSFMWLGPYPVVLITDPEHVKEILTK  120

Query  397  YELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
              ++Q+  + NP  +KL  GL   E+++WAKHR+++ PAF  EK K M PAF  SCSEM+
Sbjct  121  NYVYQRQTHPNPFAKKLALGLAKLEEDKWAKHRKIIQPAFQLEKLKHMLPAFYQSCSEMI  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            SK E I+        S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA +++
Sbjct  181  SKWEEII----PKETSFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVI  236

Query  754  ETTRQVYIPGLR  789
               R VYIPG R
Sbjct  237  NIIRSVYIPGTR  248



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 172/247 (70%), Gaps = 7/247 (3%)
 Frame = +1

Query  58   LLGVCVS---VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            ++G+ +S   VG+L + WR+L WVW +PK+LE+CL++ GL GN YR LSGD+KE   M+ 
Sbjct  6    VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
             A SKPM LSD++   V P+        GK+ + W+GP+P V I +PE ++E+  K+  F
Sbjct  66   QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            QKP +NPL   LV GLV+ + E+WAKHR+++NPAF+ +K K M PAF  SC EM+SK E 
Sbjct  126  QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEK  185

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            +V+ +GSS    E+DVWP+L  LT DVISR AFGSSYEEG+RIF+LL++Q    ++  + 
Sbjct  186  LVFLEGSS----ELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQS  241

Query  769  VYIPGLR  789
             YIPG R
Sbjct  242  AYIPGWR  248



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 165/240 (69%), Gaps = 3/240 (1%)
 Frame = +1

Query  70   CVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPM  249
             V V ++ +A ++L W W KPKKLEK L++ G +GN YR L GD+KE   ++  A SKP+
Sbjct  12   IVIVTVVTWACKILNWAWLKPKKLEKQLRRQGFRGNSYRFLFGDVKEHGILSRQAKSKPI  71

Query  250  TLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNP  429
            +L D++APRV+P Y      YGKN Y W+GP+PM+ I DP+ +KEV      FQKP+ NP
Sbjct  72   SLDDDIAPRVVPLYDQREKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNP  131

Query  430  LGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGS  609
            LG+ L  GL   E E+WAKHR+++NPAF+ EK KLM PAF  SC+E++SK E ++ G   
Sbjct  132  LGKILTTGLAIREGEKWAKHRKIINPAFHQEKLKLMLPAFYQSCTEIISKWEKLMIG---  188

Query  610  SSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
               SCE+DVWP+L  LT DVISRTAFGS+YEEG RIF+L  E A   ++  + VYIPG R
Sbjct  189  DQGSCELDVWPYLVKLTSDVISRTAFGSNYEEGIRIFQLQTELADIALQALQSVYIPGWR  248



>gb|KDO52111.1| hypothetical protein CISIN_1g046539mg [Citrus sinensis]
Length=484

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 169/236 (72%), Gaps = 4/236 (2%)
 Frame = +1

Query  85   LLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSD  261
            +LA+ AW++L W W KPKKLE  L+Q G  GN Y+I  GD K++  M  +A ++P++LSD
Sbjct  13   ILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLKEAKARPISLSD  72

Query  262  NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRK  441
            ++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N LG+ 
Sbjct  73   DIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGNSLGKL  132

Query  442  LVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCS  621
            +V G+V+YE EQW+K R++ NPAF+ +K K M P   LSC+ M+ K   I     S   S
Sbjct  133  VVNGMVTYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCNHMIRKLFEIA---ASDEES  189

Query  622  CEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             E+D+WPH+Q L  DVISRTAFGS+Y++G++IFEL++EQ+   +E ++  YIPG R
Sbjct  190  FELDIWPHIQALAADVISRTAFGSNYDDGRKIFELIREQSHLFIEVSQFDYIPGWR  245



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 166/238 (70%), Gaps = 6/238 (3%)
 Frame = +1

Query  79   VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLS  258
            + +L +AWR+L +VW KPK LEK L++ G KG+ Y+ L GDMKE+ KM  +A SKP+  S
Sbjct  17   IFVLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGEEAWSKPVNFS  76

Query  259  -DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLG  435
             D + PRV P+   +   YGKNC+VW GP P V I DPE++KEV+ K  +FQKP  NPL 
Sbjct  77   HDTIWPRVNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEVMMKNYVFQKPGGNPLT  136

Query  436  RKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSS  615
            + L  G+  YE ++WA HRRLLNPAF+ +K K M PAF L+ +EMLSK E IV  +GS  
Sbjct  137  KLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTGNEMLSKWEKIVSREGS--  194

Query  616  CSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
               E+DV P+LQ LT D ISRTAFGSSYEEG +IFEL KEQ   ++E +R +YIPG R
Sbjct  195  ---EIDVLPYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILEVSRTIYIPGWR  249



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 163/232 (70%), Gaps = 4/232 (2%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            +AW++L W+WF PK+LEK L++ G +GNPY++L GD KE +KM  +A+SKPM LSD++ P
Sbjct  19   WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            RV  Y  H    +GKN ++W+GP P V I DPE +K++ NK   F KP  NPL + L  G
Sbjct  79   RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLLKLLATG  138

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            L  YE E+W+KHRRL+NPAF  EK K M P F  SC+++++K E ++    SS  SCE+D
Sbjct  139  LADYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERML----SSDGSCEID  194

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             WP LQ +T DVI+R+AFGSS+EEG+RIF+L +EQA   ++   ++ IPG R
Sbjct  195  AWPFLQNMTSDVIARSAFGSSFEEGRRIFQLQREQAKLALQVILKIQIPGWR  246



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 168/247 (68%), Gaps = 4/247 (2%)
 Frame = +1

Query  49   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            I  +L   + + L+ + WR++ WVW +P+KLEKC ++ G+ G+PYR L GD KE+ +M  
Sbjct  3    IVAILFSAIVIALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTK  62

Query  229  DAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
            +A  KP+ L+D++ PR+ P+Y H  +KYG +C+ W+GP P +F+  PEL+KE++    +F
Sbjct  63   EAKFKPIKLTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNNTIF  122

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            +KP+  PL + LV G+ SYE ++WAKHR++LN AFY+EK K M PA   SC +M++K E 
Sbjct  123  KKPKPAPLVQLLVSGISSYEDDKWAKHRKILNTAFYAEKLKCMLPAMHTSCEDMINKWEI  182

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            ++    S + SCE+DV P+ +  T DVISRTAFGSSY EG RIF L KE A    +  + 
Sbjct  183  LL----SENKSCELDVHPYFEDFTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQS  238

Query  769  VYIPGLR  789
            VYIPG R
Sbjct  239  VYIPGWR  245



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 170/250 (68%), Gaps = 5/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME++ + L +C +V +L + W+++  VWF+P+K+EK L+Q G  G  YR L GD+ E+  
Sbjct  1    MELLQSFLALCCTVVVLIYGWKIMNLVWFRPRKMEKILRQQGFGGKSYRFLIGDLNEMKN  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A+SKP+  SD+  PR I +       +G+N +VW+GP   V I DPE V+EVL+K 
Sbjct  61   MGEEALSKPIDFSDDFVPRTISFIHKTVTNHGENSFVWLGPYAAVIISDPENVREVLSKS  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +FQKP  NPLG+ + +GL SYE ++WAKHRRL+NPAF+ +K K M P+F  SC+EMLSK
Sbjct  121  YVFQKPY-NPLGKLVAQGLASYETDKWAKHRRLINPAFHLDKVKHMLPSFHKSCAEMLSK  179

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E IV  +G      E+DVWP+LQ +T D IS TAFGSSYE+G +IFEL KEQA  L++ 
Sbjct  180  WEKIVPSEG----CFELDVWPYLQTMTSDAISLTAFGSSYEQGIKIFELQKEQAALLIKA  235

Query  760  TRQVYIPGLR  789
                +IPG R
Sbjct  236  ILSAFIPGWR  245



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 170/244 (70%), Gaps = 7/244 (3%)
 Frame = +1

Query  67   VCVSVGL---LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            VC+ V L   L  AWRVL W+W +PK+LE+ L++ GL+GNPYR+L GD+KE++ M  +  
Sbjct  7    VCLVVILILALTLAWRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMNMQKEVT  66

Query  238  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            SKPM LS ++ PRV  +  H  + +GKN ++W G  P V I +PEL+K+VLNK   F KP
Sbjct  67   SKPMNLSHDIVPRVFSFLQHTLNTHGKNSFIWFGRKPRVIITEPELIKDVLNKMHDFPKP  126

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
              +PL + L  GL+++E E+W KHRR+++PAF  EK K M P F  SC++++ K E ++ 
Sbjct  127  DTSPLVKLLATGLLNHEGEKWNKHRRIISPAFNLEKLKNMLPIFYKSCNDLIIKWEEML-  185

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
               SS  SCE+DVWP LQ L+ D I+RTAFGSSYEEG++IF+LLKEQA   ++   ++YI
Sbjct  186  ---SSDGSCEIDVWPFLQNLSSDAIARTAFGSSYEEGRKIFQLLKEQAELAMKAIMKLYI  242

Query  778  PGLR  789
            PG R
Sbjct  243  PGWR  246



>ref|XP_011460847.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Fragaria vesca subsp. vesca]
Length=523

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 163/237 (69%), Gaps = 5/237 (2%)
 Frame = +1

Query  85   LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSD-  261
            ++ +AW +L W W KPKKLE+CL+Q G +GN YR+L GD +E   M   A SKPM LS  
Sbjct  19   IVRWAWSLLDWGWLKPKKLERCLRQQGFEGNSYRLLYGDTEENFIMLKKAKSKPMNLSTS  78

Query  262  -NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGR  438
             ++ PRV P        Y KN +VWMGP+P V I +PE +K+V  K+  FQKP +NPL +
Sbjct  79   HDITPRVTPLLHXTVKTYSKNSFVWMGPIPRVNIMNPEDLKDVFTKFIDFQKPHSNPLVK  138

Query  439  KLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSC  618
             L  GL +YE E+WAKHRR++NP F+ +K K M PAF  SC EM+ + E +V      S 
Sbjct  139  LLATGLANYEGEKWAKHRRIINPTFHFDKLKRMLPAFYQSCDEMIKEWETVV---SKESS  195

Query  619  SCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            SCE+DVWP LQ +T DVISRTAFGSSY+ G++IFELLKEQA++ +++ + VYIPG R
Sbjct  196  SCEIDVWPSLQNVTADVISRTAFGSSYQAGRKIFELLKEQAVYAMKSIQSVYIPGWR  252



>ref|XP_009411224.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=378

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 164/234 (70%), Gaps = 5/234 (2%)
 Frame = +1

Query  85   LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  264
            LL +A R L   W+ P++LE+ L+  GL G PYR   GD+KE V++  +A+S PM L+ N
Sbjct  24   LLVWALRTLNRAWWTPRRLERALRAQGLNGTPYRFPKGDLKENVRLDKEALSTPMPLTHN  83

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYELFQKPRNNPLGRK  441
            + PRV+P+     D+YGK C+ W GP+P V I DPELV+EVL NK+  F KP+   LGR 
Sbjct  84   IVPRVLPFLRRAIDEYGKICFTWFGPVPRVTIMDPELVREVLSNKFGHFGKPKGILLGRF  143

Query  442  LVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCS  621
            L RGLVSYE E+W KHRR++NPAF+ EK K M PAF   CS+++S+ E +V   GS +C 
Sbjct  144  LFRGLVSYEGEKWVKHRRIMNPAFHVEKLKRMLPAFCACCSDLMSRWENLV---GSEACY  200

Query  622  CEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
             E+DVWP  Q  T DVISRTAFGSSYEEG+RIF+L  EQA  ++++ + +YIPG
Sbjct  201  -ELDVWPEFQSFTGDVISRTAFGSSYEEGRRIFQLQTEQAELVIQSIQNLYIPG  253



>ref|XP_006477887.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 171/241 (71%), Gaps = 4/241 (2%)
 Frame = +1

Query  70   CVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
             ++  +LA+ AW++L W W KPKKLE  L+Q G  GN Y+I  GDMK++  M  +A ++P
Sbjct  8    ALATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKEAKARP  67

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            +++SD++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKPR N
Sbjct  68   ISVSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPRGN  127

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
             L + +V G+V YE EQW+K R++ NPAF+ +K K M P   LSC+ M+ K   I     
Sbjct  128  SLSKLVVNGMVMYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCNHMIRKLFEIA---A  184

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            S   S E+D+WPH+Q L  DVISRTAFGS+Y++G++IFEL++EQ+  L+E ++  YIPG 
Sbjct  185  SDEESFELDIWPHIQALAADVISRTAFGSNYDDGRKIFELIREQSHLLIEVSQFDYIPGW  244

Query  787  R  789
            R
Sbjct  245  R  245



>ref|XP_006477888.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 171/241 (71%), Gaps = 4/241 (2%)
 Frame = +1

Query  70   CVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
             ++  +LA+ AW++L W W KPKKLE  L+Q G  GN Y+I  GD K++  M  +A ++P
Sbjct  8    ALATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLKEAKARP  67

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++LSD++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N
Sbjct  68   ISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGN  127

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
             LG+ +V G+V+YE EQW+K R++ NPAF+ +K K M P   LSC+ M+ K   I     
Sbjct  128  SLGKLVVNGMVTYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCNHMIRKLFEIA---A  184

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            S   S E+D+WPH+Q L  DVISRTAFGS+Y++G++IFEL++EQ+   +E ++  YIPG 
Sbjct  185  SDEESFELDIWPHIQALAADVISRTAFGSNYDDGRKIFELIREQSHLFIEVSQFDYIPGW  244

Query  787  R  789
            R
Sbjct  245  R  245



>gb|KJB12905.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=380

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 162/234 (69%), Gaps = 4/234 (2%)
 Frame = +1

Query  88   LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  267
            + + WR L WVW  PK+LE+CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRALNWVWLAPKRLERCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDI  79

Query  268  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  447
             P V P+     ++YGKN + W+GP   V I DPE ++E+  K+  FQK R NPL   LV
Sbjct  80   GPYVAPFLHQTVNQYGKNSFTWIGPRQRVNIMDPEKIREIFTKFNDFQKVRTNPLLTLLV  139

Query  448  RGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCE  627
             GLV+ E ++W+KHR+++NP+F+ +K K M PAF  SC +MLSK E +V  +G S    E
Sbjct  140  SGLVNLEGDRWSKHRKIINPSFHQDKLKNMLPAFYQSCCDMLSKWEKMVCTEGYS----E  195

Query  628  VDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +DVWP+L  LT DVISR+AFGSS+EEG+RIF+LL +Q +  ++  + VYIPG R
Sbjct  196  LDVWPYLVDLTRDVISRSAFGSSFEEGRRIFQLLDDQLVLRIKLLQTVYIPGWR  249



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 171/250 (68%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            M+++  L    V   L+ + W+++ WVW +P+KLEKC ++ G+ G+PYR L GD KE+ +
Sbjct  1    MKIVAILFSAIVINALVIWGWKMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAE  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            +  +A+ KP+ L+D++ PR+ P+Y H  +KYG +CY W+GP P +F+ +PEL+KE++   
Sbjct  61   LTKEAMLKPIKLTDDILPRIFPFYHHTLNKYGNHCYAWIGPEPRIFVMEPELIKEIVTNN  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +F+KP+  PL + LV G+ SYE E+WAKHR+++N AFY+EK K M PA   SC +M++K
Sbjct  121  TIFKKPKPAPLVQLLVSGISSYEDEKWAKHRKIINTAFYAEKLKCMLPAMHTSCEDMINK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E ++    S + S E+DV P+ + LT DVISRTAFGSSY EG RIF L KE A    + 
Sbjct  181  WEILL----SENKSYELDVHPYFEDLTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQA  236

Query  760  TRQVYIPGLR  789
             + VYIPG R
Sbjct  237  FQSVYIPGWR  246



>emb|CDX98486.1| BnaC05g38890D [Brassica napus]
Length=512

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 168/244 (69%), Gaps = 6/244 (2%)
 Frame = +1

Query  67   VCVSVGLLA---FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            V VSV ++A   + WR L WVWFKPK LE  L++ GL G+PY  L GD++    M+ +A 
Sbjct  8    VTVSVAIVAVLWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDVRRDNNMSMEAR  67

Query  238  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            SKP+ ++D++ PRV+P+ +H+   +GK  + W GP+P + I DPE +KEV NK    QKP
Sbjct  68   SKPIKITDDIVPRVVPFPSHMLKTHGKTFFTWRGPIPTITITDPEQIKEVFNKIYDCQKP  127

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
             + PL R +  GL SY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ K + +V 
Sbjct  128  HSFPLSRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGKWDKLVS  187

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
             KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  L +  R+++I
Sbjct  188  EKGS---SCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLLTQAFRRIFI  244

Query  778  PGLR  789
            PG R
Sbjct  245  PGYR  248



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 171/247 (69%), Gaps = 6/247 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME   +++ + V+VGL+ +AWR+L W+W +PKKLEK L++ GL+GNPYRIL GD+K+L+K
Sbjct  1    MEWYSSIIPIIVTVGLI-WAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLK  59

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SK M L+D++ PRVIPY  H    +GKN ++W G  P V + +PE + +VLN  
Sbjct  60   MEKEARSKSMNLTDDIMPRVIPYIQHNVKIHGKNSFMWFGTKPRVILTEPEQIIDVLNNI  119

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              F K  N+ + + LV GL S E E+W+KHRRL+NPAF+SEK K+M P F  SC++++ K
Sbjct  120  SDFPK-NNHKIFKLLVSGLASLEGEKWSKHRRLINPAFHSEKLKVMTPTFFTSCNDLIRK  178

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E ++   G    SCE+D+WP LQ L  DVISRT FGSSYEEG+RIF+L  EQA  + + 
Sbjct  179  WEEMLSPDG----SCEIDIWPSLQNLASDVISRTTFGSSYEEGRRIFQLQIEQAELMTKV  234

Query  760  TRQVYIP  780
                YIP
Sbjct  235  QMNFYIP  241



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/255 (52%), Positives = 173/255 (68%), Gaps = 6/255 (2%)
 Frame = +1

Query  31   RI*MEVIYT-LLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            R+ M V  T +L   V V +L +AWRVL WVWF+PKK+E+CL+Q G  G PYR+L GD K
Sbjct  22   RVKMTVTVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWK  81

Query  208  ELVKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  387
            E   M  +A +KP+ LSD + PRV+P+   L   YGKN ++W+GP P V I +P+ +++V
Sbjct  82   ENSDMLKEARTKPLGLSDALLPRVVPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDV  141

Query  388  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSE  567
              K   +QKP ++PL + L  GL S+E E+WAKHR+++NPAF+ EK KLM PAF  SCS 
Sbjct  142  FMKINEYQKP-SHPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFCESCSG  200

Query  568  MLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMH  747
            M++K E +V        SCE+DVWP LQGL CD ISRT+FGS+YEEGKRIF+LLKE    
Sbjct  201  MINKWEKLV---SVDEGSCELDVWPDLQGLACDAISRTSFGSNYEEGKRIFDLLKELTDL  257

Query  748  LVET-TRQVYIPGLR  789
             V    + V IPG R
Sbjct  258  TVNVIIKAVVIPGYR  272



>gb|KJB26994.1| hypothetical protein B456_004G270700 [Gossypium raimondii]
Length=521

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 164/249 (66%), Gaps = 5/249 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKM  222
            VI   L   ++VG+L    W++L W W  PKKLEKCL+Q G  GN YR+L G++KE+  M
Sbjct  6    VIIKPLLSLLAVGVLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTM  65

Query  223  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  402
               A SKPM+L+D++AP VIP+Y      YGKN   W GP P V I DPEL++E+ NK+ 
Sbjct  66   TRQARSKPMSLTDDIAPYVIPHYIRTVKNYGKNSIRWFGPSPRVTIMDPELIREIFNKFN  125

Query  403  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*  582
             FQKPR NPL   L  G+++ E ++WAKHR+++ P+F+ +K K M PAF   C+EM+ K 
Sbjct  126  EFQKPRINPLITLLFSGILTLEGDRWAKHRKIITPSFHLDKLKNMLPAFYECCTEMIEKW  185

Query  583  EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETT  762
            E  V   GSS    EVDVWP L  LT DVISR AFGSSYEEG+RIF LL EQ   L E  
Sbjct  186  EEAVSVNGSS----EVDVWPCLVNLTRDVISRAAFGSSYEEGRRIFLLLDEQTNLLTEAV  241

Query  763  RQVYIPGLR  789
            + +Y+PG R
Sbjct  242  QSLYVPGWR  250



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 162/232 (70%), Gaps = 4/232 (2%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            +AW++L W+WF PK+LEK L++ G +GNPY++L GD KE +KM  +A+SKPM LSD++ P
Sbjct  19   WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            RV  Y  H    +GKN ++W+GP P V I DPE +K++ NK   F KP  NPL + L  G
Sbjct  79   RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLFKLLATG  138

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            L  YE E+W+KHRRL+NPAF  EK K M P F  SC+++++K E ++    SS  SCE+D
Sbjct  139  LAGYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERML----SSDGSCEID  194

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             WP LQ +T DVI+R+AFGSS+EEG+RIF+L +EQ    ++   +V IPG R
Sbjct  195  AWPFLQNMTSDVIARSAFGSSFEEGRRIFQLQREQTKLALQVILKVQIPGWR  246



>gb|AJD25171.1| cytochrome P450 CYP72A330 [Salvia miltiorrhiza]
Length=517

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 167/233 (72%), Gaps = 5/233 (2%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            + W++L W +  PK+L + L++ G KGN Y+++ GD+KEL +++ +A SKP+ L D++  
Sbjct  19   YTWKLLNWAYITPKRLGEALRKQGFKGNAYKLVYGDLKELTQLSMEARSKPINLDDDIKN  78

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN-NPLGRKLVR  450
            RV P+  +   K+G   +VW+GP P + + DPELVKEVL+K  L+ +P N NP+ + L++
Sbjct  79   RVAPFIVNAIHKHGNESFVWLGPRPSIILTDPELVKEVLSKSYLYLRPENRNPMTKLLLQ  138

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL SYEK++WAKHR+++NPAF+ EK KLM PAF +SC E+L   E  V    SS  S EV
Sbjct  139  GLASYEKDEWAKHRKIINPAFHLEKLKLMIPAFYMSCDEVLKTWEKNV----SSEGSYEV  194

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DVWP+LQ LT D ISRTAFGSSY+EG+RIFEL +EQ  H+++  R +Y+PG R
Sbjct  195  DVWPYLQNLTSDAISRTAFGSSYQEGRRIFELQREQVEHIIQALRSIYVPGWR  247



>ref|XP_006442317.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
 gb|ESR55557.1| hypothetical protein CICLE_v10023602mg [Citrus clementina]
Length=512

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 170/236 (72%), Gaps = 4/236 (2%)
 Frame = +1

Query  85   LLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSD  261
            +LA+ AW++L W W KPKKLE  L+Q G  GN Y+I  GD K++  M  +A ++P++LSD
Sbjct  13   ILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDTKDMSMMLKEAKARPISLSD  72

Query  262  NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRK  441
            ++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N LG+ 
Sbjct  73   DIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGNSLGKL  132

Query  442  LVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCS  621
            +V G+V+YE EQW+K R++ NPAF+ +K K M P   LSC++++ K   I     S   S
Sbjct  133  VVNGMVTYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCNDIIRKLFEIA---ASDEES  189

Query  622  CEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             E+D+WPH+Q L  DVISRTAFGS+Y++G++IFEL++EQ+   +E ++  YIPG R
Sbjct  190  FELDIWPHIQALAADVISRTAFGSNYDDGRKIFELIREQSHLFIEVSQFDYIPGWR  245



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 168/250 (67%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+    + + V++ ++++  WR L WVWFKPK LE  L++ GL G PY  L GD+K   
Sbjct  1    MEISVASVTISVAIAVVSWWIWRTLQWVWFKPKMLESYLRRQGLVGTPYTPLVGDLKRNF  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M ++A SKP+ L+D++ PR++PY   +   YG+  Y W+GP+P + I DPE +KEV NK
Sbjct  61   SMLAEARSKPINLTDDITPRIVPYPLQMFKTYGRTFYTWLGPIPTITIMDPEQIKEVFNK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
               FQK    PL R +  GLVSY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ 
Sbjct  121  VYDFQKSHTFPLARLIAAGLVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHRSCSEVVG  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + + +V  KG    SCEVD+WP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +++
Sbjct  181  QWDKLVSDKG---LSCEVDIWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQ  237

Query  757  TTRQVYIPGL  786
              R+ +IPG 
Sbjct  238  AFRKAFIPGF  247



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 174/255 (68%), Gaps = 10/255 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVS----VGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMK  207
            ME+ Y  L + +     + +L +AWR+L +VWFKPKKLEK L+Q G KGN Y++L GDMK
Sbjct  1    MEISYYNLKIAIFSFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMK  60

Query  208  ELVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKE  384
            E+ KM  +A SKP+  S D + PR+ P+       YGKNC+VW GP P V I +P+L+KE
Sbjct  61   EMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWFGPKPAVLITEPKLIKE  120

Query  385  VLNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCS  564
            VL K  ++QK R +PL +  + GL ++EK++WA HRR+LNPAF+ +K K M PAF L+ +
Sbjct  121  VLTKNYVYQKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFHIDKLKHMLPAFKLTVN  180

Query  565  EMLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            EML+  + ++   G+     E+DVWP+LQ LT D ISRTAFGS+YEEGK+ FEL KEQ  
Sbjct  181  EMLNIWKEVISKDGT-----EIDVWPYLQTLTSDAISRTAFGSNYEEGKKNFELQKEQIE  235

Query  745  HLVETTRQVYIPGLR  789
             + + T  +YIPG R
Sbjct  236  LISKMTHSIYIPGWR  250



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 168/251 (67%), Gaps = 4/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+    + V V++ ++++  WR L WVWFKPK LE  L++ GL G PY  L+GD K   
Sbjct  1    MEISAASVTVSVAIAVVSWWVWRTLNWVWFKPKTLESYLRRQGLVGTPYTPLAGDSKRTF  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M+ +A SKP+ L+D++ PRV+P+  H+   YG+  + W G +P++ I DPE +KEV NK
Sbjct  61   NMSMEARSKPINLTDDIIPRVLPFSLHMLKTYGRTFFTWRGHIPVITIMDPEQIKEVFNK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
               FQKP   PLGR +  GL SY+ ++WA HRR++NPAF+ EK K M PAF  +CSE++ 
Sbjct  121  IYDFQKPHTFPLGRLIATGLFSYDGDKWANHRRIINPAFHLEKIKNMVPAFHQTCSEVIG  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + + +V  KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +  
Sbjct  181  EWDKLVSDKGS---SCEVDVWPWLMSMTADVISRTAFGSSYKEGQRIFELQAELAQLITL  237

Query  757  TTRQVYIPGLR  789
            + +  +IPG R
Sbjct  238  SVQTAFIPGYR  248



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 176/252 (70%), Gaps = 7/252 (3%)
 Frame = +1

Query  40   MEVIYTLLG-VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME++  ++  +CV++ LL   W+VL W WF+PKKLEK   Q GLKG PY++L GD+ EL 
Sbjct  1    MEMLSKIIATICVAI-LLICTWKVLNWAWFRPKKLEKYFIQNGLKGKPYKLLYGDLNELT  59

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
            K   +A SKP+  SD++A R+IP++    +K GK+ ++W+GP P++ I DPE VKE+  K
Sbjct  60   KSIVEAKSKPINFSDDIAQRLIPFFLDSINKNGKSSFMWLGPYPVILITDPEHVKEIFTK  119

Query  397  -YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
             Y   ++   NP+ + L +GL + E ++WAKHR+++NP F+ EK K M PAF +SCSEML
Sbjct  120  NYVYLKQTHPNPMTKLLAQGLANIEGDKWAKHRKIINPVFHVEKLKHMLPAFYMSCSEML  179

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
            SK E IV     +  S E+DVWP LQ +T +VISRTAFGSSYEEG+ +FEL KEQA +++
Sbjct  180  SKWEEIV----PTGTSFELDVWPDLQIMTSEVISRTAFGSSYEEGRTVFELQKEQAEYVI  235

Query  754  ETTRQVYIPGLR  789
            E  + +YIPG R
Sbjct  236  EKGQSIYIPGSR  247



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 170/253 (67%), Gaps = 8/253 (3%)
 Frame = +1

Query  40   MEVIYTLL--GVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKEL  213
            ME+ Y  +   +CV V LL + WRVL W WF+PKKLEK L++ GLKGNPY++  GD+ E+
Sbjct  1    MEIPYNRIIEAICV-VTLLVYTWRVLNWAWFRPKKLEKYLRKSGLKGNPYKLFYGDLNEI  59

Query  214  VKMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLN  393
                ++A SKP+  SD++A R+IP++    +K GK  +VW+GP P V I DPE VKE+  
Sbjct  60   TNKVNEARSKPINFSDDIAQRLIPFFLDSINKNGKRSFVWLGPNPAVLITDPEHVKEIFT  119

Query  394  KYELFQK-PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEM  570
            K   +QK P  NP      +GL   E+++W KHR+++NPAF+ EK K M PAF  SCSEM
Sbjct  120  KNYAYQKIPHPNPFANSFAKGLAFLEEDKWTKHRKIINPAFHFEKFKHMLPAFYQSCSEM  179

Query  571  LSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHL  750
            +SK + I         S E+DVWP +Q +T +VISRT+FGS YEEG+++FEL +EQA ++
Sbjct  180  ISKWKEI----NPKGTSVELDVWPDIQLMTGEVISRTSFGSCYEEGRKVFELQREQAEYV  235

Query  751  VETTRQVYIPGLR  789
            ++ T  VYIPG R
Sbjct  236  MDMTHSVYIPGSR  248



>ref|XP_004307203.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 166/245 (68%), Gaps = 8/245 (3%)
 Frame = +1

Query  67   VCVSVGLLAFA----WRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
            + +S+ LL+ A    WRVL WVW KPKKLEKCL+Q GL GN YR+L GD+KE  ++  +A
Sbjct  32   IALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESFRVMKEA  91

Query  235  ISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQK  414
             SKPM LSD+ APRV+P+      K+GKN + W G  P V I +P+ + E+L KY+ F++
Sbjct  92   CSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTKYDDFRR  151

Query  415  PRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIV  594
            P   P+ + L  GL + E E+W K R+++NPAF+ EK K M PA   SC++M++K E +V
Sbjct  152  PHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCTDMITKWEIMV  211

Query  595  YGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVY  774
              +G    SCE+D+WP LQ L+ DVISRTAFGSSYEEG+ IFEL KEQ   L++     Y
Sbjct  212  SKEG----SCELDIWPFLQNLSGDVISRTAFGSSYEEGRTIFELQKEQTELLIKALFSAY  267

Query  775  IPGLR  789
            IPG R
Sbjct  268  IPGFR  272



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 157/231 (68%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             WR L W+W  PKKLEKCL++ G  GN YR+ SGD+K+LV M+ +A SKPM  S ++APR
Sbjct  24   GWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPR  83

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            VIP   H  +KYGKN +VW+GP+P VFI DPE +K  L+ Y  FQKP  NPL + L  GL
Sbjct  84   VIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGL  143

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
            +++E E+W KHR+++N AF+ EK K M P    SC+EM++  E +V   G    SCE+DV
Sbjct  144  INHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDG----SCELDV  199

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             P+LQ L  DVISRTAFGS+YEEGK IF   KE     ++ +  VYIPG R
Sbjct  200  MPYLQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRR  250



>ref|XP_008366858.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=516

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 174/251 (69%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVC-VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            MEV  + +GV  V + + A+AWRV+ W+W +PKKLE+ L+Q GL GN YR L GD+KE  
Sbjct  1    MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M   A SKPM LS ++APRV+P+  H  + YGKN ++W GP+P V I +PE +K++L K
Sbjct  61   MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
             E F K ++NP  + LV G   YE E+W +HRR++NPAF+ +K K M PAF LS SEM+ 
Sbjct  121  IEDFPKLKSNPYVKLLVTGTAHYEGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSSEMIK  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + E +V  +G    SCE+DV P L+ LT D+ISR+AFGSSY+EG++IF+LL+EQ   + +
Sbjct  181  EWESLVLKEG----SCELDVRPCLENLTADMISRSAFGSSYKEGRKIFQLLREQLQLVTK  236

Query  757  TTRQVYIPGLR  789
              + VYIPG R
Sbjct  237  VIQNVYIPGWR  247



>ref|XP_009116688.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 165/242 (68%), Gaps = 6/242 (2%)
 Frame = +1

Query  67   VCVSVGLLA---FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            V VSV + A   + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A 
Sbjct  8    VTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEAR  67

Query  238  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            SKP+ L+D++ P V+P+ +H+   YG+  + W GP+P + I +PE +KEVLNK   FQKP
Sbjct  68   SKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITITNPEQIKEVLNKIYDFQKP  127

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
                L R +  GL SY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ K + IV 
Sbjct  128  NTFALSRLVASGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGKWDNIVL  187

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
             KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E +  +++  R+ +I
Sbjct  188  DKGS---SCEVDVWPWLMSMTADVISRTAFGSSYKEGQRIFELQTELSELIIQAFRKAFI  244

Query  778  PG  783
            PG
Sbjct  245  PG  246



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 167/254 (66%), Gaps = 9/254 (4%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGL---LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKE  210
            ME+ Y       S  +   L +AWR+L +VW KPK LEK L+Q G KGN Y+ L GDMKE
Sbjct  1    MEIPYNFKLAIFSFAIIFVLRWAWRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKE  60

Query  211  LVKMASDAISKPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEV  387
            + KM  +A+SKP+  S D + PRV P+   +   YGKN +VW GP P V I DPE++KEV
Sbjct  61   MSKMGEEALSKPVNFSHDMIWPRVNPFIHKIITNYGKNSFVWFGPKPAVVIMDPEVIKEV  120

Query  388  LNKYELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSE  567
            + K  +FQKP  NPL + L  G+  YE ++WA HRRLLNPAF+ +K K M PAF L+ SE
Sbjct  121  MMKNYVFQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTASE  180

Query  568  MLSK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMH  747
            ML K E IV   GS     E+DV  +LQ LT D ISRTAFGSSYEEG +IFEL KEQ   
Sbjct  181  MLGKWEKIVSRDGS-----EIDVLSYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQL  235

Query  748  LVETTRQVYIPGLR  789
            +++ +R VYIPG R
Sbjct  236  ILQVSRTVYIPGWR  249



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 162/250 (65%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            M+   +++     V LL   WR L W+W  PKKLEKCL++ G  GNPYR+ SGD+ ++V 
Sbjct  1    MDFRNSMIWFVFMVCLLRCGWRFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVA  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SKPM  S ++ PRVIP   H   KYGKN ++W+GP P V I DPE +K  L+ Y
Sbjct  61   MEEEAKSKPMNFSHDIVPRVIPSMHHTIKKYGKNSFMWLGPNPRVLIMDPEQLKAALSLY  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              FQKP  NPL R L  GL+++E E+W KHR+++N AF+ EK K M P    SC+EM+SK
Sbjct  121  NDFQKPTTNPLVRLLFDGLINHEGEKWVKHRKIINHAFHFEKLKDMVPTMFESCNEMISK  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +    G    SCE+DV P+LQ LT DVISRTAFGS+YEEGK IF   KE    +++ 
Sbjct  181  WEKMTSKDG----SCELDVVPYLQSLTADVISRTAFGSTYEEGKIIFNHFKELIRLVLQA  236

Query  760  TRQVYIPGLR  789
            +  VY+PG R
Sbjct  237  SNTVYLPGWR  246



>emb|CDY20078.1| BnaA01g29240D [Brassica napus]
Length=512

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 164/242 (68%), Gaps = 6/242 (2%)
 Frame = +1

Query  67   VCVSVGLLA---FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            V VSV + A   + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A 
Sbjct  8    VTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEAR  67

Query  238  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            SKP+ L+D++ P V+P+ +H+   YG+  + W GP+P + I  PE +KEVLNK   FQKP
Sbjct  68   SKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITITSPEQIKEVLNKIYDFQKP  127

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
                L R +  GL SY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ K + IV 
Sbjct  128  NTFALSRPVASGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGKWDNIVL  187

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
             KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E +  +++  R+ +I
Sbjct  188  DKGS---SCEVDVWPWLMSMTADVISRTAFGSSYKEGQRIFELQTELSELIIQAFRKAFI  244

Query  778  PG  783
            PG
Sbjct  245  PG  246



>ref|XP_006442316.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
 gb|ESR55556.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
Length=512

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 170/241 (71%), Gaps = 4/241 (2%)
 Frame = +1

Query  70   CVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
             ++  +LA+ AW++L W W KPKKLE  L+Q G  GN Y+I  GDMK++  M  +  ++P
Sbjct  8    ALATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKETKARP  67

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++LSD++ PR++PY+ H+  KYGK  + WMGP P + ++DP+L++E+L K+++FQKP+ N
Sbjct  68   ISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQKPKGN  127

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
             L + +V G+V YE EQW+K R++ NPAF+ +K K M P   LSC+ M+ K   I     
Sbjct  128  SLSKLVVNGMVMYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCNHMIRKLFEIA---A  184

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            S   S E+D+WPH+Q L  DVISRTAFGS+Y++G++IFEL++EQ+  L+E ++  YIPG 
Sbjct  185  SDEESFELDIWPHIQALAADVISRTAFGSNYDDGRKIFELIREQSHLLIEVSQFDYIPGW  244

Query  787  R  789
            R
Sbjct  245  R  245



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 161/233 (69%), Gaps = 6/233 (3%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W+++ W+WF+PKKLEK L+Q G  GN YRIL GD+KE   M   AISKPM  S+++APR
Sbjct  27   GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPMNFSNHIAPR  86

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN--NPLGRKLVR  450
            VIP   H    YGKN ++W+GP+P V I DPE +K V +    +QKP    NPL + L  
Sbjct  87   VIPSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  146

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL+++E  +W KHR+++NPAF+ EK K M PAF  SC EM+SK E +V  +G    SCE+
Sbjct  147  GLLNHEGHKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVQG----SCEL  202

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DV P+LQ +T DVISRTAFGSSYE+GK+IF+L  E A  ++ +T  +YIPG R
Sbjct  203  DVMPYLQNMTADVISRTAFGSSYEKGKKIFKLQTELAEMVIRSTLGIYIPGWR  255



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 157/231 (68%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             WR L W+W  PKKLEKCL++ G  GN YR+ SGD+K+LV M+ +A SKPM  S ++APR
Sbjct  90   GWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPR  149

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            VIP   H  +KYGKN +VW+GP+P VFI DPE +K  L+ Y  FQKP  NPL + L  GL
Sbjct  150  VIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGL  209

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
            +++E E+W KHR+++N AF+ EK K M P    SC+EM++  E +V   G    SCE+DV
Sbjct  210  INHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDG----SCELDV  265

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
             P+LQ L  DVISRTAFGS+YEEGK IF   KE     ++ +  VYIPG R
Sbjct  266  MPYLQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRR  316



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 166/241 (69%), Gaps = 4/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
              V V +L +AWRVL WVW +PKKLEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++L D++A RV P+   L + YGKN ++W GP P V I +P+ +K +  K   FQK  + 
Sbjct  71   LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSI  130

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL R L+ GL + E E+WAKHR+L+NPAF+ EK KLM PAF LSC E+++K E  +  +G
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEG  190

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            SS    E+DVWP+L  LT DVISRTAFGSSYEEG+RIF+L  E A   ++  R V+IPG 
Sbjct  191  SS----ELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGW  246

Query  787  R  789
            R
Sbjct  247  R  247



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 164/241 (68%), Gaps = 4/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
              V V L+ +AW VL W+W +PKKLEK L+Q GLKGN YR+L GD+KE   M   A ++P
Sbjct  11   TIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESSIMLKKAKARP  70

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++L D+ A RV P+   L   YGKN ++W GP P V I +P+ +KE+  K   F K  +N
Sbjct  71   LSLDDDAAVRVNPFLPKLFKDYGKNSFMWFGPTPRVNITNPDQIKEIFTKINDFPKINSN  130

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL R L  GLV+YE EQWAKHR+++NPAF  EK KLM PAF  S S+++++ E ++  +G
Sbjct  131  PLARILGVGLVNYEGEQWAKHRKIINPAFRQEKLKLMLPAFCQSSSDIITEWEKLMSTEG  190

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
                SCE+DVWP+L  LT DVISRTAFGS+YEEG+RIF+L  E A   ++  R VYIPG 
Sbjct  191  ----SCELDVWPYLANLTGDVISRTAFGSNYEEGRRIFQLQSELAELTIQVIRSVYIPGW  246

Query  787  R  789
            R
Sbjct  247  R  247



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 172/247 (70%), Gaps = 6/247 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            ME +  ++ + V++GL+ +AW+VL  +W +PKKLEK L++ G +GN YRIL GD+K+L K
Sbjct  1    MEWVSGIILIIVTLGLI-WAWKVLSLLWLRPKKLEKLLREQGFQGNSYRILLGDIKDLFK  59

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M  +A SK M LSD++ PRVIPY  H    +GKN Y+W G  P V + +PE +K+VLNK 
Sbjct  60   MEKEAKSKSMNLSDDITPRVIPYIQHSVKIHGKNSYIWFGIKPRVTLTEPEQIKDVLNKM  119

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              F KP N  + + L   L +YE E+W+KHR+L+NPAF+ EK K+M PAF  SC+++++K
Sbjct  120  SEFPKP-NYKIFKLLANALANYEGEKWSKHRKLINPAFHLEKLKIMTPAFFTSCNDLINK  178

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E ++    SS  SCE+D+WP LQ L  D ISRTAFGSSYEEGKRIF+L +EQA  +V+ 
Sbjct  179  WEKML----SSDGSCEIDIWPSLQNLASDAISRTAFGSSYEEGKRIFQLQREQAELIVKV  234

Query  760  TRQVYIP  780
              +  IP
Sbjct  235  VTKSIIP  241



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 163/235 (69%), Gaps = 5/235 (2%)
 Frame = +1

Query  88   LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT-LSDN  264
            L  A+ VL WVWFKPKK+EK L++ GLKGNPYR+L GD+KE+ K    A S+P+   S  
Sbjct  20   LYVAYEVLNWVWFKPKKIEKQLQEQGLKGNPYRLLYGDLKEMQKTLKKACSQPVKGFSHA  79

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  444
              PRVIP Y  +  KYGKN Y W GP   V + DPE +KEV  KY++F KP +NPL + L
Sbjct  80   FEPRVIPLYQDVVHKYGKNGYAWFGPEASVIVMDPESIKEVTLKYDVFNKPHSNPLSKLL  139

Query  445  VRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSC  624
            +RG+VSYE ++W KHR+++NPAF+ +K K M P+F  S  E +S  + +V  KGS+    
Sbjct  140  LRGVVSYEGDKWVKHRKIINPAFHQDKLKHMLPSFHTSAMETVSIWDAMVAEKGST----  195

Query  625  EVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            EVDV P+LQ LT D ISRTAFGS+YEEGKRIFEL +EQA  +V   R +YIPG R
Sbjct  196  EVDVLPYLQTLTSDAISRTAFGSNYEEGKRIFELQREQAELVVIALRSLYIPGWR  250



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 173/250 (69%), Gaps = 5/250 (2%)
 Frame = +1

Query  43   EVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKM  222
            +V+++L      +  LA+A RVL W W++P++LE+ L+  GL G PYR   GD+KE++++
Sbjct  8    DVLWSLGRGVAGLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRL  67

Query  223  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKY  399
              +A +KPM L+ N+ PR++P++    D+YGK  + W GP+P V I DPELV+EVL NK+
Sbjct  68   RKEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKF  127

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +F KP  NPL R   +GL  YE E+W KHRR++NPAF++EK K M PAF   CS+++ +
Sbjct  128  GIFGKPTQNPLSRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDR  187

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +    GS +C  E+DVWP LQ  + DVISRTAFGSSYEEG++IF+L  EQA  +++ 
Sbjct  188  WENMA---GSEAC-YELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQV  243

Query  760  TRQVYIPGLR  789
             + +Y+PG R
Sbjct  244  VQNLYVPGYR  253



>gb|AJD25167.1| cytochrome P450 CYP72A326 [Salvia miltiorrhiza]
Length=518

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/252 (47%), Positives = 179/252 (71%), Gaps = 6/252 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLL-AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            M+ +Y+++  C ++ ++  +AWR+L W + +PK+LEK L++ GL GN Y  +SGDMKE+V
Sbjct  1    MQRVYSIVAACFAIAVVVTYAWRLLNWAYLRPKRLEKILRKQGLNGNSYIPVSGDMKEMV  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
            K   +A SKP+ L D++ PR+ P+  +   K+G  C++W GP P+V I + EL+K+VLNK
Sbjct  61   KAMQEANSKPINLDDDIKPRLQPFLLNTIRKHGNECFMWKGPTPVVVITETELIKQVLNK  120

Query  397  YELFQKPRN-NPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEML  573
            + +F+KPR  NPL R   +G+ S+EK++W+KHR+++NPAF+ +K KLM PAF LSC E+L
Sbjct  121  HSVFEKPRVLNPLVRMFSQGIFSHEKDKWSKHRKIINPAFHLDKLKLMVPAFHLSCDEVL  180

Query  574  SK*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLV  753
             + E  V  +G     CE DV P+L+ +T D ISRTAFGSSY++G+R+FEL  EQ+  ++
Sbjct  181  KEWEKRVSREG----WCEFDVCPYLESITSDAISRTAFGSSYKQGRRVFELQLEQSALIM  236

Query  754  ETTRQVYIPGLR  789
            +  + VYIPG R
Sbjct  237  KAMQSVYIPGSR  248



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 168/243 (69%), Gaps = 5/243 (2%)
 Frame = +1

Query  67   VCVSVGLLA--FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  240
            +C S  L+   + WR++ WVW +P+K+EKC ++ GL G+PYR L GD KE+ K+   A  
Sbjct  5    ICFSALLVTMIWMWRMVNWVWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQAKL  64

Query  241  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            KPM L+D++  RV+P+Y +  +KYG NC++W+GP P +FI +PEL+++++    +F+KP+
Sbjct  65   KPMKLTDDILTRVLPFYHYTLNKYGNNCFIWIGPEPRIFIMEPELIRDIVMNNNIFKKPK  124

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
              PL + LV G+ SYE ++WAKHR++LN AFY+EK K M PA   SC +M++K E ++  
Sbjct  125  PTPLVQLLVSGISSYEDQKWAKHRKILNTAFYTEKLKYMVPAMHKSCEDMMNKWEILICN  184

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
            K     SCE+DV P+ + LT DVISRTAFGSSY+EG +IF L KE A    +  + VYIP
Sbjct  185  KNK---SCELDVHPYFEDLTSDVISRTAFGSSYQEGMKIFHLQKELAELTRQAFQSVYIP  241

Query  781  GLR  789
            G R
Sbjct  242  GWR  244



>ref|XP_008367417.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=238

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 154/218 (71%), Gaps = 4/218 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
             +AW+V+ W+W +PKKLE+ L+Q G+ GN Y  +SGDMKE+      A SKPM+LS ++A
Sbjct  18   TWAWKVVNWLWLRPKKLERYLRQQGIAGNSYXFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRVIP++  L + YGKN +VWMG +P V I +PE +K +L K   F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYGKNSFVWMGTIPRVIITNPEDLKYILTKMGEFPQPEPNPLVKLLAT  137

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            G+  YE E+WAKHRR++NP F+ EK K M PAF  SCSEM+ + E +   +     SCE+
Sbjct  138  GIALYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLELKES----SCEL  193

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAM  744
            DVWP+ Q LT DVISRTAFGSSY+EG++IF+LLKEQ +
Sbjct  194  DVWPYFQNLTADVISRTAFGSSYKEGRKIFQLLKEQGL  231



>ref|XP_009594691.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=419

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 165/239 (69%), Gaps = 5/239 (2%)
 Frame = +1

Query  61   LGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  240
            +   + + LL + WR + W+W +PK LEKCLK+LG +GN Y++L GDMKE+V M  +A S
Sbjct  9    ISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKS  68

Query  241  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            KP+  S ++ PR++P+       YGKN ++W+ P P + I DPEL++E+L+K  +FQKP 
Sbjct  69   KPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPP  128

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
                 + LV G++SYE ++WAKHRR++NPAF+ +K K M P+F LS  EMLS+ E +   
Sbjct  129  PTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLSTCEMLSEWEKVASA  188

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
            +GS     EVDVWP+LQ LT D ISRTAFGSSYEEG++IFEL +E A  +++ T   YI
Sbjct  189  EGS-----EVDVWPYLQSLTSDAISRTAFGSSYEEGRKIFELQQELAKIILKVTESSYI  242



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 168/249 (67%), Gaps = 4/249 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+    + + V + ++++  WR L WVWFKPK LE  L++ GL G PY  L GD+K+  
Sbjct  1    MEISVASVTISVVLAVVSWWIWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNF  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M S+A SKP+ L+D+++PRV+PY   +   YG+  + W GP+P + I DPE +KEV NK
Sbjct  61   TMLSEARSKPLKLTDDISPRVVPYPLQMFKTYGRTYFTWFGPIPTITIMDPEQIKEVFNK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
               FQKP   PL   + +GL +Y+ ++WAKHRR++NPAF+ EK K M PAF  SC E++ 
Sbjct  121  VYDFQKPHTFPLATIIAKGLANYDGDKWAKHRRIINPAFHIEKIKNMVPAFHQSCREVVG  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + + +V  KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +++
Sbjct  181  EWDQLVSDKGS---SCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQ  237

Query  757  TTRQVYIPG  783
              R+ +IPG
Sbjct  238  AFRKAFIPG  246



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 173/250 (69%), Gaps = 5/250 (2%)
 Frame = +1

Query  43   EVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKM  222
            +V+++L      +  LA+A RVL W W++P++LE+ L+  GL G PYR   GD+KE++++
Sbjct  8    DVLWSLGRGVAGLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRL  67

Query  223  ASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKY  399
              +A +KPM L+ N+ PR++P++    D+YGK  + W GP+P V I DPELV+EVL NK+
Sbjct  68   RKEARAKPMPLAHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKF  127

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +F KP  NPL R   +GL  YE E+W KHRR++NPAF++EK K M PAF   CS+++ +
Sbjct  128  GIFGKPTQNPLSRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDR  187

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E +    GS +C  E+DVWP LQ  + DVISRTAFGSSYEEG++IF+L  EQA  +++ 
Sbjct  188  WENMA---GSEAC-YELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQV  243

Query  760  TRQVYIPGLR  789
             + +Y+PG R
Sbjct  244  VQNLYVPGYR  253



>ref|XP_009343590.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 173/251 (69%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVC-VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            MEV  + +GV  V + + A+AWRV+ W+W +PKKLE+ L+Q GL GN YR L GD+KE  
Sbjct  1    MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M   A SKPM LS ++APRV+P+  H  + YGKN ++W GP+P V I +PE +K++L K
Sbjct  61   MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
             E F K ++NP  + LV G   Y+ E+W +HRR++NPAF+ +K K M PAF LS +EM+ 
Sbjct  121  IEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMIK  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + E +V   G    SCE+DV P L+ LT D+ISR+AFGSSY+EG++IF+LL+EQ   + +
Sbjct  181  EWESLVLKAG----SCELDVQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSK  236

Query  757  TTRQVYIPGLR  789
              + VYIPG R
Sbjct  237  VIQNVYIPGWR  247



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 161/232 (69%), Gaps = 5/232 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W+++ W+WF+PKKLEK L++ G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  24   GWKLVDWIWFRPKKLEKILRRQGFAGNSYRILHGDLKESAAMREEAMSKPMNFSNHIAPR  83

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            VIP   H    YGK   +W+GPMP V I DPE +K V +    FQKP  NPL R LV+GL
Sbjct  84   VIPSVYHTIQLYGKKSMMWLGPMPRVHIMDPEQLKIVFSSINDFQKPTMNPLTRLLVQGL  143

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSC-SEMLSK*EGIVYGKGSSSCSCEVD  633
             S E ++W KHR+++NPAF+ EK K M PAF  SC +EM+SK EG+V  +G    SCE+D
Sbjct  144  ASLEGQKWVKHRKIINPAFHVEKLKDMVPAFYHSCYNEMVSKWEGMVSREG----SCELD  199

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            V P+LQ +  DVISRTAFGSSYE+GK+IFEL  E A  +++    +YIPG R
Sbjct  200  VMPYLQNMASDVISRTAFGSSYEKGKKIFELQTELANLVIQANLGIYIPGWR  251



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 175/251 (70%), Gaps = 9/251 (4%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            ++ ++L   V V +L +AWRVL WVWF+PKK+E+CL+Q G  G PYR+L GD KE   M 
Sbjct  33   IVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLLGDWKESSDML  92

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A +KP+ LS+ + PRV+P+   L   YGKN ++W+GP P V I +P+ +++V  K   
Sbjct  93   KEARTKPLGLSEALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDVFMKINE  152

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            +QK  ++PL + L  GL S+E E+WAKHR+++NPAF+ EK KLM PAF  SCS M++K E
Sbjct  153  YQKA-SHPLLKALACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCSGMINKWE  211

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKE---QAMHLVE  756
             +V    +   SCE+DVWP L+GLTCD ISRT+FGS+YEEGKRIF+LLKE     +H++ 
Sbjct  212  KLV---SADEGSCELDVWPDLRGLTCDAISRTSFGSNYEEGKRIFDLLKEFTDLTVHVI-  267

Query  757  TTRQVYIPGLR  789
              + + IPG R
Sbjct  268  -MKAIVIPGYR  277



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 168/230 (73%), Gaps = 5/230 (2%)
 Frame = +1

Query  103  RVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPRVI  282
            ++L W + +PK+LEK L++ GL GN YR+L GD+++ +K   +A +KP+ L D++  RV+
Sbjct  23   KLLNWAYLRPKRLEKALRKQGLNGNSYRLLIGDLRDFMKATEEAKTKPINLDDDIKTRVV  82

Query  283  PYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR-NNPLGRKLVRGLV  459
            P++ +   K+GK+ + W GP P + + DP+L KE+L K +LF K R +NPL R LV+G++
Sbjct  83   PFFVNTLSKFGKDSFFWFGPHPTLIVTDPDLAKEILGKSDLFSKARSSNPLSRLLVQGVL  142

Query  460  SYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDVW  639
            S+EKE+WAKHR+++NPAF+ +K KLM PAF LSC +++S+ E  +  +G   C CEVDVW
Sbjct  143  SHEKEKWAKHRKIINPAFHLDKLKLMIPAFCLSCDQVVSEWEKSLSPEG---C-CEVDVW  198

Query  640  PHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            P+LQ +T D ISRTAFGSSY++G+RIFEL  EQA + +   R VYIPG R
Sbjct  199  PYLQKVTSDAISRTAFGSSYQQGRRIFELQSEQAGYAIHALRSVYIPGWR  248



>gb|EYU30753.1| hypothetical protein MIMGU_mgv1a004802mg [Erythranthe guttata]
Length=509

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 166/244 (68%), Gaps = 4/244 (2%)
 Frame = +1

Query  61   LGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  240
            L   V V L  +AW+VL WVWF P+ LEK L++ G  GN Y+IL GD+KE+  +     S
Sbjct  3    LCFVVVVLLFYYAWKVLNWVWFTPRNLEKRLREQGYNGNSYKILFGDLKEMAFIIKQFNS  62

Query  241  KPMTLS-DNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            KP++ S D V PRVIP+ +   +KYG    +W GP P +   DPE+V+EVL+K  +FQ+P
Sbjct  63   KPVSFSRDTVVPRVIPFISKTVEKYGPKSIMWFGPRPAILCFDPEIVREVLSKSYVFQRP  122

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
               PL + LV+G+ +YE E+WAKHRRL+ PAF+ +K K M PAF LSC++MLSK E IV 
Sbjct  123  PLTPLTKLLVQGVGAYETEKWAKHRRLVTPAFHPDKLKNMLPAFYLSCNDMLSKWEEIVI  182

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
               S   SCEVDVWP+LQ ++ DVISRTAFGSSYEEG+ +FEL +EQ       ++ VYI
Sbjct  183  ---SDDGSCEVDVWPYLQNMSSDVISRTAFGSSYEEGRIVFELQREQTELYGLASQSVYI  239

Query  778  PGLR  789
            PG R
Sbjct  240  PGWR  243



>ref|XP_010927467.1| PREDICTED: cytochrome P450 72A15-like [Elaeis guineensis]
Length=522

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 161/240 (67%), Gaps = 5/240 (2%)
 Frame = +1

Query  73   VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMT  252
            V+  LL +A   L WVW++P++LE+ L+  GLKG  YR L GD KE  ++  +A+SKPM 
Sbjct  17   VAALLLGWAVSALEWVWWRPRRLERALRAQGLKGTRYRFLHGDQKEYHRLHKEALSKPMA  76

Query  253  LSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYELFQKPRNNP  429
             S  + PR++P+      K GK  + W GP P V I DP L +E+L NK+  F+KP +NP
Sbjct  77   FSHQIIPRILPHLHQAIKKNGKISFTWFGPKPRVIIMDPGLTREILSNKFGHFEKPHSNP  136

Query  430  LGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGS  609
            LGR LV GLV YE E+WAKHRR++NPAF+ EK K M PAF   C E+++K E +V  KG 
Sbjct  137  LGRLLVAGLVRYEGEKWAKHRRIINPAFHLEKLKCMMPAFSTCCDELINKWERLVASKG-  195

Query  610  SSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
               SCE+DVWP  Q  T DVISRTAFGS++ EG+RIF L +EQA  +V+  + +YIPG R
Sbjct  196  ---SCELDVWPEFQSFTGDVISRTAFGSNFREGQRIFHLQEEQAQLVVQALQNIYIPGFR  252



>gb|KJB12904.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=518

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 162/234 (69%), Gaps = 4/234 (2%)
 Frame = +1

Query  88   LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  267
            + + WR L WVW  PK+LE+CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRALNWVWLAPKRLERCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDI  79

Query  268  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  447
             P V P+     ++YGKN + W+GP   V I DPE ++E+  K+  FQK R NPL   LV
Sbjct  80   GPYVAPFLHQTVNQYGKNSFTWIGPRQRVNIMDPEKIREIFTKFNDFQKVRTNPLLTLLV  139

Query  448  RGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCE  627
             GLV+ E ++W+KHR+++NP+F+ +K K M PAF  SC +MLSK E +V  +G S    E
Sbjct  140  SGLVNLEGDRWSKHRKIINPSFHQDKLKNMLPAFYQSCCDMLSKWEKMVCTEGYS----E  195

Query  628  VDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +DVWP+L  LT DVISR+AFGSS+EEG+RIF+LL +Q +  ++  + VYIPG R
Sbjct  196  LDVWPYLVDLTRDVISRSAFGSSFEEGRRIFQLLDDQLVLRIKLLQTVYIPGWR  249



>ref|XP_006495010.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=519

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 167/246 (68%), Gaps = 8/246 (3%)
 Frame = +1

Query  61   LGVCVSVGLLAFA---WRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASD  231
              +  S  +LA A   W +L WVW KPKKLEK L++ G  GN Y++  GDMKEL +   +
Sbjct  12   FSIAFSTAILAVACAWWMLLNWVWLKPKKLEKFLRKQGFSGNSYKVFHGDMKELAQTTKE  71

Query  232  AISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQ  411
            A S+P++LSD++A R++P++ H+   +GKN ++WMGP P + I DP++++E+  KY++FQ
Sbjct  72   AKSRPISLSDDIARRILPFHHHIITNFGKNSFIWMGPRPNIHITDPKMIREIFLKYDIFQ  131

Query  412  KPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGI  591
            KPR +PL + LV G+  Y  EQW K R++  PAF+ +K K M P    SC++ML K E  
Sbjct  132  KPR-SPLVKLLVTGMADYAGEQWFKVRKIATPAFHHDKLKNMLPTIHKSCNDMLRKWEIS  190

Query  592  VYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQV  771
            V    S   SCE+DVWPH+Q LT DVISRTAFGSS+EEG++IF +L+EQ   L++ +   
Sbjct  191  V----SKDESCELDVWPHIQTLTADVISRTAFGSSFEEGRKIFAVLREQINLLIQASFFA  246

Query  772  YIPGLR  789
            YIPG R
Sbjct  247  YIPGWR  252



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 173/251 (69%), Gaps = 9/251 (4%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
             + ++L   V V +L +AWR+L WVWF+PKK+E+CL+Q G  G PYR+L GD KE   M 
Sbjct  4    TVSSILVSIVYVAVLRWAWRLLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKESSDML  63

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A +KP+ LSD + PRV+P+   L   YGKN ++W+GP P V I +P+ +K+V  K   
Sbjct  64   KEARTKPIGLSDALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIKDVFMKINE  123

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            +QKP ++PL + +  GL S+E E+W+ HR+++NPAF+ EK KLM PAF  SCS M++K E
Sbjct  124  YQKP-SHPLLKAIACGLPSHEGEKWSNHRKIINPAFHQEKIKLMIPAFYESCSGMINKWE  182

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKE---QAMHLVE  756
             +V        SCE+DVWP LQGLTCD ISRT+FGS+YEEGKRIF+LLKE     +H++ 
Sbjct  183  KLV---SIDEGSCELDVWPDLQGLTCDAISRTSFGSNYEEGKRIFDLLKELTDLTVHVI-  238

Query  757  TTRQVYIPGLR  789
              + + IPG R
Sbjct  239  -IKAIVIPGYR  248



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 167/251 (67%), Gaps = 6/251 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAW---RVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            +I +   V +SV ++  +W   R+L WVWFKPK LE  L+  GL G  Y +L GD+K   
Sbjct  1    MIISAKSVTISVAIVVVSWWIWRILKWVWFKPKMLESYLRGQGLPGTSYTLLVGDVKRNS  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M  +A SKP+ L+D++A RV+PY   +A  +G+N + W+GP+P + + DPEL+KEV NK
Sbjct  61   NMLLEARSKPIKLTDDIASRVVPYPLQMAKTHGRNFFTWLGPIPSITLMDPELIKEVFNK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
               FQKP   PLGR +  GL SY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ 
Sbjct  121  IYNFQKPNVFPLGRLVATGLFSYDDDKWAKHRRIINPAFHIEKIKSMVPAFHQSCSEVVG  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K + +   KG    SCEVDVWP L  LT DVISRTAFGSSY+EG RIFEL  E    L++
Sbjct  181  KWDKLASDKG---LSCEVDVWPWLGSLTGDVISRTAFGSSYKEGHRIFELQSELTELLIQ  237

Query  757  TTRQVYIPGLR  789
              ++ +IPG R
Sbjct  238  AVQRFFIPGYR  248



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 166/241 (69%), Gaps = 4/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
              V V +L +AWRVL WVW +P+KLEK L+Q GLKGN YR+L GD+KE      +A ++P
Sbjct  11   TIVIVTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            ++L D++A RV P+   L + YGKN ++W GP P V I +P+ +K +  K   FQK  + 
Sbjct  71   LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSI  130

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            PL R L+ GL + E E+WAKHR+L+NPAF+ EK KLM PAF LSC E+++K E  +  +G
Sbjct  131  PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIITKWEKQMSVEG  190

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            SS    E+DVWP+L  LT DVISRTAFGSSYEEG+RIF+L  E A   ++  R V+IPG 
Sbjct  191  SS----ELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRSVHIPGW  246

Query  787  R  789
            R
Sbjct  247  R  247



>ref|XP_008219216.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 170/243 (70%), Gaps = 7/243 (3%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            V VS+ ++A+AWRVL W+W +PKKLE+CL++ G  GN YR+L GD K+   M   A SKP
Sbjct  11   VWVSI-VIAWAWRVLNWMWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLRQAQSKP  69

Query  247  MTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            M LS   ++APRV+P+   +   YG+N +VWMGPMP + I +PE +KE+ NK + FQ+P 
Sbjct  70   MKLSTSHDIAPRVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIFNKRQNFQRPS  129

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
             NPL + LV+GL+  E  +WAKHR+++ PAF+ EK K M P F  SCS+M+++ +G+V  
Sbjct  130  ANPLIKLLVQGLLHIEDVKWAKHRKIIKPAFHLEKLKGMLPTFYQSCSDMINEWKGLVSK  189

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIP  780
             G    SCE DVWP L+ L+ DVI+R AFGSSY+EG++IF+LL++Q  +     R VYIP
Sbjct  190  DG----SCEFDVWPCLKNLSADVIARAAFGSSYQEGRKIFQLLQQQDKNFSLVVRSVYIP  245

Query  781  GLR  789
            G R
Sbjct  246  GWR  248



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 160/229 (70%), Gaps = 4/229 (2%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W+++ W+WF+PKKLEK L++ G  GN YRIL GD+KE   M  +A+SKPM  S+++APR
Sbjct  28   GWKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPMNFSNHIAPR  87

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRGL  456
            VIP   H    YGKN ++W+GPMP V I DPE +K V +    FQKP  NPL R LV+G+
Sbjct  88   VIPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKTVFSFINDFQKPTMNPLTRLLVQGI  147

Query  457  VSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVDV  636
             + E E+WAKHR+++NPAF+ EK K M PAF  SC+EM+SK E +V  +G    SCE+DV
Sbjct  148  ANLEGEKWAKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSREG----SCELDV  203

Query  637  WPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
             P L+ +  DVISRTAFGSSYE+G +IF+L  E    +++ +  +YIPG
Sbjct  204  MPCLKNMASDVISRTAFGSSYEKGXKIFKLQTELGNLVIQASLGIYIPG  252



>gb|KJB12906.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=557

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 162/234 (69%), Gaps = 4/234 (2%)
 Frame = +1

Query  88   LAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNV  267
            + + WR L WVW  PK+LE+CL+Q G  GNPYR LSGD+KEL  M+    +KPM LSD++
Sbjct  20   MIWGWRALNWVWLAPKRLERCLRQQGFAGNPYRFLSGDIKELSTMSRQTRAKPMPLSDDI  79

Query  268  APRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLV  447
             P V P+     ++YGKN + W+GP   V I DPE ++E+  K+  FQK R NPL   LV
Sbjct  80   GPYVAPFLHQTVNQYGKNSFTWIGPRQRVNIMDPEKIREIFTKFNDFQKVRTNPLLTLLV  139

Query  448  RGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCE  627
             GLV+ E ++W+KHR+++NP+F+ +K K M PAF  SC +MLSK E +V  +G S    E
Sbjct  140  SGLVNLEGDRWSKHRKIINPSFHQDKLKNMLPAFYQSCCDMLSKWEKMVCTEGYS----E  195

Query  628  VDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +DVWP+L  LT DVISR+AFGSS+EEG+RIF+LL +Q +  ++  + VYIPG R
Sbjct  196  LDVWPYLVDLTRDVISRSAFGSSFEEGRRIFQLLDDQLVLRIKLLQTVYIPGWR  249



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 162/235 (69%), Gaps = 4/235 (2%)
 Frame = +1

Query  85   LLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDN  264
            L  +AWR + WVW +PK+LE+ L+Q GL G  Y  L GD+KE ++M  +A SKP+ +SD+
Sbjct  17   LTTWAWRAVNWVWLRPKRLERLLRQQGLSGKSYTFLVGDLKENLRMLKEAKSKPIAVSDD  76

Query  265  VAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKL  444
            + PR++P+       YGK+ + WMGP P V I +PE +KEV +K   + KP +NPL + L
Sbjct  77   IKPRLLPFLHQSFQTYGKDSFTWMGPTPRVNITNPEQIKEVFSKIYDYPKPASNPLVKLL  136

Query  445  VRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSC  624
              GL ++E E+WA+HR+++NPAF+ EK KLM PAF LSC+EM+ + E  V        SC
Sbjct  137  ADGLANHEGEKWARHRKIINPAFHMEKLKLMLPAFYLSCTEMVDRWEKSVL----EERSC  192

Query  625  EVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            EVD W  LQ LT DVISRTAFGSS+EEGKRIFEL +EQA+  ++  + VYIPG R
Sbjct  193  EVDAWVDLQNLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWR  247



>ref|XP_006299550.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
 gb|EOA32448.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
Length=512

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 167/249 (67%), Gaps = 4/249 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAF-AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+    + + ++V L+++  WR L WVWFKPK LE  L++ GL G PY    GD+K   
Sbjct  1    MEISVASVTLSLAVVLMSWLVWRTLKWVWFKPKMLESYLRRQGLAGTPYSPFGGDLKRNF  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M ++A SKP+ L+D++ PR++PY   +   +G+  Y W GP+P + I +PE +KEV NK
Sbjct  61   SMLAEARSKPIKLTDDITPRLVPYPLQMLKTHGRTFYTWFGPIPTITIMEPEQIKEVFNK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
               FQKP   PLG  + +GL +Y+ ++WAKHRR++NPAF+ EK K M PAF  SCSE+  
Sbjct  121  VYDFQKPHTFPLGTLIAKGLANYDGDKWAKHRRIINPAFHIEKIKNMVPAFYQSCSEVFG  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + + +V  KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +++
Sbjct  181  QWDKLVSEKGS---SCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQ  237

Query  757  TTRQVYIPG  783
              R+ +IPG
Sbjct  238  AFRKAFIPG  246



>ref|XP_010502032.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Camelina sativa]
Length=512

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 159/232 (69%), Gaps = 3/232 (1%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            + WR L WVWFKPK LE  L++ GL G PY +L GD+K    M ++A SKP+ L+D++ P
Sbjct  20   WVWRTLQWVWFKPKILESNLRRQGLSGTPYTLLVGDLKRHFSMLTEAKSKPIKLTDDITP  79

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            R++PY   +   +G+  + W+GP+P + I DPE +KEV NK   FQK    PLGR +  G
Sbjct  80   RIVPYPLQMLKTHGRTFFTWLGPIPTITIMDPEQIKEVFNKVYDFQKAHTFPLGRLIAAG  139

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            LVSY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE + + + +V  KGS   SCE+D
Sbjct  140  LVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSETVGEWDKLVSNKGS---SCEMD  196

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            VWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +++   + +IPG R
Sbjct  197  VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFGKAFIPGYR  248



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 165/233 (71%), Gaps = 5/233 (2%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTL-SDNVA  270
            +AW++L W+W +PK+LE+ L++ GL+GN Y +  GD+KE  KM ++A+SKPM L S ++A
Sbjct  38   WAWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIA  97

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRV+ +  H  +K+GKN ++W GP+P V + DPE +K+VLNK   F KP  NP  R L  
Sbjct  98   PRVLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAP  157

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GLVS+E E+W+KHR+++NPAF  EK K M P F+  C +++SK EG++   G+S    E 
Sbjct  158  GLVSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTS----ET  213

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            D+WP  Q L  DVISRTAFGSSYEEG+RIF+LLKEQ    ++T  +V IPG R
Sbjct  214  DIWPFFQNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWR  266



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 165/233 (71%), Gaps = 5/233 (2%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTL-SDNVA  270
            +AW++L W+W +PK+LE+ L++ GL+GN Y +  GD+KE  KM ++A+SKPM L S ++A
Sbjct  38   WAWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIA  97

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRV+ +  H  +K+GKN ++W GP+P V + DPE +K+VLNK   F KP  NP  R L  
Sbjct  98   PRVLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAP  157

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GLVS+E E+W+KHR+++NPAF  EK K M P F+  C +++SK EG++   G+S    E 
Sbjct  158  GLVSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTS----ET  213

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            D+WP  Q L  DVISRTAFGSSYEEG+RIF+LLKEQ    ++T  +V IPG R
Sbjct  214  DIWPFFQNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWR  266



>ref|XP_009343589.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=515

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 163/233 (70%), Gaps = 4/233 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
             +AWRV+ W+W +PKKLE+ L+Q GL GN YR  SGDMKE+      A SKPM+LS  +A
Sbjct  18   TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFKSGDMKEISMTTEQAYSKPMSLSHYIA  77

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVR  450
            PRVIP++  L + Y KN +VWMG +P V I +PE +K +L K E F +P  NPL + L  
Sbjct  78   PRVIPFHHRLVNTYRKNSFVWMGTIPRVIITNPEDLKYILTKMEEFPQPEPNPLVKLLAT  137

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            G+  YE E+WAKH+R++NP F+ EK K M PAF  SCSEM+ + E +V  +G    SCE+
Sbjct  138  GIALYEGEKWAKHQRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKEG----SCEL  193

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DV P L+ LT D+ISR+AFGSSY+EG++IF+LL+EQA  + +  + VYIPG R
Sbjct  194  DVRPCLENLTADMISRSAFGSSYKEGRKIFQLLREQAQLVTKVIQNVYIPGWR  246



>ref|XP_011098146.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=517

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 166/241 (69%), Gaps = 6/241 (2%)
 Frame = +1

Query  67   VCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKP  246
            + VS  L+    ++L WVWF+PKKLEK L++ GL GNPYR+  GDM++L  +      K 
Sbjct  14   ILVSTALIV---KLLNWVWFRPKKLEKLLRKQGLNGNPYRLFRGDMQDLSNVMKTKQPKT  70

Query  247  MTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNN  426
            + LSD++ P ++PYY ++ DKYGK+ ++W+GP P + + DPE +KE+L+K  LF KP  +
Sbjct  71   LKLSDDLPPHILPYYHNIIDKYGKHSFIWVGPSPRLNVADPEHIKEILSKPGLFHKPLPD  130

Query  427  PLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKG  606
            P+G  +V GL   E ++WAKHRR++NPAF+ EK K M PA  LSCS+++ K E  + G G
Sbjct  131  PIGETIVGGLAYLEDDRWAKHRRIMNPAFHMEKLKNMIPAMFLSCSKLIEKWEASISGSG  190

Query  607  SSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGL  786
            SS    E+DVWP+LQ LT DVISRTAFG SYEEG+RIFEL +EQ   ++      ++PG 
Sbjct  191  SSQ---EIDVWPYLQDLTGDVISRTAFGRSYEEGRRIFELQREQVKLVLHLFPFSFLPGW  247

Query  787  R  789
            R
Sbjct  248  R  248



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 169/249 (68%), Gaps = 4/249 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLA-FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+    + + V++ +++ + WR L WVWFKPK LE  L++ GL G  Y  L GD+K   
Sbjct  1    MEISVASVTISVAIVVVSLWVWRTLQWVWFKPKMLESYLRRQGLAGTRYTPLVGDLKRNA  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M ++A SKP+ L+D+  PR++P+  H+   +G+  + W+GP+P + I DPEL+KEV NK
Sbjct  61   NMLAEARSKPIKLTDDTRPRIVPFPLHMLKTHGRTFFTWLGPIPTITIMDPELIKEVFNK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
               FQK    PLGR +V GLVSY+ ++W KHRR++NPAF+ EK K M PAF  SCSE + 
Sbjct  121  VYDFQKAHTFPLGRLIVPGLVSYDGDKWTKHRRIINPAFHLEKIKNMVPAFHQSCSETVG  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + + +V  KGS   SCEVDVWP L  +T DVISRTAFGSSY+EG+RIFEL  E +  +++
Sbjct  181  EWDKLVSNKGS---SCEVDVWPWLLSMTADVISRTAFGSSYKEGQRIFELQAELSQLIIQ  237

Query  757  TTRQVYIPG  783
              ++ +IPG
Sbjct  238  AVQKAFIPG  246



>ref|XP_009356829.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 172/251 (69%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEVIYTLLGVC-VSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            MEV  + +GV  V + + A+AWRV+ W+W +PKKLE+ L+Q GL GN YR L GD+ E  
Sbjct  1    MEVSVSNIGVVLVRIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLTERT  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
             M   A SKPM LS ++APRV+P+  H  + YGKN ++W GP+P V I +PE +K++L K
Sbjct  61   MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
             E F K ++NP  + LV G   Y+ E+W +HRR++NPAF+ +K K M PAF LS +EM+ 
Sbjct  121  IEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMIK  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            + E +V   G    SCE+DV P L+ LT D+ISR+AFGSSY+EG++IF+LL+EQ   + +
Sbjct  181  EWESLVLKAG----SCELDVQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSK  236

Query  757  TTRQVYIPGLR  789
              + VYIPG R
Sbjct  237  VIQNVYIPGWR  247



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 165/239 (69%), Gaps = 5/239 (2%)
 Frame = +1

Query  61   LGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAIS  240
            +   + + LL + WR + W+W +PK LEKCLK+LG +GN Y++L GDMKE+V M  +A S
Sbjct  9    ISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKS  68

Query  241  KPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPR  420
            KP+  S ++ PR++P+       YGKN ++W+ P P + I DPEL++E+L+K  +FQKP 
Sbjct  69   KPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPP  128

Query  421  NNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYG  600
                 + LV G++SYE ++WAKHRR++NPAF+ +K K M P+F LS  EMLS+ E +   
Sbjct  129  PTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLSTCEMLSEWEKVASA  188

Query  601  KGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
            +GS     EVDVWP+LQ LT D ISRTAFGSSYEEG++IFEL +E A  +++ T   YI
Sbjct  189  EGS-----EVDVWPYLQSLTSDAISRTAFGSSYEEGRKIFELQQELAKIILKVTESSYI  242



>ref|XP_009146333.1| PREDICTED: cytochrome P450 72A13-like [Brassica rapa]
Length=512

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 169/244 (69%), Gaps = 6/244 (2%)
 Frame = +1

Query  67   VCVSVGLLA---FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAI  237
            V VSV ++A   + WR L WVWFKPK LE  L++ GL G+PY  L GD++    M+ +A 
Sbjct  8    VTVSVAIVAVLWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDVRRDYTMSMEAR  67

Query  238  SKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKP  417
            SKP+  +D++ PRV+P+ +H+   YG+  + W GP+P + I DPE +KEV NK   FQKP
Sbjct  68   SKPIKTTDDIIPRVVPFPSHMLKTYGRTFFTWRGPIPTITITDPEQIKEVFNKIYDFQKP  127

Query  418  RNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVY  597
             + PLGR +  GL SY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ K + +V 
Sbjct  128  HSFPLGRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGKWDKLVS  187

Query  598  GKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYI  777
             KGS   SCEVDVW  L  +T DVISRTAFGSSY+EG+RIFEL  E A+ L +  R+++I
Sbjct  188  DKGS---SCEVDVWLGLVSMTADVISRTAFGSSYKEGQRIFELQAELALLLTQAFRRIFI  244

Query  778  PGLR  789
            PG R
Sbjct  245  PGYR  248



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 160/233 (69%), Gaps = 6/233 (3%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W+++ W+WF+PKKLEK L+Q G  GN YRIL GD+KE   M   AISKPM  S+ +APR
Sbjct  28   GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKESAAMRDQAISKPMNFSNYIAPR  87

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN--NPLGRKLVR  450
            VIP   H    YGKN ++W+GPMP V I DPE +K V +    +QKP    NPL + L  
Sbjct  88   VIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  147

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL+++E ++W KHR+++NPAF+ EK K M PAF  SC EM+SK E +V  +G     CE+
Sbjct  148  GLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEG----FCEL  203

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DV P+LQ +T DVISRTAFGSSYE+GK+IF+L  E    ++++T  +YIPG R
Sbjct  204  DVMPYLQNMTADVISRTAFGSSYEKGKKIFKLQTELGEMVMQSTLGIYIPGWR  256



>ref|XP_008226302.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=518

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 167/251 (67%), Gaps = 5/251 (2%)
 Frame = +1

Query  40   MEV-IYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELV  216
            ME+ + +++   + VGL+   W+V+ WVW KPKKLE+ L+Q GL GN YR+L GD+ +  
Sbjct  1    MEISVSSMVVAILCVGLITLGWKVVNWVWLKPKKLERYLRQQGLSGNSYRLLIGDLTDNS  60

Query  217  KMASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNK  396
            KM  +A+SKPM  S ++ P V+P      +KYGK  ++W+GP+P V I D EL++E L K
Sbjct  61   KMTKEALSKPMEFSHDIVPYVLPLLQETFNKYGKKSFIWLGPVPSVVIFDAELMRETLTK  120

Query  397  YELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLS  576
            + +F+KP +NPL   LV GL+SYE ++W KH+R++NPAF+ +K K M PAF  +C  MLS
Sbjct  121  HRVFEKPHSNPLLSFLVTGLLSYEGDKWVKHKRIINPAFHIDKMKDMLPAFHAACENMLS  180

Query  577  K*EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVE  756
            K E       SS  +CE+DVWP+L   + D ISR AFGS++EEG+R FEL KEQ     E
Sbjct  181  KWE----THFSSKETCELDVWPYLCAFSGDAISRAAFGSNFEEGERFFELQKEQGALTRE  236

Query  757  TTRQVYIPGLR  789
                VYIP LR
Sbjct  237  VLNSVYIPLLR  247



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 174/248 (70%), Gaps = 4/248 (2%)
 Frame = +1

Query  46   VIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMA  225
            V   ++   +++  L +AWR+L W+W KPKKLEK L++ G KGN YR+L GD+++L+K  
Sbjct  4    VTTAIILFTLTILSLTWAWRMLNWLWLKPKKLEKLLREQGFKGNSYRLLVGDVRDLLKTR  63

Query  226  SDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYEL  405
             +A SKPM LSD++ PRV  Y  H   KYGKN ++W GP+P V I DPE +K+VLNK   
Sbjct  64   KEATSKPMNLSDDIGPRVFSYVHHSVTKYGKNSFMWFGPIPRVNITDPEQIKDVLNKIYD  123

Query  406  FQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*E  585
            F+KP +NPL R L  GLVSYE E+W KHR+++NPAF+ EK K+M P F  SC +++SK E
Sbjct  124  FRKPNSNPLVRLLANGLVSYEGEKWNKHRKIINPAFHLEKLKIMLPIFFKSCDDLISKWE  183

Query  586  GIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTR  765
             ++  +G    SCE+DVWP LQ L  DVISRTAFGSS+EEGKRIF+L  EQA    +   
Sbjct  184  KMLSLEG----SCEMDVWPFLQNLASDVISRTAFGSSFEEGKRIFQLQIEQAELTKQIMM  239

Query  766  QVYIPGLR  789
            +VYIPG R
Sbjct  240  KVYIPGWR  247



>ref|XP_007224159.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
 gb|EMJ25358.1| hypothetical protein PRUPE_ppa016446mg [Prunus persica]
Length=519

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 172/249 (69%), Gaps = 7/249 (3%)
 Frame = +1

Query  49   IYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMAS  228
            +  L  V VS+ ++A+AWRVL W+  +PKKLE+CL++ G  GN YR+L GD K+   M  
Sbjct  5    VAVLSVVWVSI-VIAWAWRVLNWMCLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLR  63

Query  229  DAISKPMTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYE  402
             A SKPM LS   ++APRV+P+   +   YG+N +VWMGPMP + I +PE +KE+ NK +
Sbjct  64   QAQSKPMKLSTSHDIAPRVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIFNKRQ  123

Query  403  LFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*  582
             FQ+P  NPL + LV+GL+  E E+WAKHR+++ PAF+ EK K M P F  SCS+M+++ 
Sbjct  124  NFQRPSANPLIKLLVQGLLHIEDEKWAKHRKIIKPAFHLEKLKGMLPTFYQSCSDMINEW  183

Query  583  EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETT  762
            +G+V   G    SCE DVWP L+ L+ DVI+R AFGSSY+EG++IF+LL++Q  +     
Sbjct  184  KGLVSKDG----SCEFDVWPCLKNLSADVIARAAFGSSYQEGRKIFQLLQQQDKNFSLVV  239

Query  763  RQVYIPGLR  789
            R VYIPG R
Sbjct  240  RSVYIPGSR  248



>ref|XP_010487266.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 160/230 (70%), Gaps = 2/230 (1%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            + WR L WVWFKPK LE  L++ GL G  Y  L GD+K    M ++A SKP+ L+D + P
Sbjct  20   WVWRTLEWVWFKPKMLESYLRRQGLAGTHYTPLVGDLKRNSSMLAEARSKPINLTDEITP  79

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            RV+P+  H+   +G+  + W+GP+P+V I DPEL+KEV NK   FQKP   PLGR +  G
Sbjct  80   RVVPFPLHMLKTHGRTFFTWLGPVPVVTIMDPELIKEVFNKVYDFQKPHTFPLGRIIAAG  139

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            LVSY+ ++WAK+RR++NPAF+ EK K M PAF  SCSE++ + + +V  K  S  SCE+D
Sbjct  140  LVSYDGDKWAKYRRIINPAFHLEKIKNMVPAFHQSCSEVVGQWDKLVLDKDGS--SCEMD  197

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            VWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +++  R+ +IPG
Sbjct  198  VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELATLIIQAFRKAFIPG  247



>ref|XP_008226214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=518

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 170/247 (69%), Gaps = 6/247 (2%)
 Frame = +1

Query  55   TLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDA  234
             +L V     ++A+AWRVL WVW +PKKLE+ L++ GL GN Y++L GD KE   M   A
Sbjct  6    AVLSVVWVSMVIAWAWRVLNWVWLRPKKLERSLREQGLTGNSYKLLFGDTKESSMMLDQA  65

Query  235  ISKPMTLSD--NVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELF  408
             SKP+ LS   ++APRV+P+     + YGKN +VWMGP+P V I +PE +KE+ NK + F
Sbjct  66   QSKPIKLSTSHDIAPRVMPFVHQTVNTYGKNSFVWMGPIPKVNIMNPEDLKEIFNKDQNF  125

Query  409  QKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EG  588
            ++P  NP+   L +GL+++E  +WAKHR++++PAF+ EK K M P F  SCSEM+++ E 
Sbjct  126  RRPSANPMIDLLAQGLLAFEDGKWAKHRKIIHPAFHLEKLKGMLPTFYQSCSEMINEWER  185

Query  589  IVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQ  768
            +V  +G    SCE+DVWP LQ L+ D+ISR AFGSSY+EG++IF+LL+EQ        + 
Sbjct  186  LVSKEG----SCELDVWPCLQTLSADMISRAAFGSSYQEGRKIFQLLREQEKFYATAIQS  241

Query  769  VYIPGLR  789
            VYIPG R
Sbjct  242  VYIPGSR  248



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 159/233 (68%), Gaps = 6/233 (3%)
 Frame = +1

Query  97   AWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAPR  276
             W+++ W+WF+PKKLEK L+Q G  GN YRIL GD+KE   M   AISKPM  S+ +APR
Sbjct  28   GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKERAAMRDQAISKPMNFSNYIAPR  87

Query  277  VIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRN--NPLGRKLVR  450
            VIP   H    YGKN ++W+GPMP V I DPE +K V +    +QKP    NPL + L  
Sbjct  88   VIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  147

Query  451  GLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEV  630
            GL+++E ++W KHR+++NPAF+ EK K M PAF  SC EM+SK E +V  +G     CE+
Sbjct  148  GLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEG----FCEL  203

Query  631  DVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            DV P+LQ +T DVISRTAFGSSYE+GKR F+L  E    ++++T  +YIPG R
Sbjct  204  DVMPYLQNMTADVISRTAFGSSYEKGKRXFKLQTELGEMVMQSTLGIYIPGWR  256



>gb|KEH36886.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=383

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 167/247 (68%), Gaps = 6/247 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            + + Y ++ + V++GL+ + WRVL W+W KPK+LEK L++ G  GN YR++ GD+K+  K
Sbjct  5    LAIYYGIILITVTLGLV-YTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYK  63

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M   A SKPM LSD++ PRVIPY   L   YGKN ++W G  P + + +PEL+K+VLN+ 
Sbjct  64   MGKKAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNRT  123

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
               QKP+   + + L  GL+ +E E+W KHRRL+N AF  EK K+M P+FL SC +M+SK
Sbjct  124  SELQKPKYE-IFKFLFSGLIIHEGEKWRKHRRLMNAAFQLEKLKIMAPSFLTSCIDMISK  182

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E  +    SS  S E+D+WP LQ LT DVISR AFGSSYEEGKRIF+L +EQ   +++ 
Sbjct  183  WESTL----SSDGSGEIDIWPSLQNLTSDVISRNAFGSSYEEGKRIFDLQREQGELVMKN  238

Query  760  TRQVYIP  780
              +  IP
Sbjct  239  LVKSLIP  245



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   248 bits (634),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 168/234 (72%), Gaps = 5/234 (2%)
 Frame = +1

Query  91   AFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVA  270
            ++AW VL  +W++P KLEKC ++ G++G P   L G++K+ V+M ++A+SKPM LS ++A
Sbjct  18   SWAWSVLYSIWWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVRMRNEALSKPMNLSHDIA  77

Query  271  PRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVL-NKYELFQKPRNNPLGRKLV  447
            PRV+P+     +KYG     W G  P + + DP+L+K++L NK+  F+KP++NPL R  V
Sbjct  78   PRVVPFVHQTIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNKFGQFEKPKSNPLIRLFV  137

Query  448  RGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCE  627
             GLVS+E E+WAKHRR++NPAF+ EK K M PAF  SC EM++K E +V  +G    SCE
Sbjct  138  DGLVSHEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCFEMITKWEKLVALEG----SCE  193

Query  628  VDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            +D+WP LQ LT DVISRTAFGSSY+EG+RIF+L  EQA  +++    +YIPG R
Sbjct  194  LDIWPELQNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALSIYIPGYR  247



>gb|EYU38228.1| hypothetical protein MIMGU_mgv1a004669mg [Erythranthe guttata]
Length=516

 Score =   248 bits (634),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 169/250 (68%), Gaps = 4/250 (2%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            MEV   LL + V VGL+  + + + WVW KPKKLEK L++ GL GNPY++L GDMK+L+ 
Sbjct  1    MEVGSILLSILV-VGLITLSAKFVNWVWIKPKKLEKLLRKEGLNGNPYKLLLGDMKQLIS  59

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            +  +   K +  SD++ P ++P+Y H   K+G+N ++W+GP P + I DP+L+KE+L K 
Sbjct  60   VMKEEQPKSIQFSDHLLPHILPHYHHNRTKFGENSFMWVGPSPKLIIADPQLMKEILEKP  119

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
             +FQKP  +P+G  +  GLV  E E+W KHRR++NPAF+ EK K M PA  LSCS ML +
Sbjct  120  NVFQKPHPDPIGETIAGGLVVLEDEKWTKHRRIINPAFHMEKLKKMVPAIRLSCSNMLDQ  179

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             E    G   S  S E+DVWP+LQ L+ DVISR AFGSS+E+G RIFEL K+Q    +E 
Sbjct  180  WEASFAG---SDESKEIDVWPYLQNLSGDVISRVAFGSSHEQGVRIFELQKDQVKLALEL  236

Query  760  TRQVYIPGLR  789
             + +++PG R
Sbjct  237  LKFMFVPGWR  246



>ref|XP_004488695.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=513

 Score =   248 bits (633),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 167/250 (67%), Gaps = 3/250 (1%)
 Frame = +1

Query  40   MEVIYTLLGVCVSVGLLAFAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVK  219
            MEV + ++   + + +L +AW+   W+W KPKKLE+ L++ GLKG  YR+L GD  +++K
Sbjct  1    MEVPWAIIVSIILLIILVWAWKAFNWLWLKPKKLERILREQGLKGTSYRLLYGDTNDVIK  60

Query  220  MASDAISKPMTLSDNVAPRVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKY  399
            M ++A  K + LSD++   V PY      KYG N ++W GP P V + D ELVKEV  K 
Sbjct  61   MQTEAAFKSINLSDDLVSHVFPYDHQTVTKYGNNPFIWFGPKPRVILTDSELVKEVFMKS  120

Query  400  ELFQKPRNNPLGRKLVRGLVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK  579
              FQK   NPL R L+ GLVSY+ E+W+KHR+++NPAF+ EK KLM P FL  C +++S 
Sbjct  121  NSFQKLPQNPLLRMLINGLVSYDSEKWSKHRKIINPAFHLEKLKLMLPTFLQCCDDLVSN  180

Query  580  *EGIVYGKGSSSCSCEVDVWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVET  759
             EG +    SS+ +CEVDVWP +Q L+ DVI+RTAFGS+YEEG +IFELLKEQ     E 
Sbjct  181  WEGEL---SSSNGTCEVDVWPSVQKLSSDVIARTAFGSTYEEGIKIFELLKEQMDLTAEM  237

Query  760  TRQVYIPGLR  789
               +YIPG R
Sbjct  238  FITIYIPGWR  247



>ref|XP_010465353.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   248 bits (633),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 159/232 (69%), Gaps = 3/232 (1%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            + WR L WVWFKPK LE  L++ GL G  Y  L GD+K    M ++A SKP+ L+D++ P
Sbjct  20   WVWRTLQWVWFKPKMLESYLRRQGLAGTSYTPLVGDLKRHFSMLTEAKSKPIKLTDDITP  79

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            R++PY   +   +G+  + W+GP+P + I DPEL+KEV NK   FQK    PLGR +  G
Sbjct  80   RIVPYPLQMLKTHGRTHFTWLGPIPTITIMDPELIKEVFNKVYDFQKAHTFPLGRLIAAG  139

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            L+SY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE + + + +V  KGS   SCE+D
Sbjct  140  LLSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSETVGEWDKLVSNKGS---SCELD  196

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPGLR  789
            VWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +++  ++ +IPG R
Sbjct  197  VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFQKTFIPGYR  248



>ref|XP_010502020.1| PREDICTED: cytochrome P450 72A13 isoform X2 [Camelina sativa]
Length=513

 Score =   248 bits (633),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 158/230 (69%), Gaps = 2/230 (1%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            + WR L WVWFKPK LE  LK+ GL G PY  L GD+K    M + A SKP+ L+D++ P
Sbjct  20   WVWRTLQWVWFKPKMLESYLKRQGLAGTPYTPLVGDLKRNSSMLAVARSKPIKLTDDITP  79

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            RV+P+  H+   +G+  + W GP+P++ I DPEL+KEV NK   FQK    PLGR +  G
Sbjct  80   RVVPFPLHMLKTHGRTFFTWFGPVPVITIMDPELIKEVFNKVYDFQKAHTFPLGRIIAAG  139

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            LVSY+ ++WAKHRR++NPAF+ EK K M PAF  SCSE++ + + +   K  S  SCE+D
Sbjct  140  LVSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGQWDKLALDKEGS--SCEMD  197

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            VWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  +++  R+ +IPG
Sbjct  198  VWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELAKLIIQAFRKAFIPG  247



>ref|XP_009146335.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   248 bits (633),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 158/230 (69%), Gaps = 3/230 (1%)
 Frame = +1

Query  94   FAWRVLGWVWFKPKKLEKCLKQLGLKGNPYRILSGDMKELVKMASDAISKPMTLSDNVAP  273
            + WR L WVWFKPKKLE  L+  GL G+PY  L GD+K    MA +A SKP+ L+D+V+ 
Sbjct  20   WTWRTLNWVWFKPKKLESYLRSQGLSGSPYTPLIGDLKRTFSMAMEARSKPIKLTDDVST  79

Query  274  RVIPYYAHLADKYGKNCYVWMGPMPMVFIRDPELVKEVLNKYELFQKPRNNPLGRKLVRG  453
            RV+P+   +   +G+  + W+G +P + I DPEL+KEV NK   FQKP   PLG  + +G
Sbjct  80   RVVPFPFEMLKTHGRTYFTWLGTIPTITIMDPELIKEVFNKVYDFQKPHTFPLGNVIAKG  139

Query  454  LVSYEKEQWAKHRRLLNPAFYSEKPKLMQPAFLLSCSEMLSK*EGIVYGKGSSSCSCEVD  633
            L +Y+ E+WAKHR+++NPAF+ EK K M PAF  SCSE++ K + IV  KGS   SCEVD
Sbjct  140  LANYDGEKWAKHRKIINPAFHLEKIKNMVPAFHQSCSEVVGKWDKIVSEKGS---SCEVD  196

Query  634  VWPHLQGLTCDVISRTAFGSSYEEGKRIFELLKEQAMHLVETTRQVYIPG  783
            VWP L  +T DVISRTAFGSSY+EG+RIFEL  E A  ++    + ++PG
Sbjct  197  VWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIILAVLKAFVPG  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570