BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF043E02

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               169   4e-45   Ipomoea batatas [batate]
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        117   1e-26   
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 117   2e-26   Theobroma cacao [chocolate]
gb|KJB61042.1|  hypothetical protein B456_009G337000                    115   2e-26   Gossypium raimondii
gb|KJB61043.1|  hypothetical protein B456_009G337000                    115   6e-26   Gossypium raimondii
gb|KJB61041.1|  hypothetical protein B456_009G337000                    115   9e-26   Gossypium raimondii
gb|KJB61045.1|  hypothetical protein B456_009G337000                    115   9e-26   Gossypium raimondii
gb|KDP26621.1|  hypothetical protein JCGZ_17779                         115   1e-25   Jatropha curcas
gb|KDO82336.1|  hypothetical protein CISIN_1g006968mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    114   2e-25   Solanum lycopersicum
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    114   2e-25   Solanum lycopersicum
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                114   3e-25   Erythranthe guttata [common monkey flower]
gb|KDO82335.1|  hypothetical protein CISIN_1g006968mg                   112   4e-25   Citrus sinensis [apfelsine]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             113   5e-25   Citrus clementina [clementine]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    113   5e-25   Citrus sinensis [apfelsine]
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   113   6e-25   Citrus sinensis [apfelsine]
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   8e-25   Solanum tuberosum [potatoes]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        112   1e-24   Elaeis guineensis
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             112   1e-24   
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    112   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    111   2e-24   Populus euphratica
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    111   2e-24   Populus euphratica
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   111   3e-24   Morus notabilis
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    110   4e-24   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    110   4e-24   Malus domestica [apple tree]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    110   4e-24   Malus domestica [apple tree]
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    110   5e-24   Solanum tuberosum [potatoes]
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    110   5e-24   
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    110   5e-24   
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    110   6e-24   
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        110   6e-24   
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        110   7e-24   Phoenix dactylifera
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        109   1e-23   Nelumbo nucifera [Indian lotus]
dbj|BAD68256.1|  putative brassinosteroid insensitive 1-associate...    107   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    109   1e-23   Elaeis guineensis
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    108   2e-23   Nicotiana tomentosiformis
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    108   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EPS59440.1|  hypothetical protein M569_15369                         100   2e-23   Genlisea aurea
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        108   3e-23   Vitis vinifera
emb|CAN75190.1|  hypothetical protein VITISV_035381                     107   4e-23   Vitis vinifera
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    107   4e-23   Fragaria vesca subsp. vesca
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    107   4e-23   Fragaria vesca subsp. vesca
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             107   5e-23   
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    107   5e-23   
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        107   5e-23   Nicotiana sylvestris
emb|CDP13189.1|  unnamed protein product                                107   6e-23   Coffea canephora [robusta coffee]
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        107   7e-23   Eucalyptus grandis [rose gum]
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    107   8e-23   Phoenix dactylifera
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    107   8e-23   Phoenix dactylifera
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        107   8e-23   Solanum lycopersicum
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        107   8e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    107   9e-23   Setaria italica
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          107   9e-23   
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    106   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    106   1e-22   
ref|NP_001169689.1|  LOC100383570 precursor                             106   2e-22   Zea mays [maize]
dbj|BAK02609.1|  predicted protein                                      106   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009797107.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    104   3e-22   Nicotiana sylvestris
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        105   4e-22   Glycine soja [wild soybean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    105   4e-22   Glycine max [soybeans]
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             105   5e-22   Eutrema salsugineum [saltwater cress]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    104   6e-22   Prunus mume [ume]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    104   6e-22   Prunus mume [ume]
gb|ACM89541.1|  leucine-rich repeat receptor-like kinase                103   7e-22   Glycine max [soybeans]
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    104   7e-22   Cucumis sativus [cucumbers]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    104   7e-22   Glycine max [soybeans]
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        104   7e-22   Glycine soja [wild soybean]
emb|CDY61461.1|  BnaC01g43240D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             103   1e-21   
ref|XP_002312685.1|  leucine-rich repeat family protein                 103   1e-21   
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590          103   1e-21   Amborella trichopoda
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   1e-21   
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    103   1e-21   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    103   2e-21   Nelumbo nucifera [Indian lotus]
gb|EPS73511.1|  hypothetical protein M569_01245                         102   3e-21   Genlisea aurea
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           102   3e-21   Medicago truncatula
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    102   4e-21   Brassica rapa
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    102   4e-21   Brassica rapa
emb|CDY46185.1|  BnaA01g23070D                                          102   4e-21   Brassica napus [oilseed rape]
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                102   4e-21   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    102   5e-21   Cicer arietinum [garbanzo]
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        101   7e-21   Tarenaya hassleriana [spider flower]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    101   9e-21   Cucumis melo [Oriental melon]
gb|KCW86694.1|  hypothetical protein EUGRSUZ_B03306                   99.4    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    100   2e-20   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    100   2e-20   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    100   2e-20   Eucalyptus grandis [rose gum]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                     100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    100   2e-20   
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.8    2e-20   
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  99.8    2e-20   Eucalyptus grandis [rose gum]
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   99.8    2e-20   Eucalyptus grandis [rose gum]
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                   99.8    3e-20   Eucalyptus grandis [rose gum]
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                   99.8    3e-20   Eucalyptus grandis [rose gum]
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                   99.8    3e-20   Eucalyptus grandis [rose gum]
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                   99.8    3e-20   Eucalyptus grandis [rose gum]
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  99.8    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  99.8    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  98.6    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  98.6    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002886588.1|  nsp-interacting kinase 3                         98.6    7e-20   
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  97.8    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  97.4    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g           97.4    2e-19   Phaseolus vulgaris [French bean]
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg           96.3    4e-19   
gb|AAB71968.1|  Putative Serine/Threonine protein kinase              95.9    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176279.1|  NSP-interacting kinase 3                            95.9    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  92.8    6e-18   
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.7    7e-16   Populus euphratica
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g           86.7    7e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g           86.7    7e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.7    7e-16   Populus euphratica
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.3    9e-16   Tarenaya hassleriana [spider flower]
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  86.3    9e-16   Tarenaya hassleriana [spider flower]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.9    1e-15   Elaeis guineensis
gb|KDO70179.1|  hypothetical protein CISIN_1g007025mg                 84.7    1e-15   Citrus sinensis [apfelsine]
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.9    1e-15   Phoenix dactylifera
ref|XP_002871697.1|  nsp-interacting kinase 1                         85.5    2e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  85.1    2e-15   Citrus sinensis [apfelsine]
gb|KDO70178.1|  hypothetical protein CISIN_1g007025mg                 84.7    2e-15   Citrus sinensis [apfelsine]
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg           85.1    2e-15   Citrus clementina [clementine]
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      85.1    3e-15   Camelina sativa [gold-of-pleasure]
gb|AFW73242.1|  putative leucine-rich repeat receptor-like protei...  78.6    3e-15   
ref|XP_002876917.1|  nsp-interacting kinase 2                         84.7    4e-15   
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.7    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    4e-15   
ref|NP_197104.1|  NSP-interacting kinase 1                            84.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65586.1|  receptor protein kinase-like protein                  84.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG93736.1|  unnamed protein product                              82.0    4e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KJB43138.1|  hypothetical protein B456_007G186300                  84.3    4e-15   Gossypium raimondii
gb|KDP31451.1|  hypothetical protein JCGZ_11827                       84.3    4e-15   Jatropha curcas
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    5e-15   Elaeis guineensis
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    5e-15   Phoenix dactylifera
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    6e-15   Phoenix dactylifera
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g           83.6    8e-15   Phaseolus vulgaris [French bean]
gb|AFK34142.1|  unknown                                               78.2    8e-15   Medicago truncatula
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      83.6    9e-15   Cucumis melo [Oriental melon]
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.2    9e-15   
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.2    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007033440.1|  NSP-interacting kinase 1                         83.2    1e-14   
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg           83.2    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  83.2    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      83.2    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      83.2    1e-14   Tarenaya hassleriana [spider flower]
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...  83.6    1e-14   
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.8    1e-14   
gb|EEC73926.1|  hypothetical protein OsI_08784                        83.2    1e-14   Oryza sativa Indica Group [Indian rice]
gb|EEE57731.1|  hypothetical protein OsJ_08242                        83.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg           82.8    1e-14   Citrus clementina [clementine]
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                 82.8    1e-14   Citrus sinensis [apfelsine]
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.8    1e-14   Citrus sinensis [apfelsine]
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                      82.4    2e-14   Glycine soja [wild soybean]
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.4    2e-14   
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.4    2e-14   Phoenix dactylifera
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      82.4    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004173630.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.3    2e-14   
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg           82.0    2e-14   Capsella rubella
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  82.0    2e-14   Nicotiana tomentosiformis
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  81.6    3e-14   Populus euphratica
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g           81.6    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  81.6    3e-14   Populus euphratica
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    3e-14   Solanum tuberosum [potatoes]
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    4e-14   Cucumis sativus [cucumbers]
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  81.3    4e-14   Cucumis melo [Oriental melon]
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg              81.3    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  81.3    4e-14   
emb|CDY48073.1|  BnaA06g33550D                                        81.3    4e-14   Brassica napus [oilseed rape]
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                      81.3    4e-14   Glycine soja [wild soybean]
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...  81.3    5e-14   Brassica rapa
ref|XP_006844161.1|  hypothetical protein AMTR_s00006p00261510        81.3    5e-14   Amborella trichopoda
ref|XP_010424117.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.9    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  81.3    5e-14   Glycine max [soybeans]
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  81.3    5e-14   Ricinus communis
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      81.3    5e-14   Tarenaya hassleriana [spider flower]
ref|XP_006833053.1|  hypothetical protein AMTR_s00170p00030060        80.9    5e-14   
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.9    5e-14   Phoenix dactylifera
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      80.9    6e-14   Solanum lycopersicum
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg           80.9    6e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  80.5    7e-14   Nicotiana sylvestris
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      80.5    8e-14   Solanum lycopersicum
ref|XP_002305735.1|  leucine-rich repeat transmembrane protein ki...  80.5    8e-14   
gb|KDP24340.1|  hypothetical protein JCGZ_25636                       80.1    9e-14   Jatropha curcas
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                 80.1    9e-14   
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor           80.1    9e-14   Zea mays [maize]
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase              80.1    9e-14   Populus tomentosa [Chinese white poplar]
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.1    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.1    1e-13   Oryza brachyantha
ref|XP_002309372.1|  leucine-rich repeat family protein               80.1    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                 80.1    1e-13   
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.1    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      79.7    1e-13   Vitis vinifera
emb|CDX83534.1|  BnaC07g22740D                                        79.7    1e-13   
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  79.7    1e-13   Camelina sativa [gold-of-pleasure]
emb|CDX70667.1|  BnaC03g07510D                                        79.7    1e-13   
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...  79.7    2e-13   Pyrus x bretschneideri [bai li]
emb|CDX78667.1|  BnaA03g05790D                                        79.7    2e-13   
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  79.7    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...  80.1    2e-13   
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                79.3    2e-13   Gossypium arboreum [tree cotton]
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.3    2e-13   Elaeis guineensis
gb|KJB80538.1|  hypothetical protein B456_013G102600                  79.3    2e-13   Gossypium raimondii
gb|KEH25224.1|  NSP-interacting kinase-like protein                   79.0    2e-13   Medicago truncatula
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  79.3    2e-13   Cicer arietinum [garbanzo]
gb|KEH25223.1|  NSP-interacting kinase-like protein                   79.3    2e-13   Medicago truncatula
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  78.6    3e-13   
gb|KEH17047.1|  NSP-interacting kinase-like protein                   79.0    3e-13   Medicago truncatula
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...  79.0    3e-13   Pyrus x bretschneideri [bai li]
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                      78.6    3e-13   Glycine soja [wild soybean]
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...  78.6    3e-13   
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...  78.6    3e-13   Saccharum hybrid cultivar [sugarcane]
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  78.6    3e-13   Setaria italica
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  78.6    3e-13   Glycine max [soybeans]
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170        78.6    4e-13   Sorghum bicolor [broomcorn]
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      78.2    4e-13   Nicotiana tomentosiformis
emb|CDX69484.1|  BnaA10g18330D                                        78.2    4e-13   
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      78.2    4e-13   Brassica rapa
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  78.2    4e-13   Nelumbo nucifera [Indian lotus]
emb|CDY26481.1|  BnaC09g41870D                                        78.2    4e-13   Brassica napus [oilseed rape]
gb|KFK25832.1|  hypothetical protein AALP_AA8G167900                  78.2    4e-13   Arabis alpina [alpine rockcress]
ref|XP_006594544.1|  PREDICTED: probable LRR receptor-like serine...  78.2    4e-13   Glycine max [soybeans]
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      78.2    4e-13   Brassica rapa
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...  78.2    4e-13   Populus euphratica
ref|XP_009619542.1|  PREDICTED: probable LRR receptor-like serine...  78.2    5e-13   Nicotiana tomentosiformis
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  78.2    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  78.2    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g           78.2    5e-13   Phaseolus vulgaris [French bean]
ref|XP_009619541.1|  PREDICTED: probable LRR receptor-like serine...  77.8    5e-13   Nicotiana tomentosiformis
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.8    6e-13   Brachypodium distachyon [annual false brome]
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg           77.8    7e-13   Capsella rubella
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  77.8    7e-13   Solanum tuberosum [potatoes]
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2     77.0    8e-13   Glycine max [soybeans]
ref|XP_002325107.1|  leucine-rich repeat family protein               77.4    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.4    9e-13   Populus euphratica
dbj|BAB09221.1|  receptor-like protein kinase                         77.0    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148027.1|  hypothetical protein PHAVU_006G174400g           77.0    9e-13   Phaseolus vulgaris [French bean]
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.4    9e-13   Populus euphratica
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g           77.4    9e-13   Phaseolus vulgaris [French bean]
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1     77.4    9e-13   Glycine max [soybeans]
ref|XP_007148028.1|  hypothetical protein PHAVU_006G174400g           77.0    9e-13   Phaseolus vulgaris [French bean]
emb|CBI30706.3|  unnamed protein product                              77.0    9e-13   Vitis vinifera
ref|NP_001238448.1|  NSP-interacting kinase precursor                 77.0    9e-13   Glycine max [soybeans]
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...  77.0    1e-12   
ref|NP_199390.2|  putative LRR receptor-like serine/threonine-pro...  77.0    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.0    1e-12   Sesamum indicum [beniseed]
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.0    1e-12   Sesamum indicum [beniseed]
ref|XP_010274435.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_003633015.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Vitis vinifera
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.0    1e-12   
ref|XP_010274431.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
emb|CDO96836.1|  unnamed protein product                              77.0    1e-12   Coffea canephora [robusta coffee]
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010274436.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010274437.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010999763.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Populus euphratica
ref|XP_011039407.1|  PREDICTED: probable LRR receptor-like serine...  76.6    1e-12   Populus euphratica
gb|ADD60694.1|  putative somatic embryogenesis receptor kinase 1      73.9    1e-12   Oryza officinalis
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  77.0    1e-12   Elaeis guineensis
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  76.6    1e-12   Nicotiana sylvestris
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  76.6    1e-12   Nicotiana sylvestris
ref|XP_004485913.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Cicer arietinum [garbanzo]
ref|XP_002863454.1|  hypothetical protein ARALYDRAFT_330836           76.6    1e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_011039404.1|  PREDICTED: probable LRR receptor-like serine...  76.6    1e-12   Populus euphratica
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...  76.6    1e-12   
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.6    1e-12   Pyrus x bretschneideri [bai li]
emb|CDP02372.1|  unnamed protein product                              76.6    1e-12   Coffea canephora [robusta coffee]
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      76.6    1e-12   Fragaria vesca subsp. vesca
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.6    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.6    2e-12   Glycine max [soybeans]
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.6    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  76.3    2e-12   Nicotiana tomentosiformis
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.3    2e-12   Nicotiana sylvestris
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                      76.3    2e-12   
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.3    2e-12   
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  76.3    2e-12   
ref|XP_007214944.1|  hypothetical protein PRUPE_ppa002897mg           76.3    2e-12   
ref|XP_008383876.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-12   
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.3    2e-12   
ref|XP_009781121.1|  PREDICTED: probable LRR receptor-like serine...  76.3    2e-12   
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      76.3    2e-12   
ref|XP_009781120.1|  PREDICTED: probable LRR receptor-like serine...  76.3    2e-12   
ref|XP_002317403.1|  leucine-rich repeat transmembrane protein ki...  76.3    2e-12   
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.3    2e-12   
ref|XP_006358118.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  76.3    2e-12   
gb|KEH21800.1|  NSP-interacting kinase-like protein                   75.9    2e-12   
ref|NP_001152329.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  75.9    2e-12   
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg           75.9    2e-12   
gb|KEH21801.1|  NSP-interacting kinase-like protein                   75.9    2e-12   
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      75.9    2e-12   
ref|XP_006358117.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
emb|CBI16897.3|  unnamed protein product                              75.9    2e-12   
ref|XP_009101570.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_006358116.1|  PREDICTED: probable LRR receptor-like serine...  75.9    3e-12   
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...  75.9    3e-12   
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg           75.9    3e-12   
ref|XP_009101569.1|  PREDICTED: probable LRR receptor-like serine...  75.9    3e-12   
emb|CDY39449.1|  BnaAnng05800D                                        75.5    3e-12   
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                   75.5    3e-12   
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...  75.5    3e-12   
gb|KJB60823.1|  hypothetical protein B456_009G327400                  75.5    3e-12   
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  75.5    4e-12   
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  75.5    4e-12   
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  75.5    4e-12   
gb|AFO67893.1|  leucine-rich repeat receptor-like kinase              75.5    4e-12   
ref|XP_002522232.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  75.1    4e-12   
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g           75.5    4e-12   
emb|CDX77614.1|  BnaC07g18680D                                        75.1    4e-12   
ref|XP_009402861.1|  PREDICTED: probable LRR receptor-like serine...  75.1    4e-12   
ref|XP_003571896.1|  PREDICTED: probable LRR receptor-like serine...  75.1    4e-12   
ref|NP_001057375.2|  Os06g0274300                                     72.4    5e-12   
gb|EAZ22359.1|  hypothetical protein OsJ_06018                        74.7    5e-12   
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  75.1    5e-12   
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...  75.1    5e-12   
emb|CAM31941.1|  hypothetical protein                                 75.1    5e-12   
ref|XP_006412696.1|  hypothetical protein EUTSA_v10024678mg           74.3    5e-12   
ref|XP_006412695.1|  hypothetical protein EUTSA_v10024678mg           74.7    6e-12   
ref|XP_009402860.1|  PREDICTED: probable LRR receptor-like serine...  74.7    6e-12   
ref|NP_001046389.1|  Os02g0236100                                     74.7    6e-12   
gb|EEC72800.1|  hypothetical protein OsI_06491                        74.7    7e-12   
ref|XP_010316837.1|  PREDICTED: probable LRR receptor-like serine...  74.3    7e-12   
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  74.3    7e-12   
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  74.3    7e-12   
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      74.3    8e-12   
ref|XP_010246460.1|  PREDICTED: probable LRR receptor-like serine...  74.3    8e-12   
ref|XP_010246458.1|  PREDICTED: probable LRR receptor-like serine...  74.3    8e-12   
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010        74.3    8e-12   
ref|XP_010246459.1|  PREDICTED: probable LRR receptor-like serine...  74.3    9e-12   
emb|CDY39685.1|  BnaA04g14020D                                        74.3    9e-12   
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...  73.9    9e-12   
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                  73.9    1e-11   
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  73.9    1e-11   
gb|KHG18235.1|  hypothetical protein F383_07279                       73.9    1e-11   
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg           73.9    1e-11   
ref|XP_007025340.1|  Leucine-rich repeat protein kinase family pr...  73.6    1e-11   
ref|XP_010518814.1|  PREDICTED: probable LRR receptor-like serine...  73.6    1e-11   
ref|XP_006398263.1|  hypothetical protein EUTSA_v10000817mg           73.6    2e-11   
gb|ACD56650.1|  putative leucine-rich repeat transmembrane protein    73.6    2e-11   
ref|XP_007025341.1|  Leucine-rich repeat protein kinase family pr...  73.6    2e-11   
ref|XP_004134925.1|  PREDICTED: probable LRR receptor-like serine...  73.2    2e-11   
gb|KDP21117.1|  hypothetical protein JCGZ_21588                       73.2    2e-11   
gb|KHN28623.1|  Putative LRR receptor-like serine/threonine-prote...  73.2    2e-11   
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein    72.8    2e-11   
ref|XP_006449530.1|  hypothetical protein CICLE_v10014603mg           72.8    2e-11   
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  72.8    3e-11   
dbj|BAJ89901.1|  predicted protein                                    72.8    3e-11   
ref|XP_010525766.1|  PREDICTED: probable LRR receptor-like serine...  72.8    3e-11   
emb|CAH56437.1|  somatic embryogenesis receptor-like kinase 1         72.8    3e-11   
gb|KDO77893.1|  hypothetical protein CISIN_1g006907mg                 72.8    3e-11   
ref|XP_006467627.1|  PREDICTED: probable LRR receptor-like serine...  72.8    3e-11   
ref|XP_010518811.1|  PREDICTED: probable LRR receptor-like serine...  72.8    3e-11   
ref|XP_006467628.1|  PREDICTED: probable LRR receptor-like serine...  72.8    3e-11   
ref|XP_010518812.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...  72.8    3e-11   
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  72.4    3e-11   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...  72.4    3e-11   
ref|XP_009129052.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      70.5    3e-11   
ref|XP_010518810.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...  72.4    3e-11   
ref|XP_008792202.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
ref|XP_010518809.1|  PREDICTED: probable LRR receptor-like serine...  72.4    3e-11   
gb|ACN30679.1|  unknown                                               72.4    3e-11   
ref|XP_002880534.1|  leucine-rich repeat family protein               72.4    3e-11   
ref|XP_008792970.1|  PREDICTED: probable LRR receptor-like serine...  72.0    4e-11   
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  72.0    4e-11   
gb|ACL52449.1|  unknown                                               72.0    4e-11   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  72.0    4e-11   
ref|XP_004951350.1|  PREDICTED: probable LRR receptor-like serine...  72.0    4e-11   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...  72.0    4e-11   
ref|XP_008647816.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  72.0    4e-11   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        72.0    4e-11   
ref|XP_010925613.1|  PREDICTED: probable LRR receptor-like serine...  71.6    4e-11   
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...  72.0    4e-11   
ref|XP_010925612.1|  PREDICTED: probable LRR receptor-like serine...  72.0    5e-11   
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...  71.6    6e-11   
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein    71.6    6e-11   
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg           71.6    6e-11   
ref|XP_008371497.1|  PREDICTED: probable LRR receptor-like serine...  71.2    7e-11   
ref|XP_008371495.1|  PREDICTED: probable LRR receptor-like serine...  71.2    7e-11   
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1       71.2    7e-11   
ref|XP_006845438.1|  hypothetical protein AMTR_s00019p00103320        71.2    8e-11   
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      71.2    8e-11   
ref|XP_008371496.1|  PREDICTED: probable LRR receptor-like serine...  71.2    8e-11   
gb|KFK31520.1|  hypothetical protein AALP_AA6G123400                  71.2    8e-11   
ref|NP_974360.1|  NSP-interacting kinase 2                            71.2    9e-11   
ref|NP_001189971.1|  NSP-interacting kinase 2                         71.2    9e-11   
ref|NP_189183.2|  NSP-interacting kinase 2                            71.2    9e-11   
gb|KJB69703.1|  hypothetical protein B456_011G038400                  70.9    9e-11   
gb|KJB69702.1|  hypothetical protein B456_011G038400                  70.9    1e-10   
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein    70.9    1e-10   
gb|KJB69704.1|  hypothetical protein B456_011G038400                  70.9    1e-10   
gb|KDP38737.1|  hypothetical protein JCGZ_04090                       70.9    1e-10   
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  70.9    1e-10   
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                      70.9    1e-10   
ref|XP_006279596.1|  hypothetical protein CARUB_v10026097mg           70.9    1e-10   
ref|XP_002533978.1|  lrr receptor protein kinase, putative            70.5    1e-10   
ref|XP_011085976.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-10   
emb|CAH56436.1|  somatic embryogenesis receptor-like kinase 2         70.5    1e-10   
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-10   
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...  70.1    2e-10   
ref|XP_009352740.1|  PREDICTED: probable LRR receptor-like serine...  70.1    2e-10   
emb|CAB79770.1|  receptor-like kinase homolog                         70.1    2e-10   
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...  70.1    2e-10   
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg           70.1    2e-10   
ref|NP_194781.2|  senescence-associated receptor-like kinase          70.1    2e-10   
emb|CDX99771.1|  BnaC02g35490D                                        68.2    2e-10   
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...  69.3    3e-10   
emb|CDY65182.1|  BnaC04g56200D                                        69.7    3e-10   
gb|KJB30563.1|  hypothetical protein B456_005G149000                  66.2    3e-10   
ref|XP_009351465.1|  PREDICTED: probable LRR receptor-like serine...  69.7    3e-10   
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...  69.7    3e-10   
gb|KEH36623.1|  LRR receptor-like kinase                              69.7    3e-10   
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...  69.3    3e-10   
ref|XP_002867342.1|  predicted protein                                69.3    3e-10   
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...  69.3    3e-10   
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...  69.3    3e-10   
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      69.3    4e-10   
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  69.3    4e-10   
ref|XP_007045673.1|  NSP-interacting kinase 2, putative               68.9    4e-10   
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...  69.3    4e-10   
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...  68.9    4e-10   
ref|NP_001057376.1|  Os06g0274500                                     68.9    4e-10   
emb|CAN63294.1|  hypothetical protein VITISV_040285                   68.9    4e-10   
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...  68.9    4e-10   
gb|EYU34317.1|  hypothetical protein MIMGU_mgv1a0033341mg             65.9    4e-10   
gb|EAZ36607.1|  hypothetical protein OsJ_20953                        68.9    4e-10   
gb|EEC80384.1|  hypothetical protein OsI_22508                        68.9    4e-10   
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase       68.9    5e-10   
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1       68.9    5e-10   
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1       68.6    5e-10   
ref|XP_006656876.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  68.6    5e-10   
gb|KFK29623.1|  hypothetical protein AALP_AA7G158000                  68.6    6e-10   
emb|CDY46500.1|  BnaA02g27500D                                        67.0    6e-10   
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...  68.6    6e-10   
ref|XP_010441667.1|  PREDICTED: probable LRR receptor-like serine...  68.2    7e-10   
emb|CDP00520.1|  unnamed protein product                              68.2    8e-10   
ref|XP_010441669.1|  PREDICTED: probable LRR receptor-like serine...  68.2    8e-10   
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...  68.2    9e-10   
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...  68.2    9e-10   
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      68.2    9e-10   
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1       67.8    9e-10   
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg              67.8    1e-09   
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  67.8    1e-09   
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-09   
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...  67.8    1e-09   
ref|XP_004295585.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-09   
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-09   
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-09   
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  67.8    1e-09   
ref|XP_010494725.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-09   
emb|CDY39211.1|  BnaA03g50230D                                        67.4    1e-09   
ref|XP_010494726.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-09   
emb|CDX72249.1|  BnaC07g42710D                                        67.8    1e-09   
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  64.7    1e-09   
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...  67.4    2e-09   
emb|CDP02874.1|  unnamed protein product                              67.4    2e-09   
ref|XP_006295562.1|  hypothetical protein CARUB_v10024669mg           67.0    2e-09   
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...  67.4    2e-09   
ref|XP_004507770.1|  PREDICTED: probable LRR receptor-like serine...  67.0    2e-09   
gb|ADD60668.1|  putative somatic embryogenesis receptor kinase 1      64.3    2e-09   
ref|XP_010481533.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-09   
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  66.6    2e-09   
ref|XP_010481531.1|  PREDICTED: probable LRR receptor-like serine...  66.6    3e-09   
ref|XP_010481532.1|  PREDICTED: probable LRR receptor-like serine...  66.6    3e-09   
gb|KJB53859.1|  hypothetical protein B456_009G008400                  66.6    3e-09   
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      66.2    3e-09   
ref|XP_011069822.1|  PREDICTED: probable LRR receptor-like serine...  66.2    3e-09   
gb|KCW86417.1|  hypothetical protein EUGRSUZ_B03087                   65.9    4e-09   
gb|EAZ07144.1|  hypothetical protein OsI_29394                        66.2    4e-09   
ref|NP_179973.2|  leucine-rich repeat protein kinase family protein   66.2    4e-09   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...  66.2    4e-09   
ref|XP_011085975.1|  PREDICTED: probable LRR receptor-like serine...  65.9    4e-09   
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...  65.9    4e-09   
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...  66.2    4e-09   
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg              65.9    4e-09   
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...  65.9    5e-09   
ref|XP_002436858.1|  hypothetical protein SORBIDRAFT_10g010020        63.2    5e-09   
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                  65.9    5e-09   
gb|EMT29112.1|  Putative LRR receptor-like serine/threonine-prote...  65.5    5e-09   
ref|XP_011079354.1|  PREDICTED: probable LRR receptor-like serine...  65.5    6e-09   
gb|KHG07759.1|  hypothetical protein F383_34545                       65.5    6e-09   
ref|XP_010687666.1|  PREDICTED: probable LRR receptor-like serine...  65.5    7e-09   
ref|XP_010687665.1|  PREDICTED: probable LRR receptor-like serine...  65.5    7e-09   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820        65.5    7e-09   
dbj|BAJ91470.1|  predicted protein                                    65.1    8e-09   
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...  65.1    8e-09   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...  64.7    1e-08   
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g           64.7    1e-08   
gb|KJB76637.1|  hypothetical protein B456_012G097800                  64.3    1e-08   
gb|KJB76636.1|  hypothetical protein B456_012G097800                  64.3    1e-08   



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/82 (98%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MEREWFL FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN
Sbjct  1    MEREWFLPFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  60

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCSPDGYVSALG
Sbjct  61   SVDPCSWRMVTCSPDGYVSALG  82



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDV  634
            MER  FL +KV   G+ +L    CS +TLSPSGVNYEVVALIAIK  L DPYNVLENWD 
Sbjct  1    MERGKFLFWKV---GLLVLAMVECSYSTLSPSGVNYEVVALIAIKNDLRDPYNVLENWDA  57

Query  635  NSVXPCSWRMVTCSPDGYVSALG  703
            NSV PCSWRMVTCS DGYVSALG
Sbjct  58   NSVDPCSWRMVTCSQDGYVSALG  80



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M+R   +LF+ LGL +  L+  S SATLSP+G+N+EVVAL+AIK  LHDPYNVLENWD+N
Sbjct  1    MDRRSLMLFR-LGLLVLALMGIS-SATLSPTGINFEVVALMAIKYNLHDPYNVLENWDMN  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVSALG
Sbjct  59   SVDPCSWRMVTCSTDGYVSALG  80



>gb|KJB61042.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
 gb|KJB61044.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=391

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+ DGYVSALG
Sbjct  59   SVDPCSWRMVTCTADGYVSALG  80



>gb|KJB61043.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=536

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+ DGYVSALG
Sbjct  59   SVDPCSWRMVTCTADGYVSALG  80



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+ DGYVSALG
Sbjct  59   SVDPCSWRMVTCTADGYVSALG  80



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+ DGYVSALG
Sbjct  59   SVDPCSWRMVTCTADGYVSALG  80



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME     L+KV GL +W L+  S SATLSP+G+NYEVVAL+ IKT LHDPYNVLE+WD+N
Sbjct  1    MEGRSLWLWKV-GLVVWALMEIS-SATLSPTGINYEVVALVNIKTALHDPYNVLESWDIN  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVSALG
Sbjct  59   SVDPCSWRMVTCSSDGYVSALG  80



>gb|KDO82336.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=391

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRM+TCSPDGYVSALG
Sbjct  59   SVDPCSWRMITCSPDGYVSALG  80



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 6/82 (7%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MER+W +   V+ L        SC A+LSP+G+NYEVVALI IK  LHDPYNVLENWDV 
Sbjct  1    MERKWCMFLYVVAL------MESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVT  54

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVS+LG
Sbjct  55   SVDPCSWRMVTCSNDGYVSSLG  76



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 6/82 (7%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MER+W +   V+ L        SC A+LSP+G+NYEVVALI IK  LHDPYNVLENWDV 
Sbjct  1    MERKWCMFLYVVAL------MESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVT  54

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVS+LG
Sbjct  55   SVDPCSWRMVTCSNDGYVSSLG  76



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  533  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +TLSPSGVNYEVVALIAIK+ LHDPYNVLENWD NSV PCSWRMVTCSPDGYVSALG
Sbjct  24   STLSPSGVNYEVVALIAIKSDLHDPYNVLENWDANSVDPCSWRMVTCSPDGYVSALG  80



>gb|KDO82335.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=540

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRM+TCSPDGYVSALG
Sbjct  59   SVDPCSWRMITCSPDGYVSALG  80



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRM+TCSPDGYVSALG
Sbjct  59   SVDPCSWRMITCSPDGYVSALG  80



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRM+TCSPDGYVSALG
Sbjct  59   SVDPCSWRMITCSPDGYVSALG  80



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRM+TCSPDGYVSALG
Sbjct  59   SVDPCSWRMITCSPDGYVSALG  80



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M+R+W +   V+     + +  SC A+LSP+G+NYEVVALI IK  LHDPYNVLENWDV 
Sbjct  1    MDRKWCMFLYVV-----LTLMESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVT  55

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVS+LG
Sbjct  56   SVDPCSWRMVTCSNDGYVSSLG  77



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+AIK  LHDPYNVLENWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  21   SSSATLSPSGINYEVVALMAIKMELHDPYNVLENWDINSVDPCSWRMVTCSADGYVSALG  80



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 61/79 (77%), Gaps = 6/79 (8%)
 Frame = +2

Query  485  KVLGLGIWMLI------ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVX  646
            +VLG   WML           +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NSV 
Sbjct  4    RVLGFAFWMLGLLLWAWPEMAAATLSPSGINYEVVALMAIKMELNDPYNVLENWDINSVD  63

Query  647  PCSWRMVTCSPDGYVSALG  703
            PCSWRMVTCS DGYVSALG
Sbjct  64   PCSWRMVTCSADGYVSALG  82



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = +2

Query  464  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  643
            R  F L +V+ L +  L+  S +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV
Sbjct  4    RRSFRLCRVVFL-VLALMEIS-TATLSPAGINYEVVALVAIKTALRDPYNVLDNWDINSV  61

Query  644  XPCSWRMVTCSPDGYVSALG  703
             PCSWRMVTC+PDGYVSALG
Sbjct  62   DPCSWRMVTCTPDGYVSALG  81



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+AIK  LHDPYNVLENWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  21   SSSATLSPSGINYEVVALMAIKMELHDPYNVLENWDINSVDPCSWRMVTCSADGYVSALG  80



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSP+G+N+EVVAL+AIKT L DPYNVLENWD+NSV PCSWRMVTCSPDGYVSALG
Sbjct  24   SATLSPTGINFEVVALMAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALG  81



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSP+G+N+EVVAL+AIKT L DPYNVLENWD+NSV PCSWRMVTCSPDGYVSALG
Sbjct  24   SATLSPTGINFEVVALMAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALG  81



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +++ +  + SATLSP+G+NYEVVAL+AIKT L+DP+NVLENWDVNSV PCSWRMVTC+ D
Sbjct  25   VFLALLQASSATLSPTGINYEVVALVAIKTALNDPHNVLENWDVNSVDPCSWRMVTCTSD  84

Query  683  GYVSALG  703
            GYVSALG
Sbjct  85   GYVSALG  91



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R  F L+K LGL +  L+  + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSTFTLWK-LGLLVLALVE-AASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWDSN  65

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+PDGYVSALG
Sbjct  66   SVDPCSWRMVTCTPDGYVSALG  87



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R  F L+K LGL +  L+  + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSTFTLWK-LGLLVLALVE-AASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWDSN  65

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+PDGYVSALG
Sbjct  66   SVDPCSWRMVTCTPDGYVSALG  87



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R  F L+K LGL +  L+  + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSTFTLWK-LGLLVLALVE-AASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWDSN  65

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+PDGYVSALG
Sbjct  66   SVDPCSWRMVTCTPDGYVSALG  87



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  479  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSW  658
            LF  +GL ++  +  S SATLSP+GVNYEVVAL  IK  LHDPYNVL+NWDVNSV PCSW
Sbjct  4    LFWNVGLLLFCTLMESSSATLSPAGVNYEVVALTEIKKALHDPYNVLDNWDVNSVDPCSW  63

Query  659  RMVTCSPDGYVSALG  703
            RMVTCS DGYVSAL 
Sbjct  64   RMVTCSLDGYVSALA  78



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R  F+L K LGL + + +A + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSNFMLCK-LGL-LVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLENWDSN  65

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+PDGYVSALG
Sbjct  66   SVDPCSWRMVTCTPDGYVSALG  87



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R  F+L K LGL + + +A + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSNFMLCK-LGL-LVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLENWDSN  65

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+PDGYVSALG
Sbjct  66   SVDPCSWRMVTCTPDGYVSALG  87



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R  F+L K LGL + + +A + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSNFMLCK-LGL-LVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLENWDSN  65

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTC+PDGYVSALG
Sbjct  66   SVDPCSWRMVTCTPDGYVSALG  87



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME +W +L+ V GL +  L+  SC A+LSP+G+NYEVVAL  IK  LHDPYNVLENWDV 
Sbjct  1    MEGKWCMLWYV-GLLVLTLME-SCYASLSPTGINYEVVALTEIKKALHDPYNVLENWDVT  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVSALG
Sbjct  59   SVDPCSWRMVTCSIDGYVSALG  80



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 61/79 (77%), Gaps = 6/79 (8%)
 Frame = +2

Query  485  KVLGLGIWMLI------ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVX  646
            +VLG   WML           +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NSV 
Sbjct  4    RVLGFPFWMLGLLLWAWPELPAATLSPSGINYEVVALMAIKMELNDPYNVLENWDINSVD  63

Query  647  PCSWRMVTCSPDGYVSALG  703
            PCSWRMVTCS DGYVSALG
Sbjct  64   PCSWRMVTCSADGYVSALG  82



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 3/73 (4%)
 Frame = +2

Query  494  GLGIWMLI---ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRM  664
            G+G+ +L+       +ATLSPSGVNYEVVAL+AIK  L+DPYNVLENWD+NSV PCSWRM
Sbjct  9    GVGLVLLVLAWMEGSAATLSPSGVNYEVVALMAIKNDLNDPYNVLENWDINSVDPCSWRM  68

Query  665  VTCSPDGYVSALG  703
            VTCS DGYVSALG
Sbjct  69   VTCSADGYVSALG  81



>dbj|BAD68256.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
Length=418

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  512  LIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYV  691
            ++  S +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV PCSWRMVTCS DGYV
Sbjct  17   ILLPSSTATLSPAGINYEVVALMAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYV  76

Query  692  SALG  703
            SALG
Sbjct  77   SALG  80



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 64/88 (73%), Gaps = 12/88 (14%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLI------ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVL  619
            MER      +V G   WML         + +ATLSPSG+NYEVVAL+AIK  L+DPYNVL
Sbjct  1    MER------RVSGFSFWMLGLLLWAGPLASAATLSPSGINYEVVALMAIKMELNDPYNVL  54

Query  620  ENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            ENWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  55   ENWDINSVDPCSWRMVTCSVDGYVSALG  82



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  476  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCS  655
            LL+ V  L I  L+  S SATLSP+G+NYEVVAL  IK  LHDPYNVL+NWDVNSV PCS
Sbjct  4    LLWNVGLLLICTLMMESSSATLSPTGINYEVVALTEIKKALHDPYNVLDNWDVNSVDPCS  63

Query  656  WRMVTCSPDGYVSALG  703
            WRMVTCS DGYVSAL 
Sbjct  64   WRMVTCSFDGYVSALA  79



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  21   SSTATLSPAGINYEVVALMAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYVSALG  80



>gb|EPS59440.1| hypothetical protein M569_15369 [Genlisea aurea]
Length=82

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query  464  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  643
            R+  LL +  GL I  L    C + LSPSGVNYEVVALI +K  LHDPYN LE+WD NSV
Sbjct  5    RKNSLLLRT-GLVILALFTGCCYSYLSPSGVNYEVVALIMVKRELHDPYNALESWDANSV  63

Query  644  XPCSWRMVTCSPDGYVSAL  700
             PCSWRM+TC+ DGYVS+L
Sbjct  64   DPCSWRMITCTTDGYVSSL  82



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSPSG+NYEVVAL+ IK  L+DPYNVLENWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  23   SATLSPSGINYEVVALMTIKNNLNDPYNVLENWDINSVDPCSWRMVTCSSDGYVSALG  80



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSPSG+NYEVVAL+ IK  L+DPYNVLENWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  5    SATLSPSGINYEVVALMTIKNNLNDPYNVLENWDINSVDPCSWRMVTCSSDGYVSALG  62



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  509  MLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGY  688
            +++A + SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSV PCSWRMVTC+PDGY
Sbjct  19   LVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPCSWRMVTCTPDGY  78

Query  689  VSALG  703
            VSALG
Sbjct  79   VSALG  83



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  509  MLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGY  688
            +++A + SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSV PCSWRMVTC+PDGY
Sbjct  19   LVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPCSWRMVTCTPDGY  78

Query  689  VSALG  703
            VSALG
Sbjct  79   VSALG  83



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 3/81 (4%)
 Frame = +2

Query  464  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYE-VVALIAIKTGLHDPYNVLENWDVNS  640
            R  F L +V+ L +  L+  S +ATLSP+G+NYE VVAL+AIKT L DPYNVL+NWD+NS
Sbjct  4    RRSFRLCRVVFL-VLALMEIS-TATLSPAGINYEAVVALVAIKTALRDPYNVLDNWDINS  61

Query  641  VXPCSWRMVTCSPDGYVSALG  703
            V PCSWRMVTC+PDGYVSALG
Sbjct  62   VDPCSWRMVTCTPDGYVSALG  82



>ref|XP_008654537.1| PREDICTED: uncharacterized LOC100272802 isoform X1 [Zea mays]
 gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  515  IATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVS  694
            I  S  ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV PCSWRMVTCS DGYVS
Sbjct  17   ILPSSDATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPCSWRMVTCSSDGYVS  76

Query  695  ALG  703
            ALG
Sbjct  77   ALG  79



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME +W +L+ V GL +  L+ +S  A+LSP+G+NYEVVAL  IK  LHDPYNVLENWDV 
Sbjct  1    MEGKWCMLWYV-GLLVLTLMESSY-ASLSPTGINYEVVALTEIKKALHDPYNVLENWDVT  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVSALG
Sbjct  59   SVDPCSWRMVTCSLDGYVSALG  80



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME +W +L KV+ L +++L+ +S SA+LSP+G+NYEVVAL+AIK  L DPYNVLENWD N
Sbjct  1    MEMKWSVLGKVVLL-VFILVHSS-SASLSPTGINYEVVALMAIKNDLKDPYNVLENWDTN  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            +V PCSW  VTCSPDG VSALG
Sbjct  59   AVDPCSWTRVTCSPDGSVSALG  80



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SCSA+LSP+GVNYEV+AL+AIKT LHDPYNVLE WDV SV PCSWRMVTC+ DG+VS+LG
Sbjct  16   SCSASLSPAGVNYEVMALMAIKTALHDPYNVLEGWDVTSVDPCSWRMVTCTGDGFVSSLG  75



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +2

Query  482  FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWR  661
            F +LGL +W     S +ATLSPSG+NYEVVAL+AI+  L+DPYNVLENWD+NSV PCSWR
Sbjct  24   FWMLGLLLWAGPLVS-AATLSPSGINYEVVALMAIRMELNDPYNVLENWDINSVDPCSWR  82

Query  662  MVTCSPDGYVSALG  703
            MVTCS DGYVSA+G
Sbjct  83   MVTCSADGYVSAIG  96



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +2

Query  482  FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWR  661
            F +LGL +W     S +ATLSPSG+NYEVVAL+AI+  L+DPYNVLENWD+NSV PCSWR
Sbjct  24   FWMLGLLLWAGPLVS-AATLSPSGINYEVVALMAIRMELNDPYNVLENWDINSVDPCSWR  82

Query  662  MVTCSPDGYVSALG  703
            MVTCS DGYVSA+G
Sbjct  83   MVTCSADGYVSAIG  96



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MER   L + V+ L    LI +S SATLSP+GVNYEVVAL  IK  LHDPYNVL+NWDV 
Sbjct  1    MERMLHLFWNVVLLLFCTLIESS-SATLSPAGVNYEVVALTEIKKALHDPYNVLDNWDVT  59

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS +GYVSAL 
Sbjct  60   SVDPCSWRMVTCSLEGYVSALA  81



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            ++ ++  + SATLSP+GVNYEVVAL+AIK  L DPY+ LENWD+NSV PCSWRM+TCS D
Sbjct  11   LFFILVGAASATLSPTGVNYEVVALMAIKNELKDPYDALENWDINSVDPCSWRMITCSSD  70

Query  683  GYVSALG  703
            GYVSALG
Sbjct  71   GYVSALG  77



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +2

Query  500  GIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSP  679
            G+  +I    +ATLSP+G+NYEVVAL+AIKT L DP+NVL+NWD+NSV PCSWRMVTCS 
Sbjct  18   GLLAVILPPSTATLSPAGINYEVVALMAIKTELEDPHNVLDNWDINSVDPCSWRMVTCSS  77

Query  680  DGYVSALG  703
            DGYVSALG
Sbjct  78   DGYVSALG  85



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  512  LIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYV  691
            +I    +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV PCSWRMVTCS DGYV
Sbjct  23   VILPPSNATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPCSWRMVTCSSDGYV  82

Query  692  SALG  703
            SALG
Sbjct  83   SALG  86



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NSV PCSWRMVTC+ DGYVSALG
Sbjct  56   AATLSPSGINYEVVALVAIKMELNDPYNVLENWDINSVDPCSWRMVTCTSDGYVSALG  113



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NSV PCSWRMVTC+ DGYVSALG
Sbjct  56   AATLSPSGINYEVVALVAIKMELNDPYNVLENWDINSVDPCSWRMVTCTSDGYVSALG  113



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  29   NATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPCSWRMVTCSSDGYVSALG  86



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  500  GIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSP  679
            G+  L+    +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSV PCSWRMVTCS 
Sbjct  16   GVLCLLLPPAAATLSPTGINYEVVALMAIKTDLQDHYNVLDNWDINSVDPCSWRMVTCSS  75

Query  680  DGYVSALG  703
            DGYVSALG
Sbjct  76   DGYVSALG  83



>ref|XP_009797107.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana sylvestris]
Length=520

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R   LL+ V  L I  L+  S  ATLSP+G+NYEVVAL  IK  LHDPYNVL+NWDVN
Sbjct  8    MGRMLHLLWNVGLLLICTLMENSF-ATLSPTGINYEVVALTEIKKALHDPYNVLDNWDVN  66

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS DGYVSAL 
Sbjct  67   SVDPCSWRMVTCSFDGYVSALA  88



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK GL DP+NVLENWD+NSV PCSWRM+TCSPDG VS LG
Sbjct  23   SAALSPSGINYEVVALMAIKNGLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSVLG  80



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK GL DP+NVLENWD+NSV PCSWRM+TCSPDG VS LG
Sbjct  23   SAALSPSGINYEVVALMAIKNGLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSVLG  80



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W L  +S  ATLSP+GVNYEV AL+AIK  L+DPYNVLENWDVNSV P
Sbjct  9    WRLGFLVL---VWFLDVSS--ATLSPTGVNYEVTALVAIKNELNDPYNVLENWDVNSVDP  63

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVSALG
Sbjct  64   CSWRMVTCT-DGYVSALG  80



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = +2

Query  473  FLLFKVLGLGIWMLIA-TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            F+L+KV   G+ +L +  + SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSV P
Sbjct  36   FMLWKV---GLLLLASIEASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDP  92

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVSALG
Sbjct  93   CSWRMVTCTADGYVSALG  110



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = +2

Query  473  FLLFKVLGLGIWMLIA-TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            F+L+KV   G+ +L +  + SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSV P
Sbjct  36   FMLWKV---GLLLLASIEASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDP  92

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVSALG
Sbjct  93   CSWRMVTCTADGYVSALG  110



>gb|ACM89541.1| leucine-rich repeat receptor-like kinase [Glycine max]
Length=515

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSV PCSWRM+TCSPDG VSALG
Sbjct  5    SAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSALG  62



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
             SATLSPSGVN+EVVAL+AIK  L DP+NVLENWD NSV PCSWRMVTCSPDGYVS LG
Sbjct  21   ASATLSPSGVNFEVVALMAIKYDLLDPHNVLENWDSNSVDPCSWRMVTCSPDGYVSVLG  79



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSV PCSWRM+TCSPDG VSALG
Sbjct  24   SAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSALG  81



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSV PCSWRM+TCSPDG VSALG
Sbjct  24   SAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSALG  81



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W    T+  ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSV P
Sbjct  9    WRLGFLVL---VWFPDVTT--ATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDP  63

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVSALG
Sbjct  64   CSWRMVTCT-DGYVSALG  80



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 2/58 (3%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSP+G+N+E  AL+AIKT L DPYNVLENWD+NSV PCSWRMVTCSPDGYVSALG
Sbjct  24   SATLSPTGINFE--ALVAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALG  79



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 2/58 (3%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSP+G+N+E  AL+AIKT L DPYNVLENWD+NSV PCSWRMVTCSPDGYVSALG
Sbjct  24   SATLSPTGINFE--ALVAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALG  79



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S  ATLSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSV PCSWRMVTCS DGYVS+LG
Sbjct  22   SSFATLSPSGINYEVVALMAIKNDLVDPHNVLENWDMNSVDPCSWRMVTCSADGYVSSLG  81



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALG  82



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALG  82



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALG  82



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = +2

Query  500  GIWMLIAT---SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVT  670
            G+ +L+ +     SATLSPSG+NYEV AL+ IKTGL DP+NVL+NWD  SV PC WRM+T
Sbjct  9    GVGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDPHNVLDNWDSTSVDPCGWRMIT  68

Query  671  CSPDGYVSALG  703
            CSPDGYVS+LG
Sbjct  69   CSPDGYVSSLG  79



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALG  82



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = +2

Query  500  GIWMLIAT---SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVT  670
            G+ +L+ +     SATLSPSG+NYEV AL+ IKTGL DP+NVL+NWD  SV PC WRM+T
Sbjct  9    GVGLLVLSWIEESSATLSPSGINYEVEALVNIKTGLRDPHNVLDNWDSTSVDPCGWRMIT  68

Query  671  CSPDGYVSALG  703
            CSPDGYVS+LG
Sbjct  69   CSPDGYVSSLG  79



>gb|EPS73511.1| hypothetical protein M569_01245, partial [Genlisea aurea]
Length=636

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  533  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +TLSPSGVNYEVVALI+IK  L+DPYN LE+WDVNSV PCSWR VTCSPDG+VSALG
Sbjct  1    STLSPSGVNYEVVALISIKGSLNDPYNALESWDVNSVDPCSWRTVTCSPDGFVSALG  57



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK  L+DP+NVLENWD+N V PCSWRM+TC+PDG VSALG
Sbjct  23   SAALSPSGINYEVVALMAIKNDLNDPHNVLENWDINYVDPCSWRMITCTPDGSVSALG  80



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W    T+  ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSV P
Sbjct  9    WRLGFLVL---VWFHDVTT--ATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDP  63

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVS LG
Sbjct  64   CSWRMVTCT-DGYVSTLG  80



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W    T+  ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSV P
Sbjct  9    WRLGFLVL---VWFHDVTT--ATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDP  63

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVS LG
Sbjct  64   CSWRMVTCT-DGYVSTLG  80



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W    T+  ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSV P
Sbjct  9    WRLGFLVL---VWFHDVTT--ATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDP  63

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVS LG
Sbjct  64   CSWRMVTCT-DGYVSTLG  80



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W    T+  ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSV P
Sbjct  9    WRLGFLVL---VWFHDVTT--ATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDP  63

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMVTC+ DGYVS LG
Sbjct  64   CSWRMVTCT-DGYVSTLG  80



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK  L+DP+NVLE+WD+NSV PCSWRM+TC+PDG VSALG
Sbjct  23   SAALSPSGINYEVVALMAIKNELNDPHNVLESWDINSVDPCSWRMITCNPDGSVSALG  80



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME   F+L++ LG  + +L+    +ATLSPSG+NYEVVAL+AIK+ L+DPYNVLENWDVN
Sbjct  1    MEGVRFVLWR-LGFLVLVLLLDVSAATLSPSGINYEVVALMAIKSELNDPYNVLENWDVN  59

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSWRMVTCS  GYVS+LG
Sbjct  60   SVDPCSWRMVTCSY-GYVSSLG  80



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  536  TLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            TLSPSGVN+EVVAL+AIK  L DP+NVLENWD NSV PCSWRMVTCSPDGYVS LG
Sbjct  24   TLSPSGVNFEVVALMAIKYDLLDPHNVLENWDSNSVDPCSWRMVTCSPDGYVSVLG  79



>gb|KCW86694.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=479

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>ref|XP_010044596.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Eucalyptus 
grandis]
Length=626

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>ref|XP_010044595.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Eucalyptus 
grandis]
Length=626

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>ref|XP_010044594.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Eucalyptus 
grandis]
Length=627

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>gb|KCW86687.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
 gb|KCW86688.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>ref|XP_010044597.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X4 [Eucalyptus 
grandis]
Length=625

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>ref|XP_010044598.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X5 [Eucalyptus 
grandis]
Length=624

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>ref|XP_010044599.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X6 [Eucalyptus 
grandis]
Length=578

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>gb|KCW86689.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=598

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>gb|KCW86693.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>gb|KCW86692.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>gb|KCW86691.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=625

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>gb|KCW86690.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SV PC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W+   ++  ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSV P
Sbjct  11   WRLGFLVL---VWLFDVST--ATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDP  65

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMV+C+ DGYVS LG
Sbjct  66   CSWRMVSCT-DGYVSMLG  82



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 6/78 (8%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXP  649
            W L F VL   +W+   ++  ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSV P
Sbjct  11   WRLGFLVL---VWLFDVST--ATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDP  65

Query  650  CSWRMVTCSPDGYVSALG  703
            CSWRMV+C+ DGYVS LG
Sbjct  66   CSWRMVSCT-DGYVSMLG  82



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSV PCSWRMV+C+ DGYVS LG
Sbjct  26   SATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLG  82



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSV PCSWRMV+C+ DGYVS LG
Sbjct  26   SATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLG  82



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 3/66 (5%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +W+L  ++  ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSV PCSWRMVTC+ D
Sbjct  12   VWLLDVST--ATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVTCT-D  68

Query  683  GYVSAL  700
            GYVS L
Sbjct  69   GYVSGL  74



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSV PCSWRMV+C+ DGYVS LG
Sbjct  26   TATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLG  82



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSV PCSWRMV+C+ DGYVS LG
Sbjct  26   TATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLG  82



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD +SV PCSWRM+TCS DG VSALG
Sbjct  23   SAALSPSGINYEVVALMAIKGALTDPHNVLENWDSSSVDPCSWRMITCSSDGSVSALG  80



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +W L  +S  ATLSP+GVNYEV AL+A+K  L+DP NVL NWDVNSV PCSWRMVTC+ D
Sbjct  17   VWFLDVSS--ATLSPTGVNYEVTALVAVKNELNDPDNVLANWDVNSVDPCSWRMVTCT-D  73

Query  683  GYVSALG  703
            GYVSALG
Sbjct  74   GYVSALG  80



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME   F++++ LG  +++      SATLSP+GVNYEV AL+A+K  L+DPY VLENWDVN
Sbjct  1    MEGVRFVVWR-LGFLVFVWFFDISSATLSPTGVNYEVTALVAVKNELNDPYKVLENWDVN  59

Query  638  SVXPCSWRMVTCSPDGYVSAL  700
            SV PCSWRMV+C+ DGYVS+L
Sbjct  60   SVDPCSWRMVSCT-DGYVSSL  79



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME   F++++ LG  +++      SATLSP+GVNYEV AL+A+K  L+DPY VLENWDVN
Sbjct  1    MEGVRFVVWR-LGFLVFVWFFDISSATLSPTGVNYEVTALVAVKNELNDPYKVLENWDVN  59

Query  638  SVXPCSWRMVTCSPDGYVSAL  700
            SV PCSWRMV+C+ DGYVS+L
Sbjct  60   SVDPCSWRMVSCT-DGYVSSL  79



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 6/71 (8%)
 Frame = +2

Query  491  LGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVT  670
            +GL +  L+  S SATLSP+     VVAL  IK+ LHDPYNVLE+WD NSV PCSWRMVT
Sbjct  8    VGLLVLTLVEIS-SATLSPT-----VVALANIKSALHDPYNVLESWDANSVDPCSWRMVT  61

Query  671  CSPDGYVSALG  703
            CSPDGYV+ALG
Sbjct  62   CSPDGYVTALG  72



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++V PCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  683  GYVSALG  703
              V  LG
Sbjct  77   SLVIGLG  83



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++V PCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  683  GYVSALG  703
              V  LG
Sbjct  77   SLVIGLG  83



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++V PCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  683  GYVSALG  703
              V  LG
Sbjct  77   SLVIGLG  83



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++V PCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  683  GYVSALG  703
              V  LG
Sbjct  77   SLVIGLG  83



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            ++L+  S +A LSP GVN+EV AL+ IK  LHDP+ VLE+WD ++V PCSW MVTCS D 
Sbjct  21   FLLLLGSANALLSPQGVNFEVQALMDIKASLHDPHGVLESWDRDAVDPCSWTMVTCSSDN  80

Query  686  YVSALG  703
            +V +LG
Sbjct  81   FVISLG  86



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            ++L+  S +A LSP GVN+EV AL+ IK  LHDP+ VLE+WD ++V PCSW MVTCS D 
Sbjct  21   FLLLLGSANALLSPQGVNFEVQALMDIKASLHDPHGVLESWDRDAVDPCSWTMVTCSSDN  80

Query  686  YVSALG  703
            +V +LG
Sbjct  81   FVISLG  86



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S +A LSP GVN+EV AL+ IK  L DP+NVLENWD +SV PCSW MVTCSP   V+ LG
Sbjct  21   SATAILSPKGVNFEVQALMGIKAFLKDPHNVLENWDKDSVDPCSWTMVTCSPQNLVTGLG  80



>gb|KDO70179.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=400

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSW +VTCS DG V+ LG
Sbjct  57   SVDPCSWALVTCS-DGLVTGLG  77



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +2

Query  503  IWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTC  673
             WM+      S +A LSP GVN+EV AL+ +K  L DP+NVLENWD +SV PCSW MVTC
Sbjct  11   FWMVFFWSWASATAILSPKGVNFEVQALMGLKAFLKDPHNVLENWDKDSVDPCSWTMVTC  70

Query  674  SPDGYVSALG  703
            SP   V+ LG
Sbjct  71   SPQNLVTGLG  80



>ref|XP_002871697.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47956.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata]
Length=638

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  497  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            LG   L+++S    LSP G+N+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS
Sbjct  19   LGFLCLLSSSVDGLLSPKGINFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  78

Query  677  PDGYVSALG  703
             + +V  LG
Sbjct  79   SENFVIGLG  87



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSW +VTCS DG V+ LG
Sbjct  57   SVDPCSWALVTCS-DGLVTGLG  77



>gb|KDO70178.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=517

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSW +VTCS DG V+ LG
Sbjct  57   SVDPCSWALVTCS-DGLVTGLG  77



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSW +VTCS DG V+ LG
Sbjct  57   SVDPCSWALVTCS-DGLVTGLG  77



>ref|XP_010453748.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Camelina sativa]
Length=639

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  497  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            LG+ + + +S +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS
Sbjct  19   LGLLLCVLSSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  78

Query  677  PDGYVSALG  703
             + +V  LG
Sbjct  79   SENFVIGLG  87



>gb|AFW73242.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=80

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +2

Query  497  LGIWMLIATSC---SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            L + +L   SC   S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SV PCSW MV
Sbjct  10   LALVLLFFCSCGPASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMV  69

Query  668  TCSPDGYVSAL  700
            TCSP+  V+ L
Sbjct  70   TCSPENLVTGL  80



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            +S SA L+  GVN+EV+ALI IK+ L DP+ VL+NWD  +V PCSW M+TCSPDG+V +L
Sbjct  28   SSSSAELTDKGVNFEVLALIGIKSSLVDPHGVLQNWDDTAVDPCSWNMITCSPDGFVLSL  87

Query  701  G  703
            G
Sbjct  88   G  88



>ref|XP_010492459.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Camelina sativa]
Length=640

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +2

Query  497  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            LG+  L+ +S +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS
Sbjct  21   LGLLCLL-SSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  79

Query  677  PDGYVSALG  703
            P+ +V  LG
Sbjct  80   PENFVIGLG  88



>ref|XP_010927979.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Elaeis 
guineensis]
Length=591

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S +  LSP GVN+EV ALI IK  L DP++VLENWD +SV PCSW MVTCSPD  V +LG
Sbjct  32   SAAGLLSPKGVNFEVQALIDIKVSLKDPHSVLENWDQDSVDPCSWAMVTCSPDNLVISLG  91



>ref|NP_197104.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
 sp|Q9LFS4.1|NIK1_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 1; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC01799.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL66960.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAN86199.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59368.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92233.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
Length=638

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  497  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            LG   L+ +S    LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS
Sbjct  19   LGFLCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  78

Query  677  PDGYVSALG  703
             + +V  LG
Sbjct  79   SENFVIGLG  87



>gb|AAM65586.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=629

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  497  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            LG   L+ +S    LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS
Sbjct  10   LGFLCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  69

Query  677  PDGYVSALG  703
             + +V  LG
Sbjct  70   SENFVIGLG  78



>dbj|BAG93736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
             SA LSP GVNYEV AL+ IKT L DP+ VL+NWD +SV PCSW MVTCSP+  V+ L
Sbjct  25   ASALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGL  82



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            LSP GVNYEV AL+AIK  LHDP+ VL+NWD ++V PCSW MVTCSP+  V  LG
Sbjct  26   LSPKGVNYEVQALMAIKDALHDPHGVLDNWDADAVDPCSWAMVTCSPESLVIGLG  80



>gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            LSP GVNYEVVAL++IK  LHDP+NVL NWD  +V PCSW M+TCSPDG V+ LG
Sbjct  26   LSPKGVNYEVVALMSIKGLLHDPHNVL-NWDETAVDPCSWTMITCSPDGLVTGLG  79



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S +  LSP GVN+EV ALI IK  L DP++VLENWD +SV PCSW MVTCSPD  V +LG
Sbjct  32   SAAGLLSPKGVNFEVQALIDIKVSLKDPHSVLENWDQDSVDPCSWAMVTCSPDNLVISLG  91



>ref|XP_008807034.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Phoenix 
dactylifera]
Length=604

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S +  LSP GVN+EV AL+ IK  L DP++VLENWD +SV PCSW MVTCSPD  V +LG
Sbjct  21   SAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDQDSVDPCSWTMVTCSPDNLVISLG  80



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +2

Query  473  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPC  652
            + LF ++ L  W+    S +  LSP GVNYEV AL+ +K  L DP++VLENWD +SV PC
Sbjct  29   YELFALVFLFSWV----SAAGVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPC  84

Query  653  SWRMVTCSPDGYVSALG  703
            SW MVTCSP+  V  LG
Sbjct  85   SWTMVTCSPENLVIGLG  101



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +2

Query  473  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPC  652
            + LF ++ L  W+    S +  LSP GVNYEV AL+ +K  L DP++VLENWD +SV PC
Sbjct  29   YELFALVFLFSWV----SAAGVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPC  84

Query  653  SWRMVTCSPDGYVSALG  703
            SW MVTCSP+  V  LG
Sbjct  85   SWTMVTCSPENLVIGLG  101



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S +  LSP GVN+EV AL+ IK  L DP++VLENWD +SV PCSW MVTCSPD  V +LG
Sbjct  21   SAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDQDSVDPCSWTMVTCSPDNLVISLG  80



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MER   +    L L     ++TS    LSP GVNYEV AL++IK  L DP++VL NWD +
Sbjct  1    MERRGDVALFCLAL---FFLSTSVVGLLSPKGVNYEVQALMSIKNSLMDPHSVLGNWDAD  57

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            +V PC+W MVTCS D +V+ALG
Sbjct  58   AVDPCNWAMVTCSSDHFVTALG  79



>gb|AFK34142.1| unknown [Medicago truncatula]
Length=110

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            +  L ++  + TS +  LS  GVNYEV ALI IK  L DP++ L NWD  SV PC+W M+
Sbjct  6    LFSLVLFFFMWTSVTGLLSSKGVNYEVQALIGIKNSLVDPHSALNNWDAESVDPCNWAMI  65

Query  668  TCSPDGYVSALG  703
            TCS D +V ALG
Sbjct  66   TCSSDRFVVALG  77



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            V  L IW+   +S +A LSP GVNYEV AL+ IK  L DP+ VLENWD ++V PCSW MV
Sbjct  14   VASLLIWV---SSINALLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMV  70

Query  668  TCSPDGYVSALG  703
            TCSP+  V  LG
Sbjct  71   TCSPESLVIGLG  82



>ref|XP_009418103.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  497  LGIWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            L +W+L      + +A LSP GVN+EV AL+ IK  L DP+ VLENWD +SV PCSW MV
Sbjct  9    LMLWVLFFWPWVTATAMLSPKGVNFEVQALMGIKASLEDPHGVLENWDQDSVDPCSWTMV  68

Query  668  TCSPDGYVSALG  703
            TCSP+  V  LG
Sbjct  69   TCSPENLVIGLG  80



>ref|XP_009418102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=623

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +2

Query  497  LGIWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            L +W+L      + +A LSP GVN+EV AL+ IK  L DP+ VLENWD +SV PCSW MV
Sbjct  9    LMLWVLFFWPWVTATAMLSPKGVNFEVQALMGIKASLEDPHGVLENWDQDSVDPCSWTMV  68

Query  668  TCSPDGYVSALG  703
            TCSP+  V  LG
Sbjct  69   TCSPENLVIGLG  80



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            LSP GVNYEV +L+AIK  LHDP+ VL+NWD ++V PCSW MVTCSP+  V  LG
Sbjct  31   LSPKGVNYEVQSLMAIKAALHDPHGVLDNWDADAVDPCSWAMVTCSPESLVIGLG  85



>ref|XP_006400129.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
 gb|ESQ41582.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
Length=637

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            ++ + +S +  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCSP+ 
Sbjct  21   FLCLLSSVNGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSPEN  80

Query  686  YVSALG  703
            +V+ LG
Sbjct  81   FVTGLG  86



>ref|XP_009417562.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
             +A LSP GVNYEV AL+ +K  L DP++VLENWD +SV PCSW MVTCSP+  V  LG
Sbjct  33   AAAVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGLG  91



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
             S +  LSP GVN+EV AL+ IK  LHDP+NVLENWD ++V PCSW MVTCS D  V  L
Sbjct  26   NSANGLLSPKGVNFEVQALMRIKDCLHDPHNVLENWDKDAVDPCSWTMVTCSTDSLVVGL  85

Query  701  G  703
            G
Sbjct  86   G  86



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
             + L+  S SA L+  GVNYEV+AL+ IK  L DP+ VL+NWD  +V PCSW MV+CSPD
Sbjct  21   FFFLLLGSSSAELTDKGVNYEVLALMGIKNSLVDPHEVLKNWDETAVDPCSWNMVSCSPD  80

Query  683  GYVSALG  703
            G V  LG
Sbjct  81   GLVITLG  87



>gb|EMT25229.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=737

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  566  VVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            VVAL+AIKT L D YNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  132  VVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALG  177



>ref|XP_009417563.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=542

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
             +A LSP GVNYEV AL+ +K  L DP++VLENWD +SV PCSW MVTCSP+  V  LG
Sbjct  33   AAAVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGLG  91



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
             SA LSP GVNYEV AL+ IKT L DP+ VL+NWD +SV PCSW MVTCSP+  V+ L
Sbjct  25   ASALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGL  82



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
             SA LSP GVNYEV AL+ IKT L DP+ VL+NWD +SV PCSW MVTCSP+  V+ L
Sbjct  25   ASALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGL  82



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  643
            RE F +  V  L  W    T+ +  LS  GVNYEV AL+ +K  LHDP+ VLENWD ++V
Sbjct  4    REVFAICFVAFLCFW----TTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAV  59

Query  644  XPCSWRMVTCSPDGYVSALG  703
             PCSW MVTCSP+  V  LG
Sbjct  60   DPCSWTMVTCSPESLVIGLG  79



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  643
            RE F +  V  L  W    T+ +  LS  GVNYEV AL+ +K  LHDP+ VLENWD ++V
Sbjct  4    REVFAICFVAFLCFW----TTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAV  59

Query  644  XPCSWRMVTCSPDGYVSALG  703
             PCSW MVTCSP+  V  LG
Sbjct  60   DPCSWTMVTCSPESLVIGLG  79



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  464  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  643
            RE F +  V  L  W    T+ +  LS  GVNYEV AL+ +K  LHDP+ VLENWD ++V
Sbjct  4    REVFAICFVAFLCFW----TTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAV  59

Query  644  XPCSWRMVTCSPDGYVSALG  703
             PCSW MVTCSP+  V  LG
Sbjct  60   DPCSWTMVTCSPESLVIGLG  79



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            TS +A LSP GVNYEV AL++IK  L DP++VL NWD ++V PC+W MVTCS D +V AL
Sbjct  19   TSVAALLSPKGVNYEVQALMSIKNSLVDPHSVLNNWDTDAVDPCNWAMVTCSSDHFVIAL  78

Query  701  G  703
            G
Sbjct  79   G  79



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            TS +A LSP GVNYEV AL++IK  L DP++VL NWD ++V PC+W MVTCS D +V AL
Sbjct  19   TSVAALLSPKGVNYEVQALMSIKNSLVDPHSVLNNWDTDAVDPCNWAMVTCSSDHFVIAL  78

Query  701  G  703
            G
Sbjct  79   G  79



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +2

Query  491  LGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVT  670
            L L +++    S +  LSP GVN+EV AL+ IK  L DP++VLENWD +SV PCSW MVT
Sbjct  21   LFLMVFLWTLASAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDRDSVDPCSWAMVT  80

Query  671  CSPDGYVSALG  703
            CSP+  V +LG
Sbjct  81   CSPENLVISLG  91



>ref|XP_010502426.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Camelina sativa]
Length=645

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA L+  GVNYEV+ALI IK+ L DP+ VL NWD  +V PCSW M+TCSPDG+V +LG
Sbjct  40   SAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCSPDGFVLSLG  97



>ref|XP_004173630.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like, partial [Cucumis 
sativus]
Length=393

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            +S +  LSP GVNYEV AL+ IK  L DP+ VLENWD ++V PCSW MVTCSP+  V  L
Sbjct  22   SSINGLLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMVTCSPESLVIGL  81

Query  701  G  703
            G
Sbjct  82   G  82



>ref|XP_006287253.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
 gb|EOA20151.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
Length=640

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +2

Query  521  TSCSAT--LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVS  694
            TSCS    LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS + +V 
Sbjct  27   TSCSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFVI  86

Query  695  ALG  703
             LG
Sbjct  87   GLG  89



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            V G  + +      +A L+P+GVNYEV AL+ IK  LHDP+NVL NWD +SV PCSW M+
Sbjct  9    VFGFLVLLSFLVYSNAMLTPAGVNYEVQALMEIKNSLHDPHNVL-NWDESSVDPCSWNMI  67

Query  668  TCSPDGYVSALG  703
            TCS D +V+ L 
Sbjct  68   TCSSDKFVTGLA  79



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            T+    L+ +GVNYEV AL+ IK  LHDP+N+L NWD ++V PCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  701  G  703
            G
Sbjct  80   G  80



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            T+    L+ +GVNYEV AL+ IK  LHDP+N+L NWD ++V PCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  701  G  703
            G
Sbjct  80   G  80



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            T+    L+ +GVNYEV AL+ IK  LHDP+N+L NWD ++V PCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  701  G  703
            G
Sbjct  80   G  80



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME++  +    L +  ++++ +S +  LSP GVN+EV AL+AIK  L DP+ VL+NWD  
Sbjct  1    MEKKREIKVAFLYVATFLVLWSSAAGLLSPKGVNFEVQALMAIKVALKDPHGVLDNWDST  60

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSW MVTCS +  V  LG
Sbjct  61   SVDPCSWAMVTCSSESLVIGLG  82



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            +S +  LSP GVNYEV AL+ IK  L DP+ VLENWD ++V PCSW MVTCSP+  V  L
Sbjct  22   SSINGLLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMVTCSPESLVIGL  81

Query  701  G  703
            G
Sbjct  82   G  82



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 41/56 (73%), Gaps = 12/56 (21%)
 Frame = +2

Query  536  TLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            TLSPSGVN+E            DP+NVLENWD NSV PCSWRMVTCSPDGYVS LG
Sbjct  24   TLSPSGVNFE------------DPHNVLENWDSNSVDPCSWRMVTCSPDGYVSVLG  67



>gb|EYU44266.1| hypothetical protein MIMGU_mgv1a002951mg [Erythranthe guttata]
Length=622

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            TS +A LSP GVN+EV AL+ IK GL DP+ VL+NWD ++V PCSW MVTCS +  V  L
Sbjct  17   TSAAALLSPKGVNFEVEALMGIKGGLRDPHGVLDNWDRDAVDPCSWTMVTCSSNNLVIGL  76

Query  701  G  703
            G
Sbjct  77   G  77



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  578  IAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +AIKT L DPYNVL+NWD+NSV PCSWRMVTCS DGYVSALG
Sbjct  1    MAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYVSALG  42



>emb|CDY48073.1| BnaA06g33550D [Brassica napus]
Length=640

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +2

Query  503  IWMLIATSCS--ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            ++  IA  CS  A L+  GVNYEV+ALI IK+ L DP+ VL NWD  +V PCSW M+TCS
Sbjct  28   LFFFIALLCSSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCS  87

Query  677  PDGYVSALG  703
             DG+V +LG
Sbjct  88   ADGFVLSLG  96



>gb|KHN07168.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=582

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MER   +    L L     + TS +A LSP GVNYEV AL+ I+  L DP++VL NWD +
Sbjct  1    MERRRDVALFCLAL---FFLWTSVAALLSPKGVNYEVQALMGIRNSLADPHSVLNNWDPD  57

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            +V PC+W MVTCS D +V ALG
Sbjct  58   AVDPCNWAMVTCSSDHFVIALG  79



>ref|XP_009152132.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Brassica rapa]
Length=652

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +2

Query  503  IWMLIATSCS--ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            ++  IA  CS  A L+  GVNYEV+ALI IK+ L DP+ VL NWD  +V PCSW M+TCS
Sbjct  19   LFFFIALLCSSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCS  78

Query  677  PDGYVSALG  703
             DG+V +LG
Sbjct  79   ADGFVLSLG  87



>ref|XP_006844161.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
 gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
Length=620

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S +A LSP GVN+EV AL+ IK  L DP +VLENWD +SV PCSW M+TCSP+  V  LG
Sbjct  18   SSTALLSPKGVNFEVQALMGIKQALKDPLSVLENWDGDSVDPCSWAMITCSPENLVIGLG  77



>ref|XP_010424117.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like, partial [Camelina 
sativa]
Length=493

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +2

Query  479  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSW  658
            +F  LGL   + + +S +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW
Sbjct  15   IFCFLGL---ICLLSSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSW  71

Query  659  RMVTCSPDGYVSALG  703
             MVTCS + +V  LG
Sbjct  72   TMVTCSSENFVIGLG  86



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MER   +    L L     + TS +A LSP GVNYEV AL+ I+  L DP++VL NWD +
Sbjct  1    MERRRDVALFCLAL---FFLWTSVAALLSPKGVNYEVQALMGIRNSLADPHSVLNNWDPD  57

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            +V PC+W MVTCS D +V ALG
Sbjct  58   AVDPCNWAMVTCSSDHFVIALG  79



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            ++ +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCSP+  V  L
Sbjct  20   STANGLLSPKGVNFEVQALMGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPESLVIGL  79

Query  701  G  703
            G
Sbjct  80   G  80



>ref|XP_010549936.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Tarenaya hassleriana]
 gb|ABD96874.1| hypothetical protein [Cleome spinosa]
Length=634

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +W+L   S SA LSP GVN+EV AL+ IK  L+DP+ VLE+WD ++V PCSW MVTCS +
Sbjct  23   LWLL--GSASALLSPQGVNFEVRALMDIKASLNDPHGVLESWDRDAVDPCSWTMVTCSSE  80

Query  683  GYVSALG  703
             +V +LG
Sbjct  81   NFVISLG  87



>ref|XP_006833053.1| hypothetical protein AMTR_s00170p00030060 [Amborella trichopoda]
 gb|ERM98331.1| hypothetical protein AMTR_s00170p00030060 [Amborella trichopoda]
Length=545

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            LSP GVNYEV AL+ +K+G+ D ++V E WD+NSV PC+W M+ CSP+G+V AL
Sbjct  29   LSPKGVNYEVAALMGVKSGMKDEFHVFEGWDINSVDPCTWAMIGCSPEGFVIAL  82



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +2

Query  503  IWMLIATS---CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTC  673
             WM+   S    +A LSP GVN+EV AL+ IK  L DP+NVLENWD +SV PCSW MVTC
Sbjct  11   FWMVFFWSWACAAAILSPKGVNFEVQALMGIKAFLKDPHNVLENWDKDSVDPCSWTMVTC  70

Query  674  SPDGYVSALG  703
            S    V+ LG
Sbjct  71   SSQKLVTTLG  80



>ref|XP_004236956.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Solanum lycopersicum]
Length=620

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            ++ L+A    A L+P+GVNYEV AL+ IK  L+DPYNVL NWD ++V PCSW M+TCS D
Sbjct  10   LFNLLAYYAHAMLTPAGVNYEVQALMEIKKNLNDPYNVL-NWDGDAVDPCSWNMITCSND  68

Query  683  GYVSAL  700
             +V++L
Sbjct  69   KFVTSL  74



>ref|XP_006395648.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
 gb|ESQ32934.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
Length=643

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            I + +  S  A L+  GVN+EV+ALI IK+ L DP+ VL NWD  +V PCSW M+TCSPD
Sbjct  30   IIIFLLCSSYAELTDKGVNFEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCSPD  89

Query  683  GYVSALG  703
            G+V +LG
Sbjct  90   GFVLSLG  96



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            VL   I        +A L+P+GVNYEV AL+ IK  LHDP+NVL NWD +SV PCSW M+
Sbjct  9    VLAFLILFSFLFYSNAMLTPAGVNYEVQALMEIKNSLHDPHNVL-NWDESSVDPCSWNMI  67

Query  668  TCSPDGYVSALG  703
            TCS D +V+ L 
Sbjct  68   TCSTDKFVTGLA  79



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            ME++  +    L +  ++ + +S +  LSP GVN+EV AL+AIK  L DP+ VL+NWD  
Sbjct  1    MEKKREIKASFLYVATFLALWSSAAGLLSPKGVNFEVQALMAIKVALKDPHGVLDNWDST  60

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            SV PCSW MVTCS +  V  LG
Sbjct  61   SVDPCSWAMVTCSSESLVIGLG  82



>ref|XP_002305735.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE86246.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=616

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  476  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCS  655
            +LF +     W+  A +  + LSP GVNYEV AL+A+K  + D   V+  WD+NSV PC+
Sbjct  4    ILFHIFLAVFWVHFAQATGSLLSPKGVNYEVAALMAVKKEMRDESGVMNGWDLNSVDPCT  63

Query  656  WRMVTCSPDGYVSAL  700
            W MV CSP+G+V +L
Sbjct  64   WNMVGCSPEGFVFSL  78



>gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCSP+  V  LG
Sbjct  26   LSPKGVNFEVQALMGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPESLVIGLG  80



>ref|XP_010091686.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
 gb|EXB44952.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
Length=619

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 5/77 (6%)
 Frame = +2

Query  473  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPC  652
            FL F      I+ L   S +  LSP GVNYEV AL++IK  L DP+NVL NWD  +V PC
Sbjct  10   FLFF----FNIFCLCHFS-AGMLSPKGVNYEVQALMSIKYLLKDPHNVLGNWDDAAVDPC  64

Query  653  SWRMVTCSPDGYVSALG  703
            SW MVTCSPDG V +LG
Sbjct  65   SWTMVTCSPDGSVISLG  81



>ref|NP_001146634.1| uncharacterized LOC100280233 precursor [Zea mays]
 ref|XP_008643516.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643517.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643518.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 gb|ACL54438.1| unknown [Zea mays]
 gb|AFW73243.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 1 [Zea mays]
 gb|AFW73244.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 2 [Zea mays]
 gb|AFW73245.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 3 [Zea mays]
 gb|AFW73246.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 4 [Zea mays]
Length=626

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +2

Query  497  LGIWMLIATSC---SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            L + +L   SC   S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SV PCSW MV
Sbjct  10   LALVLLFFCSCGPASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMV  69

Query  668  TCSPDGYVSAL  700
            TCSP+  V+ L
Sbjct  70   TCSPENLVTGL  80



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            T+    L+ +GVNYEV AL+  K  LHDP+N+L NWD ++V PCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGFKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  701  G  703
            G
Sbjct  80   G  80



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            + L   + +A LSP GVN+EV AL+ IK  L DP++VLENWD +SV PCSW MVTCSP+ 
Sbjct  15   FFLFWAAGTALLSPKGVNFEVQALMGIKASLMDPHSVLENWDQDSVDPCSWTMVTCSPEN  74

Query  686  YVSALG  703
             V  L 
Sbjct  75   LVVGLA  80



>ref|XP_006647834.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Oryza brachyantha]
Length=626

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SV PCSW MVTCSPD  V+ L
Sbjct  25   SGVLSPKGVNYEVQALMMIKDYLKDPHGVLKNWDQDSVDPCSWTMVTCSPDNLVTGL  81



>ref|XP_002309372.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE92895.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=640

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +2

Query  476  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCS  655
            +  K+L L I+ L     S +  P   N+EV ALI+I+  LHDPY VL NWD +SV PCS
Sbjct  1    MALKLLHLSIFFLFLARLSLSYEPR--NHEVDALISIREALHDPYGVLNNWDEDSVDPCS  58

Query  656  WRMVTCSPDGYVSALG  703
            W M+TCSPD  V  LG
Sbjct  59   WAMITCSPDNLVICLG  74



>ref|XP_010100900.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
 gb|EXB85824.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
Length=695

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 50/79 (63%), Gaps = 10/79 (13%)
 Frame = +2

Query  470  WFLLFKVLGLGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVX  646
            WFL F    L  W     SC+   LSP GVN+EV AL+ IK  L DP+ VLENWD +SV 
Sbjct  12   WFLAF----LWFW-----SCANGILSPKGVNFEVQALMGIKHSLEDPHGVLENWDGDSVD  62

Query  647  PCSWRMVTCSPDGYVSALG  703
            PCSW MVTCSP+  V  LG
Sbjct  63   PCSWTMVTCSPESLVIGLG  81



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +2

Query  503  IWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTC  673
             WM+      + +A LSP GVNYEV AL+ IK  L DP++VLENWD +SV PCSW M+TC
Sbjct  11   FWMMFFWSWAAATAVLSPKGVNYEVQALMGIKASLVDPHSVLENWDKDSVDPCSWTMITC  70

Query  674  SPDGYVSALG  703
            S +  V  LG
Sbjct  71   SSENLVVGLG  80



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            + RE  L F V  L +W     S S+ LSP GVN+EV AL++IK  L DP +VLENWD +
Sbjct  4    LRREAVLCF-VAFLCLW----NSASSLLSPKGVNFEVQALMSIKNSLIDPRSVLENWDKD  58

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            +V PCSW M+TCS D  V +LG
Sbjct  59   AVDPCSWNMITCSDDKLVISLG  80



>emb|CDX83534.1| BnaC07g22740D [Brassica napus]
Length=640

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  497  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            L  ++ +  S SA L+  GVNYEV+ALI IK+ L DP+ VL NWD  +V PCSW M++CS
Sbjct  28   LFFFIALLYSSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMISCS  87

Query  677  PDGYVSALG  703
             DG+V +LG
Sbjct  88   ADGFVLSLG  96



>ref|XP_010514169.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Camelina sativa]
Length=646

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  533  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            A L+  GVNYEV+ALI IK+ L DP+ VL NWD  +V PCSW M++CSPDG+V +LG
Sbjct  42   AELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMISCSPDGFVLSLG  98



>emb|CDX70667.1| BnaC03g07510D [Brassica napus]
Length=720

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            ++ + TS +  LS +GVN+EV AL+ IK  LHDP+ VL++WD ++V PCSW MVTCS + 
Sbjct  20   FLYLLTSVNGLLSSNGVNFEVQALMDIKASLHDPHGVLDSWDRDAVDPCSWTMVTCSSEN  79

Query  686  YVSALG  703
            +V  LG
Sbjct  80   FVIGLG  85



>ref|XP_009360005.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g23950 [Pyrus x bretschneideri]
Length=638

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            +L L + +   +SCS  LS    N+EV ALI+++ GL+DP+ VL NWD +SV PCSW M+
Sbjct  1    MLSLKLLIFFLSSCSLCLSYEPRNHEVEALISLRVGLNDPHGVLNNWDEDSVDPCSWAMI  60

Query  668  TCSPDGYVSALG  703
            TCSPD  V  LG
Sbjct  61   TCSPDNLVIGLG  72



>emb|CDX78667.1| BnaA03g05790D [Brassica napus]
Length=723

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            ++ + TS +  LS +GVN+EV AL+ IK  LHDP+ VL++WD ++V PCSW MVTCS + 
Sbjct  20   FLYLLTSVNGLLSSNGVNFEVQALMDIKASLHDPHGVLDSWDRDAVDPCSWTMVTCSSEN  79

Query  686  YVSALG  703
            +V  LG
Sbjct  80   FVIGLG  85



>ref|XP_009356495.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
 ref|XP_009356496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
Length=624

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            LSP GVNYEV AL+ IK  L DP  VL NWD  SV PC W MVTCSPDG V  LG
Sbjct  26   LSPKGVNYEVQALVGIKGALEDPRGVLRNWDETSVDPCIWNMVTCSPDGLVIGLG  80



>ref|XP_007045670.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY01502.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=926

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  518  ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSA  697
            + S S  ++P+GV YEV+ALI IK  L DP+ VL+NWD +S  PCSW MVTCSPDG+V  
Sbjct  37   SASASPLVAPNGVGYEVLALIGIKRLLVDPHKVLDNWDDSSRDPCSWNMVTCSPDGFVVG  96

Query  698  LG  703
            LG
Sbjct  97   LG  98


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
              +E F+L  V  L +W    +S    LSP GVN+EV AL+ IK  L DP+ VL+NWD  
Sbjct  302  FRKEKFVLCCVALLCLW----SSACGLLSPKGVNFEVQALMGIKNFLVDPHRVLDNWDEA  357

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            +V PCSW MVTC+PDG V  LG
Sbjct  358  AVDPCSWSMVTCTPDGLVVGLG  379



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +  L  +S +A LSP GVN+EV AL+ IK  L DP+ VL+NWD  +V PCSW MVTCS D
Sbjct  14   VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLDNWDEAAVDPCSWNMVTCSID  73

Query  683  GYVSALG  703
            G V  LG
Sbjct  74   GLVIGLG  80



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 4/72 (6%)
 Frame = +2

Query  500  GIWMLIA----TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            G+++L+      S +A LSP GVN+EV AL+ IK  L DP++VLENWD +SV PCSW MV
Sbjct  20   GLFLLVFLWTWASAAALLSPKGVNFEVQALMYIKDSLKDPHSVLENWDRDSVDPCSWAMV  79

Query  668  TCSPDGYVSALG  703
            TCS +  V +LG
Sbjct  80   TCSSENLVISLG  91



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +  L  +S +A LSP GVN+EV AL+ IK  L DP+ VL+NWD  +V PCSW MVTCS D
Sbjct  14   VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLDNWDEAAVDPCSWNMVTCSID  73

Query  683  GYVSALG  703
            G V  LG
Sbjct  74   GLVIGLG  80



>gb|KEH25224.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=527

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +2

Query  524  SCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            SC+ A LSP G+N+EV AL++IK  L DP+ + ENWD ++V PCSW MVTCSP+  V +L
Sbjct  20   SCANALLSPKGINFEVQALVSIKESLMDPHGIFENWDGDAVDPCSWNMVTCSPENLVVSL  79

Query  701  G  703
            G
Sbjct  80   G  80



>ref|XP_004490300.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cicer arietinum]
Length=622

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 4/83 (5%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            MER+  +    L L     + TS +  LSP GVNYEV AL+ IK  L DP++ L++WD  
Sbjct  1    MERKRDVALFCLAL---FFLWTSVAGLLSPKGVNYEVQALMGIKNSLVDPHSALDSWDAE  57

Query  638  SVXPCSWRMVTCSPDG-YVSALG  703
            SV PC+W MVTCSPD  +V+ALG
Sbjct  58   SVDPCNWAMVTCSPDDHFVTALG  80



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +2

Query  524  SCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            SC+ A LSP G+N+EV AL++IK  L DP+ + ENWD ++V PCSW MVTCSP+  V +L
Sbjct  20   SCANALLSPKGINFEVQALVSIKESLMDPHGIFENWDGDAVDPCSWNMVTCSPENLVVSL  79

Query  701  G  703
            G
Sbjct  80   G  80



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +A LSP GVN+EV+AL+ IK  L DP+ +L+NWD ++V PCSW MVTCSP+  V +LG
Sbjct  23   NALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNMVTCSPENLVISLG  80



>gb|KEH17047.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=621

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            +  L ++  + TS +  LS  GVNYEV ALI IK  L DP++ L NWD  SV PC+W M+
Sbjct  6    LFSLVLFFFMWTSVTGLLSSKGVNYEVQALIGIKNSLVDPHSALNNWDAESVDPCNWAMI  65

Query  668  TCSPDGYVSALG  703
            TCS D +V ALG
Sbjct  66   TCSSDRFVVALG  77



>ref|XP_009345903.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g23950 [Pyrus x bretschneideri]
Length=638

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            +L L + +   +SCS  LS    N+EV ALI+++ GL+DP+ VL NWD +SV PCSW M+
Sbjct  1    MLPLKLLIFFLSSCSLCLSYEPRNHEVEALISLRVGLNDPHGVLNNWDEDSVDPCSWAMI  60

Query  668  TCSPDGYVSALG  703
            TCSPD  V  LG
Sbjct  61   TCSPDNLVIGLG  72



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +A LSP GVN+EV+AL+ IK  L DP+ +L+NWD ++V PCSW MVTCSP+  V +LG
Sbjct  23   NALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNMVTCSPENLVISLG  80



>ref|XP_008359493.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g23950 [Malus domestica]
Length=638

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  488  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMV  667
            +L L + +   +SCS  LS    N+EV ALI+++ GL+DP+ VL NWD +SV PCSW M+
Sbjct  1    MLPLKLLIFFLSSCSLCLSYEPRNHEVEALISLRVGLNDPHGVLNNWDEDSVDPCSWAMI  60

Query  668  TCSPDGYVSALG  703
            TCSPD  V  LG
Sbjct  61   TCSPDNLVIGLG  72



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
             S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SV PCSW MVTCSP+  V+ L
Sbjct  24   ASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGL  81



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
             S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SV PCSW MVTCSP+  V+ L
Sbjct  22   ASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGL  79



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +A LSP GVN+EV+AL+ IK  L DP+ +L+NWD ++V PCSW MVTCSP+  V +LG
Sbjct  23   NALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNMVTCSPENLVISLG  80



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  527  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
             S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SV PCSW MVTCSP+  V+ L
Sbjct  24   ASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGL  81



>ref|XP_009630581.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Nicotiana tomentosiformis]
Length=625

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = +2

Query  497  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCS  676
            L +W     + +  LSP GVN+EV AL+AIK  L DP+ VL+NWD  SV PCSW MVTCS
Sbjct  17   LALW----NTATGLLSPKGVNFEVQALMAIKAALKDPHGVLDNWDGTSVDPCSWAMVTCS  72

Query  677  PDGYVSALG  703
             + +V  LG
Sbjct  73   AESFVIGLG  81



>emb|CDX69484.1| BnaA10g18330D [Brassica napus]
Length=634

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S S  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS + +V  LG
Sbjct  19   SVSGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFVIGLG  78



>ref|XP_009121529.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Brassica rapa]
Length=634

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S S  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS + +V  LG
Sbjct  19   SVSGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFVIGLG  78



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S  LSP GVN+EV AL+ IK  L DP+ VL+NWD +SV PCSW MVTCSP   V+ LG
Sbjct  23   SCLLSPKGVNFEVQALMGIKASLVDPHGVLDNWDGDSVDPCSWTMVTCSPQSLVTGLG  80



>emb|CDY26481.1| BnaC09g41870D [Brassica napus]
Length=637

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S S  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++V PCSW MVTCS + +V  LG
Sbjct  23   SVSGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFVIGLG  82



>gb|KFK25832.1| hypothetical protein AALP_AA8G167900 [Arabis alpina]
Length=636

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +2

Query  458  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  637
            M R  F+ F    LG   L+  S +  LS  GVN+EV AL+ IK  LHDP+ VL+NWD +
Sbjct  9    MMRTSFVYF----LGFLCLLC-SVNGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRD  63

Query  638  SVXPCSWRMVTCSPDGYVSALG  703
            +V PCSW MVTCS + +V  LG
Sbjct  64   AVDPCSWTMVTCSSENFVIGLG  85



>ref|XP_006594544.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like isoform X1 [Glycine max]
 ref|XP_006594545.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like isoform X2 [Glycine max]
 ref|XP_006594546.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780-like isoform X3 [Glycine max]
 gb|KHN08420.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=620

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            W+L+     + LSP GVNYEV AL+++K+ ++D  +V++ WD+NSV PC+W MV CS +G
Sbjct  18   WVLVVDGTDSLLSPKGVNYEVAALMSMKSKMNDELHVMDGWDINSVDPCTWNMVGCSAEG  77

Query  686  YVSAL  700
            YV +L
Sbjct  78   YVISL  82



>ref|XP_009131513.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Brassica rapa]
Length=636

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            ++ + TS +  LS +GVN+EV AL+ IK  LHDP+ VL++WD ++V PCSW MVTCS + 
Sbjct  20   FLYLLTSVNGLLSSNGVNFEVQALMDIKASLHDPHGVLDSWDRDAVDPCSWTMVTCSSEN  79

Query  686  YVSALG  703
            +V  LG
Sbjct  80   FVIGLG  85



>ref|XP_011018089.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g30520 [Populus euphratica]
Length=637

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +2

Query  476  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCS  655
            + FK+L L  + L     S +  P   N+EV ALI I+  LHDP+ VL NWD +SV PCS
Sbjct  1    MAFKLLHLSFFSLFLAKLSLSYEPR--NHEVEALIGIREALHDPHGVLSNWDEDSVDPCS  58

Query  656  WRMVTCSPDGYVSALG  703
            W M+TCSP+  V  LG
Sbjct  59   WAMITCSPENLVIGLG  74



>ref|XP_009619542.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Nicotiana tomentosiformis]
Length=610

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
             W+ +  +  + LSP GVNYEV AL+++K  + D Y VL+ WD+NSV PC+W MV CS +
Sbjct  14   FWLAVTPASMSLLSPKGVNYEVAALMSMKNKMRDEYQVLDGWDINSVDPCTWYMVGCSSE  73

Query  683  GYVSAL  700
            G+V +L
Sbjct  74   GFVISL  79



>ref|XP_009400110.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            +  + T  +ATLSP GVN+EV  L+ IK  L DP+ VLENWD +SV PCSW MVTCSP+ 
Sbjct  18   FFFLWTIVTATLSPKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPEN  77

Query  686  YVSAL  700
             V  L
Sbjct  78   SVIGL  82



>ref|XP_009400102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            +  + T  +ATLSP GVN+EV  L+ IK  L DP+ VLENWD +SV PCSW MVTCSP+ 
Sbjct  18   FFFLWTIVTATLSPKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPEN  77

Query  686  YVSAL  700
             V  L
Sbjct  78   SVIGL  82



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            +S +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++V PCSW MVTCSP+  V +L
Sbjct  21   SSSNALLSPKGVNFEVQALMGIKAFLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISL  80

Query  701  G  703
            G
Sbjct  81   G  81



>ref|XP_009619541.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Nicotiana tomentosiformis]
Length=617

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
             W+ +  +  + LSP GVNYEV AL+++K  + D Y VL+ WD+NSV PC+W MV CS +
Sbjct  14   FWLAVTPASMSLLSPKGVNYEVAALMSMKNKMRDEYQVLDGWDINSVDPCTWYMVGCSSE  73

Query  683  GYVSAL  700
            G+V +L
Sbjct  74   GFVISL  79



>ref|XP_003563960.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Brachypodium 
distachyon]
Length=629

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  512  LIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYV  691
             +++   A LSP GVN EV ALI IK  L DP+ VL+NWD +SV PCS+ M+TCSPD +V
Sbjct  23   FVSSPSCALLSPKGVNTEVQALIGIKNLLKDPHGVLKNWDQDSVDPCSFTMITCSPDNFV  82

Query  692  SAL  700
            + L
Sbjct  83   TGL  85



>ref|XP_006290715.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
 gb|EOA23613.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
Length=651

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            SA L+  GVNYEV+ALI IK  L DP+ VL NWD  +V PCSW M+TCS DG+V  LG
Sbjct  46   SAELTDKGVNYEVLALIGIKNSLIDPHGVLMNWDDTAVDPCSWNMITCSSDGFVIILG  103



>ref|XP_006344295.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Solanum tuberosum]
Length=620

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +2

Query  488  VLG-LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRM  664
            +LG L ++  +A    A L+P+GVNYEV AL+ IK  L DP+NVL NWD ++V PCSW M
Sbjct  4    ILGYLYLFNFLAYYAHAMLTPAGVNYEVQALMEIKKNLDDPHNVL-NWDGDAVDPCSWNM  62

Query  665  VTCSPDGYVSAL  700
            VTCS D +V++L
Sbjct  63   VTCSYDKFVTSL  74



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++V PCSW MVTCSP+  V +LG
Sbjct  23   NALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLG  80



>ref|XP_002325107.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF03672.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=637

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +2

Query  476  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCS  655
            + FK+L L  + L     S +  P   N+EV ALI+I+  LHDP+ VL NWD +SV PCS
Sbjct  1    MAFKLLHLSFFSLFLAKLSLSYEPR--NHEVEALISIREALHDPHGVLSNWDEDSVDPCS  58

Query  656  WRMVTCSPDGYVSALG  703
            W M+TCSP+  V   G
Sbjct  59   WAMITCSPENLVIGFG  74



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +W+L  T+ +  L+P GVN+EV AL+ IK  L DP+ VLENWD ++V PCSW MVTCS +
Sbjct  19   LWLL--TTVNGLLTPKGVNFEVQALMGIKASLDDPHGVLENWDGDAVDPCSWTMVTCSSE  76

Query  683  GYVSALG  703
              V  LG
Sbjct  77   SLVIGLG  83



>dbj|BAB09221.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=570

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 6/80 (8%)
 Frame = +2

Query  479  LFKVLGLGIWML---IATSCSAT---LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNS  640
            L K L LGIW+    +  S SA    LSP GVNYEV AL+++K  + D   VL  WD+NS
Sbjct  5    LMKFLFLGIWVYYYSVLDSVSAMDSLLSPKGVNYEVAALMSVKNKMKDEKEVLSGWDINS  64

Query  641  VXPCSWRMVTCSPDGYVSAL  700
            V PC+W MV CS +G+V +L
Sbjct  65   VDPCTWNMVGCSSEGFVVSL  84



>ref|XP_007148027.1| hypothetical protein PHAVU_006G174400g [Phaseolus vulgaris]
 gb|ESW20021.1| hypothetical protein PHAVU_006G174400g [Phaseolus vulgaris]
Length=572

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            W+L+     + LSP GVNYEV AL+++K+ ++  ++V++ WD+NSV PC+W MV CS +G
Sbjct  18   WVLLVEGTDSLLSPKGVNYEVAALMSLKSKMYGEFHVMDGWDINSVDPCTWYMVGCSAEG  77

Query  686  YVSAL  700
            YV +L
Sbjct  78   YVVSL  82



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +2

Query  503  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPD  682
            +W+L  T+ +  L+P GVN+EV AL+ IK  L DP+ VLENWD ++V PCSW MVTCS +
Sbjct  19   LWLL--TTVNGLLTPKGVNFEVQALMGIKASLDDPHGVLENWDGDAVDPCSWTMVTCSSE  76

Query  683  GYVSALG  703
              V  LG
Sbjct  77   SLVIGLG  83



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  524  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            S  A LSP GVN+EV AL++IK  L DP+ VL+NWD ++V PCSW MVTCS +  V  LG
Sbjct  20   SADAVLSPKGVNFEVQALMSIKQSLEDPHGVLDNWDGDAVDPCSWTMVTCSSENLVVGLG  79



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++V PCSW MVTCSP+  V +LG
Sbjct  23   NALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLG  80



>ref|XP_007148028.1| hypothetical protein PHAVU_006G174400g [Phaseolus vulgaris]
 gb|ESW20022.1| hypothetical protein PHAVU_006G174400g [Phaseolus vulgaris]
Length=620

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  506  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDG  685
            W+L+     + LSP GVNYEV AL+++K+ ++  ++V++ WD+NSV PC+W MV CS +G
Sbjct  18   WVLLVEGTDSLLSPKGVNYEVAALMSLKSKMYGEFHVMDGWDINSVDPCTWYMVGCSAEG  77

Query  686  YVSAL  700
            YV +L
Sbjct  78   YVVSL  82



>emb|CBI30706.3| unnamed protein product [Vitis vinifera]
Length=604

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            LSP GVNYEV AL+A+K  ++D  NVL+ WD+NSV PC+W MV C+P+G+V +L
Sbjct  9    LSPKGVNYEVAALMAMKNKMNDESNVLDGWDINSVDPCTWNMVGCTPEGFVISL  62



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  530  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++V PCSW MVTCSP+  V +LG
Sbjct  23   NALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLG  80



>ref|XP_008389350.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Malus domestica]
Length=621

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  539  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSALG  703
            LSP GVNYEV AL+AIK  L DP  VL NWD  SV PC W MVTCS DG V  LG
Sbjct  22   LSPKGVNYEVQALVAIKGALEDPRGVLRNWDETSVDPCIWNMVTCSLDGLVIGLG  76



>ref|NP_199390.2| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGU5.1|Y5457_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At5g45780; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59380.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95298.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=614

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 6/80 (8%)
 Frame = +2

Query  479  LFKVLGLGIWML---IATSCSAT---LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNS  640
            L K L LGIW+    +  S SA    LSP GVNYEV AL+++K  + D   VL  WD+NS
Sbjct  5    LMKFLFLGIWVYYYSVLDSVSAMDSLLSPKGVNYEVAALMSVKNKMKDEKEVLSGWDINS  64

Query  641  VXPCSWRMVTCSPDGYVSAL  700
            V PC+W MV CS +G+V +L
Sbjct  65   VDPCTWNMVGCSSEGFVVSL  84



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  521  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVXPCSWRMVTCSPDGYVSAL  700
            +S    LSP GVN+EV AL+ IK GL DP+ VL+NWD ++V PCSW MVTCS +  V  L
Sbjct  22   SSAIGLLSPKGVNFEVQALMGIKAGLRDPHGVLDNWDGDAVDPCSWTMVTCSSESLVIGL  81

Query  701  G  703
            G
Sbjct  82   G  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335