BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF042L13

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617291.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    373   3e-123   Nicotiana tomentosiformis
ref|XP_009617290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    368   2e-121   Nicotiana tomentosiformis
ref|XP_006345041.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    367   6e-121   Solanum tuberosum [potatoes]
ref|XP_004236119.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    364   9e-120   
ref|XP_010028184.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    363   1e-119   Eucalyptus grandis [rose gum]
ref|XP_011071828.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    362   8e-119   Sesamum indicum [beniseed]
gb|AFK41217.1|  unknown                                                 360   3e-118   Lotus japonicus
gb|KJB53132.1|  hypothetical protein B456_008G294300                    357   3e-118   Gossypium raimondii
emb|CDP18933.1|  unnamed protein product                                360   3e-118   Coffea canephora [robusta coffee]
gb|KHN18468.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    358   3e-117   Glycine soja [wild soybean]
gb|AFW86313.1|  restorer of fertility2                                  355   3e-117   
gb|KJB53133.1|  hypothetical protein B456_008G294300                    357   3e-117   Gossypium raimondii
ref|XP_007155410.1|  hypothetical protein PHAVU_003G199100g             357   4e-117   Phaseolus vulgaris [French bean]
gb|KJB53131.1|  hypothetical protein B456_008G294300                    357   4e-117   Gossypium raimondii
ref|XP_007155411.1|  hypothetical protein PHAVU_003G199100g             357   5e-117   Phaseolus vulgaris [French bean]
gb|AHM26656.1|  aldehyde dehydrogenase 2-1                              357   8e-117   Zea mays subsp. mays [corn]
dbj|BAB92019.1|  mitochondrial aldehyde dehydrogenase                   356   2e-116   Sorghum bicolor [broomcorn]
gb|AAK58370.1|AF269064_1  T-cytoplasm male sterility restorer fac...    356   2e-116   Zea mays [maize]
gb|AAO72532.1|  aldehyde dehydrogenase 1 precursor                      355   2e-116   Lotus corniculatus
ref|NP_001105891.1|  mitochondrial aldehyde dehydrogenase 2             356   2e-116   Zea mays [maize]
gb|KDP26565.1|  hypothetical protein JCGZ_17723                         354   5e-116   Jatropha curcas
ref|XP_007210569.1|  hypothetical protein PRUPE_ppa003869mg             354   7e-116   Prunus persica
ref|XP_003608978.1|  Mitochondrial aldehyde dehydrogenase               354   9e-116   
gb|AES91175.2|  NAD-dependent aldehyde dehydrogenase family protein     353   1e-115   Medicago truncatula
gb|AAZ79355.1|  aldehyde dehydrogenase                                  353   1e-115   Vitis pseudoreticulata
emb|CAN63005.1|  hypothetical protein VITISV_013710                     353   2e-115   Vitis vinifera
ref|XP_002283132.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    353   2e-115   Vitis vinifera
ref|XP_004138115.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    353   3e-115   Cucumis sativus [cucumbers]
ref|XP_008374451.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    352   4e-115   Malus domestica [apple tree]
gb|KHG08400.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    352   4e-115   Gossypium arboreum [tree cotton]
ref|XP_004155012.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    352   4e-115   
ref|XP_008239742.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    352   5e-115   Prunus mume [ume]
ref|XP_010678738.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    352   6e-115   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010101190.1|  Aldehyde dehydrogenase family 2 member             351   1e-114   Morus notabilis
emb|CDP00179.1|  unnamed protein product                                350   2e-114   Coffea canephora [robusta coffee]
gb|AAF73828.1|AF162665_1  aldehyde dehydrogenase                        351   2e-114   Oryza sativa [red rice]
ref|XP_010251301.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    350   2e-114   Nelumbo nucifera [Indian lotus]
ref|XP_004965205.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    350   2e-114   Setaria italica
ref|NP_001057358.1|  Os06g0270900                                       350   3e-114   
gb|EAZ00462.1|  hypothetical protein OsI_22484                          350   3e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_008221788.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    350   3e-114   Prunus mume [ume]
ref|XP_010546022.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    350   3e-114   Tarenaya hassleriana [spider flower]
ref|XP_007036177.1|  Aldehyde dehydrogenase family 2 member B4          350   4e-114   
ref|XP_002877590.1|  ALDH2B4                                            350   4e-114   
ref|XP_009363534.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    349   6e-114   Pyrus x bretschneideri [bai li]
ref|XP_009391259.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    349   6e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010914166.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    350   9e-114   Elaeis guineensis
ref|XP_010426271.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    348   9e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010503421.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    348   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_007221800.1|  hypothetical protein PRUPE_ppa004036mg             348   1e-113   Prunus persica
ref|XP_010928601.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    348   2e-113   Elaeis guineensis
ref|XP_004297642.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    347   2e-113   Fragaria vesca subsp. vesca
ref|XP_010682576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    345   2e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008793883.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    348   2e-113   
emb|CDY36910.1|  BnaA06g16950D                                          348   2e-113   Brassica napus [oilseed rape]
ref|XP_009149853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    347   3e-113   Brassica rapa
ref|XP_010515110.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    347   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_007153639.1|  hypothetical protein PHAVU_003G052500g             347   3e-113   Phaseolus vulgaris [French bean]
emb|CDY44985.1|  BnaCnng12150D                                          347   4e-113   Brassica napus [oilseed rape]
ref|XP_008453101.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    347   5e-113   Cucumis melo [Oriental melon]
ref|XP_002511424.1|  aldehyde dehydrogenase, putative                   347   5e-113   
ref|XP_009363532.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    347   6e-113   Pyrus x bretschneideri [bai li]
ref|XP_008389628.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   7e-113   
ref|XP_006404308.1|  hypothetical protein EUTSA_v10010271mg             346   8e-113   Eutrema salsugineum [saltwater cress]
ref|XP_004298932.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   8e-113   Fragaria vesca subsp. vesca
ref|XP_010913576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   9e-113   Elaeis guineensis
ref|XP_004508853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   1e-112   Cicer arietinum [garbanzo]
gb|EYU42550.1|  hypothetical protein MIMGU_mgv1a004919mg                345   1e-112   Erythranthe guttata [common monkey flower]
ref|XP_003527026.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   1e-112   
ref|XP_008367527.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   1e-112   
gb|EPS72983.1|  mitochondrial benzaldehyde dehydrogenase                345   1e-112   Genlisea aurea
ref|XP_009391258.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    345   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391257.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    345   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP31120.1|  hypothetical protein JCGZ_11496                         345   2e-112   Jatropha curcas
ref|XP_009612265.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    345   3e-112   Nicotiana tomentosiformis
ref|XP_010682575.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    345   3e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009391256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    344   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009759823.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    344   4e-112   Nicotiana sylvestris
ref|XP_006290873.1|  hypothetical protein CARUB_v10016983mg             344   5e-112   Capsella rubella
ref|XP_011028588.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    343   9e-112   Populus euphratica
ref|XP_008781996.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    343   1e-111   Phoenix dactylifera
ref|XP_006844236.1|  hypothetical protein AMTR_s00006p00268060          342   1e-111   
ref|XP_006656871.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    343   2e-111   Oryza brachyantha
ref|XP_010460154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    342   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010477684.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    342   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_007031424.1|  Aldehyde dehydrogenase 2B4 isoform 2               338   3e-111   
gb|KDO69714.1|  hypothetical protein CISIN_1g012806mg                   337   4e-111   Citrus sinensis [apfelsine]
gb|KDO69715.1|  hypothetical protein CISIN_1g012806mg                   337   4e-111   Citrus sinensis [apfelsine]
emb|CAA71003.1|  aldehyde dehydrogenase (NAD+)                          342   5e-111   Nicotiana tabacum [American tobacco]
ref|XP_004238676.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    341   6e-111   
ref|XP_003517756.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    341   7e-111   
ref|XP_006355977.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    341   8e-111   Solanum tuberosum [potatoes]
gb|KHG27537.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    341   9e-111   Gossypium arboreum [tree cotton]
gb|KJB50197.1|  hypothetical protein B456_008G158500                    340   1e-110   Gossypium raimondii
gb|ABK92547.1|  unknown                                                 337   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_011044320.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    340   1e-110   Populus euphratica
gb|KDO69713.1|  hypothetical protein CISIN_1g012806mg                   338   2e-110   Citrus sinensis [apfelsine]
gb|KHN00347.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    340   2e-110   Glycine soja [wild soybean]
ref|XP_002301540.1|  mitochondrial aldehyde dehydrogenase family ...    340   2e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010653335.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    340   3e-110   Vitis vinifera
ref|XP_007031423.1|  Aldehyde dehydrogenase 2B4 isoform 1               339   3e-110   
ref|XP_003519638.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    340   3e-110   
ref|XP_010029207.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    339   3e-110   Eucalyptus grandis [rose gum]
ref|XP_004509835.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    339   4e-110   
gb|ACM89738.1|  mitochondrial benzaldehyde dehydrogenase                339   4e-110   Antirrhinum majus [garden snapdragon]
ref|XP_004509834.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    339   5e-110   Cicer arietinum [garbanzo]
ref|XP_010498885.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    339   5e-110   Camelina sativa [gold-of-pleasure]
gb|KFK34098.1|  hypothetical protein AALP_AA5G101700                    339   5e-110   Arabis alpina [alpine rockcress]
ref|XP_010551563.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    339   5e-110   Tarenaya hassleriana [spider flower]
gb|KDO82494.1|  hypothetical protein CISIN_1g009035mg                   334   5e-110   Citrus sinensis [apfelsine]
dbj|BAB62757.1|  mitochondrial aldehyde dehydrogenase ALDH2             339   6e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW56067.1|  hypothetical protein EUGRSUZ_I01824                     338   6e-110   Eucalyptus grandis [rose gum]
ref|XP_011463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    338   7e-110   Fragaria vesca subsp. vesca
ref|XP_011086550.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    338   8e-110   Sesamum indicum [beniseed]
ref|XP_002274863.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    338   1e-109   Vitis vinifera
ref|NP_190383.1|  aldehyde dehydrogenase 2B4                            338   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318034.1|  aldehyde dehydrogenase 1 precursor family pr...    338   1e-109   Populus trichocarpa [western balsam poplar]
gb|KCW86739.1|  hypothetical protein EUGRSUZ_B03349                     338   2e-109   Eucalyptus grandis [rose gum]
ref|XP_010044646.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    338   2e-109   Eucalyptus grandis [rose gum]
ref|XP_009399660.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    338   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297641.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    337   3e-109   Fragaria vesca subsp. vesca
ref|XP_003552014.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    337   3e-109   
gb|AFK49345.1|  unknown                                                 328   3e-109   Medicago truncatula
ref|XP_006476755.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    337   4e-109   Citrus sinensis [apfelsine]
gb|KDO82492.1|  hypothetical protein CISIN_1g009035mg                   334   4e-109   Citrus sinensis [apfelsine]
gb|KDO82493.1|  hypothetical protein CISIN_1g009035mg                   334   4e-109   Citrus sinensis [apfelsine]
ref|XP_006439784.1|  hypothetical protein CICLE_v10019638mg             337   4e-109   Citrus clementina [clementine]
dbj|BAB92017.1|  mitochondrial aldehyde dehydrogenase                   337   5e-109   Secale cereale
gb|EMT04899.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    337   6e-109   
gb|EYU31278.1|  hypothetical protein MIMGU_mgv1a004311mg                336   6e-109   Erythranthe guttata [common monkey flower]
gb|EMS51754.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    337   6e-109   Triticum urartu
ref|XP_010552639.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    336   7e-109   Tarenaya hassleriana [spider flower]
gb|KEH35052.1|  NAD-dependent aldehyde dehydrogenase family protein     333   7e-109   Medicago truncatula
gb|KEH35053.1|  NAD-dependent aldehyde dehydrogenase family protein     333   1e-108   Medicago truncatula
gb|KEH35051.1|  NAD-dependent aldehyde dehydrogenase family protein     333   1e-108   Medicago truncatula
gb|KJB11462.1|  hypothetical protein B456_001G261100                    330   1e-108   Gossypium raimondii
ref|XP_010477682.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    335   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_003532011.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    335   1e-108   
gb|AAL77004.1|  aldehyde dehydrogenase                                  327   1e-108   Allium cepa
ref|XP_011003158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    335   2e-108   Populus euphratica
gb|KDO82485.1|  hypothetical protein CISIN_1g009035mg                   335   4e-108   Citrus sinensis [apfelsine]
ref|NP_564204.1|  aldehyde dehydrogenase 2B7                            334   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438422.1|  hypothetical protein CICLE_v10031155mg             334   4e-108   Citrus clementina [clementine]
gb|AAL99612.1|AF348416_1  mitochondrial aldehyde dehydrogenase          334   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682577.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    334   4e-108   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH19980.1|  NAD-dependent aldehyde dehydrogenase family protein     334   6e-108   Medicago truncatula
ref|XP_004139235.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   7e-108   
ref|XP_004156463.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   8e-108   
ref|XP_010029206.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   8e-108   Eucalyptus grandis [rose gum]
ref|XP_002893307.1|  hypothetical protein ARALYDRAFT_472641             333   1e-107   
ref|XP_009115500.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   1e-107   Brassica rapa
gb|KEH35050.1|  NAD-dependent aldehyde dehydrogenase family protein     333   2e-107   Medicago truncatula
ref|XP_009150211.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   2e-107   Brassica rapa
ref|XP_008456004.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   2e-107   Cucumis melo [Oriental melon]
gb|ABK24267.1|  unknown                                                 333   2e-107   Picea sitchensis
gb|KFK44454.1|  hypothetical protein AALP_AA1G258900                    332   2e-107   Arabis alpina [alpine rockcress]
gb|KHG06517.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    332   2e-107   Gossypium arboreum [tree cotton]
gb|KJB11461.1|  hypothetical protein B456_001G261100                    332   2e-107   Gossypium raimondii
ref|XP_011071082.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    332   2e-107   
emb|CDY47634.1|  BnaC05g18900D                                          332   3e-107   Brassica napus [oilseed rape]
ref|XP_006307216.1|  hypothetical protein CARUB_v10008816mg             332   3e-107   Capsella rubella
gb|KGN60807.1|  hypothetical protein Csa_2G010420                       333   3e-107   Cucumis sativus [cucumbers]
gb|KJB31274.1|  hypothetical protein B456_005G183300                    331   4e-107   Gossypium raimondii
ref|XP_009761724.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    332   4e-107   Nicotiana sylvestris
ref|XP_011044321.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    331   7e-107   Populus euphratica
ref|XP_009110081.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    330   9e-107   Brassica rapa
gb|EYU22484.1|  hypothetical protein MIMGU_mgv1a004342mg                330   1e-106   Erythranthe guttata [common monkey flower]
emb|CDY57318.1|  BnaA08g20300D                                          330   1e-106   Brassica napus [oilseed rape]
ref|XP_007157468.1|  hypothetical protein PHAVU_002G072100g             330   2e-106   Phaseolus vulgaris [French bean]
emb|CDX91724.1|  BnaC08g06430D                                          329   4e-106   
ref|XP_010682578.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    330   4e-106   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY61548.1|  BnaA09g29890D                                          330   4e-106   Brassica napus [oilseed rape]
ref|XP_004245256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    328   7e-106   Solanum lycopersicum
emb|CDX77883.1|  BnaC03g53360D                                          329   1e-105   
ref|XP_009600000.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    328   1e-105   
ref|XP_010271955.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    327   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_003563967.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    327   5e-105   Brachypodium distachyon [annual false brome]
ref|XP_006356663.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    325   9e-105   Solanum tuberosum [potatoes]
ref|XP_010037573.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    325   1e-104   Eucalyptus grandis [rose gum]
gb|AAC98035.1|  Strong similarity to gb|Y09876 aldehyde dehydroge...    324   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793866.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    324   3e-104   Phoenix dactylifera
ref|XP_007044551.1|  Aldehyde dehydrogenase 2B4                         323   5e-104   
ref|XP_006416054.1|  hypothetical protein EUTSA_v10007303mg             323   6e-104   Eutrema salsugineum [saltwater cress]
ref|XP_010316283.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    323   9e-104   Solanum lycopersicum
gb|AEV54528.1|  aldehyde dehydrogenase ALDH2B4_V3                       322   1e-103   Vitis vinifera
ref|XP_002525343.1|  aldehyde dehydrogenase, putative                   318   1e-103   
gb|AAZ79358.1|  aldehyde dehydrogenase                                  322   2e-103   Vitis pseudoreticulata
ref|XP_010265814.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    322   4e-103   Nelumbo nucifera [Indian lotus]
ref|XP_006594290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    321   6e-103   Glycine max [soybeans]
gb|KHN47185.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    321   6e-103   Glycine soja [wild soybean]
ref|XP_003542700.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    321   7e-103   
ref|XP_010928603.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    319   3e-102   Elaeis guineensis
ref|XP_004953799.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   2e-101   Setaria italica
ref|XP_010100483.1|  Aldehyde dehydrogenase family 2 member             317   2e-101   Morus notabilis
ref|XP_004953798.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   4e-101   
gb|AGV54428.1|  mitochondrial aldehyde dehydrogenase                    315   7e-101   Phaseolus vulgaris [French bean]
gb|KHN23562.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    310   3e-99    Glycine soja [wild soybean]
emb|CDY21806.1|  BnaA06g20750D                                          309   6e-99    Brassica napus [oilseed rape]
gb|AAW50842.1|  aldehyde dehydrogenase                                  295   1e-97    Aegiceras corniculatum
ref|XP_007151102.1|  hypothetical protein PHAVU_004G018000g             306   2e-97    Phaseolus vulgaris [French bean]
gb|KEH19981.1|  NAD-dependent aldehyde dehydrogenase family protein     304   1e-96    Medicago truncatula
gb|AAZ79356.1|  aldehyde dehydrogenase                                  302   2e-96    Vitis pseudoreticulata
gb|AEV54527.1|  aldehyde dehydrogenase ALDH2B4_V2                       302   2e-96    Vitis vinifera
gb|KJB50198.1|  hypothetical protein B456_008G158500                    300   2e-95    Gossypium raimondii
gb|AFW63787.1|  hypothetical protein ZEAMMB73_379378                    296   5e-95    
ref|XP_006647839.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    299   2e-94    
ref|XP_002321583.2|  aldehyde dehydrogenase 1 precursor family pr...    297   3e-94    
gb|AFW63788.1|  hypothetical protein ZEAMMB73_379378                    296   5e-94    
gb|ACG32898.1|  aldehyde dehydrogenase                                  297   1e-93    Zea mays [maize]
dbj|BAB92018.1|  mitochondrial aldehyde dehydrogenase                   297   1e-93    Sorghum bicolor [broomcorn]
gb|KHN05814.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    292   3e-93    Glycine soja [wild soybean]
ref|NP_001105576.1|  aldehyde dehydrogenase2                            296   3e-93    Zea mays [maize]
gb|AHM26657.1|  aldehyde dehydrogenase 2-2                              296   4e-93    Zea mays subsp. mays [corn]
gb|AAL99614.2|AF348418_1  mitochondrial aldehyde dehydrogenase RF2B     296   4e-93    Zea mays [maize]
gb|EEC73936.1|  hypothetical protein OsI_08800                          295   1e-92    Oryza sativa Indica Group [Indian rice]
ref|NP_001048010.1|  Os02g0730000                                       295   1e-92    
gb|EMT22926.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    287   2e-88    
ref|XP_006439785.1|  hypothetical protein CICLE_v10019638mg             281   2e-88    
gb|ACU18804.1|  unknown                                                 271   6e-88    Glycine max [soybeans]
ref|XP_001785650.1|  predicted protein                                  280   2e-87    
gb|KDO82484.1|  hypothetical protein CISIN_1g009035mg                   270   6e-84    Citrus sinensis [apfelsine]
gb|ABD35815.1|  putative mitochondrial aldehyde dehydrogenase           250   2e-80    Populus x canadensis [Canadian poplar]
ref|XP_002978501.1|  hypothetical protein SELMODRAFT_233128             259   1e-79    
ref|XP_002970420.1|  hypothetical protein SELMODRAFT_231526             257   7e-79    
ref|XP_002983210.1|  hypothetical protein SELMODRAFT_234195             254   8e-78    
ref|XP_002961352.1|  hypothetical protein SELMODRAFT_266598             252   7e-77    
ref|WP_036269309.1|  betaine-aldehyde dehydrogenase                     243   3e-73    Methylocaldum szegediense
ref|XP_002983288.1|  hypothetical protein SELMODRAFT_180171             243   4e-73    
ref|XP_002961274.1|  hypothetical protein SELMODRAFT_164447             243   5e-73    
gb|AAK57987.1|  T cytoplasm male sterility restorer factor 2            229   2e-72    Zea mays [maize]
gb|ABR16485.1|  unknown                                                 235   3e-70    Picea sitchensis
gb|EWM25899.1|  aldehyde dehydrogenase                                  237   6e-70    Nannochloropsis gaditana
emb|CDW77748.1|  betaine-aldehyde dehydrogenase                         233   1e-69    Stylonychia lemnae
ref|WP_036502729.1|  betaine-aldehyde dehydrogenase                     233   2e-69    Nitrosococcus oceani
ref|WP_002814365.1|  betaine-aldehyde dehydrogenase                     233   2e-69    Nitrosococcus oceani
ref|WP_013034365.1|  betaine-aldehyde dehydrogenase                     231   1e-68    Nitrosococcus halophilus
emb|CDY49384.1|  BnaA03g50730D                                          223   1e-68    Brassica napus [oilseed rape]
ref|WP_021832205.1|  Aldehyde dehydrogenase                             225   4e-68    
ref|WP_008272605.1|  betaine-aldehyde dehydrogenase                     226   5e-67    Cyanothece sp. CCY0110
ref|WP_013219586.1|  betaine-aldehyde dehydrogenase                     226   5e-67    Nitrosococcus watsonii
ref|WP_007307870.1|  betaine-aldehyde dehydrogenase                     226   7e-67    Crocosphaera watsonii
emb|CCQ61589.1|  Aldehyde dehydrogenase                                 226   7e-67    Crocosphaera watsonii WH 0401
ref|WP_015249427.1|  betaine-aldehyde dehydrogenase                     226   8e-67    Singulisphaera acidiphila
emb|CCQ69085.1|  Aldehyde dehydrogenase                                 226   9e-67    Crocosphaera watsonii WH 0402
ref|WP_007312907.1|  betaine-aldehyde dehydrogenase                     226   1e-66    Crocosphaera watsonii
gb|EJY82344.1|  hypothetical protein OXYTRI_20134                       226   1e-66    Oxytricha trifallax
ref|XP_005642981.1|  aldehyde dehydrogenase                             224   2e-66    Coccomyxa subellipsoidea C-169
ref|XP_005642984.1|  aldehyde dehydrogenase                             226   5e-66    Coccomyxa subellipsoidea C-169
ref|XP_002948098.1|  hypothetical protein VOLCADRAFT_73567              224   1e-65    Volvox carteri f. nagariensis
ref|WP_009782331.1|  betaine-aldehyde dehydrogenase                     223   1e-65    Lyngbya sp. PCC 8106
ref|WP_008181335.1|  betaine-aldehyde dehydrogenase                     222   2e-65    Moorea producens
ref|WP_023069382.1|  aldehyde dehydrogenase family protein              222   3e-65    Lyngbya aestuarii
emb|CDW85535.1|  betaine-aldehyde dehydrogenase                         217   3e-65    Stylonychia lemnae
ref|WP_009547631.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       221   6e-65    Cyanothece
ref|WP_002643666.1|  betaine-aldehyde dehydrogenase                     221   8e-65    Gimesia maris
ref|WP_036019563.1|  betaine-aldehyde dehydrogenase                     220   1e-64    
ref|WP_011612157.1|  betaine-aldehyde dehydrogenase                     220   2e-64    Trichodesmium erythraeum
gb|EKU99215.1|  NAD-dependent aldehyde dehydrogenase                    220   2e-64    Leptolyngbya sp. PCC 7375
ref|WP_013324932.1|  betaine-aldehyde dehydrogenase                     219   2e-64    Cyanothece sp. PCC 7822
ref|WP_007911497.1|  betaine-aldehyde dehydrogenase                     219   2e-64    Ktedonobacter racemifer
gb|KIZ05750.1|  aldehyde dehydrogenase (NAD+)                           220   4e-64    Monoraphidium neglectum
ref|WP_017721107.1|  betaine-aldehyde dehydrogenase                     219   5e-64    Oscillatoria sp. PCC 10802
gb|KDO82486.1|  hypothetical protein CISIN_1g009035mg                   217   5e-64    Citrus sinensis [apfelsine]
gb|EJY79302.1|  hypothetical protein OXYTRI_23427                       218   1e-63    Oxytricha trifallax
gb|KJB11463.1|  hypothetical protein B456_001G261100                    215   2e-63    Gossypium raimondii
ref|XP_001690955.1|  aldehyde dehydrogenase                             218   2e-63    Chlamydomonas reinhardtii
ref|WP_026100754.1|  betaine-aldehyde dehydrogenase                     217   2e-63    Synechococcus sp. PCC 7336
ref|XP_004711052.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    217   3e-63    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_001639716.1|  predicted protein                                  217   3e-63    Nematostella vectensis
ref|XP_009048780.1|  hypothetical protein LOTGIDRAFT_177987             216   4e-63    Lottia gigantea
ref|XP_004508854.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    214   4e-63    Cicer arietinum [garbanzo]
ref|XP_004581021.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    216   7e-63    Ochotona princeps [southern American pika]
ref|XP_003385758.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    214   7e-63    Amphimedon queenslandica
gb|KCW56066.1|  hypothetical protein EUGRSUZ_I01821                     214   7e-63    Eucalyptus grandis [rose gum]
ref|WP_010676364.1|  betaine-aldehyde dehydrogenase                     215   9e-63    Bacillus timonensis
ref|WP_017550804.1|  betaine-aldehyde dehydrogenase                     215   1e-62    Bacillus coagulans
ref|WP_014098431.1|  betaine-aldehyde dehydrogenase                     215   1e-62    Bacillus coagulans
ref|XP_004600315.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    216   1e-62    Sorex araneus [Eurasian shrew]
ref|XP_007524179.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    216   1e-62    Erinaceus europaeus [common hedgehog]
ref|XP_004747712.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    216   1e-62    
ref|XP_010967936.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    216   1e-62    
ref|WP_029141634.1|  betaine-aldehyde dehydrogenase                     215   1e-62    
gb|KIE10085.1|  betaine-aldehyde dehydrogenase                          215   1e-62    
ref|WP_017554076.1|  betaine-aldehyde dehydrogenase                     215   1e-62    
ref|WP_044747140.1|  betaine-aldehyde dehydrogenase                     215   1e-62    
ref|WP_013859232.1|  betaine-aldehyde dehydrogenase                     215   1e-62    
ref|XP_003940113.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    215   1e-62    
ref|WP_029629697.1|  betaine-aldehyde dehydrogenase                     214   2e-62    
ref|WP_018662214.1|  betaine-aldehyde dehydrogenase                     214   2e-62    
gb|EFB19337.1|  hypothetical protein PANDA_000873                       215   2e-62    
emb|CAD30313.1|  aldehyde dehydrogenase                                 214   2e-62    
ref|XP_002913100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    215   2e-62    
ref|WP_017746980.1|  betaine-aldehyde dehydrogenase                     214   3e-62    
ref|WP_008654380.1|  aldehyde dehydrogenase                             214   3e-62    
ref|WP_034410238.1|  betaine-aldehyde dehydrogenase                     214   3e-62    
ref|WP_008665861.1|  aldehyde dehydrogenase                             214   3e-62    
ref|XP_006886928.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    214   3e-62    
emb|CAD10505.1|  aldehyde dehydrogenase                                 214   3e-62    
gb|KHE90517.1|  aldehyde dehydrogenase (NAD)                            214   3e-62    
ref|XP_538742.2|  PREDICTED: aldehyde dehydrogenase X, mitochondr...    214   3e-62    
ref|WP_011122652.1|  betaine-aldehyde dehydrogenase                     214   3e-62    
ref|WP_007334248.1|  betaine-aldehyde dehydrogenase                     214   3e-62    
ref|WP_037245914.1|  betaine-aldehyde dehydrogenase                     214   4e-62    
ref|WP_035202128.1|  betaine-aldehyde dehydrogenase                     214   4e-62    
ref|XP_003785199.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    214   5e-62    
ref|WP_026683483.1|  betaine-aldehyde dehydrogenase                     213   5e-62    
ref|NP_000683.3|  aldehyde dehydrogenase X, mitochondrial precursor     214   5e-62    
ref|XP_004048099.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    214   5e-62    
ref|WP_027725052.1|  betaine-aldehyde dehydrogenase                     213   5e-62    
ref|XP_003995700.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    214   5e-62    
dbj|BAG36147.1|  unnamed protein product                                214   5e-62    
ref|WP_019721171.1|  betaine-aldehyde dehydrogenase                     213   5e-62    
ref|WP_043903379.1|  betaine-aldehyde dehydrogenase                     213   5e-62    
ref|XP_008140103.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    214   6e-62    
ref|WP_011244911.1|  betaine-aldehyde dehydrogenase                     213   6e-62    
ref|XP_008270467.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    214   6e-62    
ref|WP_025909157.1|  betaine-aldehyde dehydrogenase                     213   6e-62    
ref|XP_006842238.1|  hypothetical protein AMTR_s00078p00188120          210   7e-62    
ref|WP_019390529.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       213   7e-62    
ref|XP_005326359.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    213   8e-62    
ref|XP_004631881.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    213   8e-62    
emb|CCD74479.1|  aldehyde dehydrogenase 2B4                             204   8e-62    
ref|XP_006053036.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    214   8e-62    
ref|XP_004327205.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    213   9e-62    
ref|WP_039742627.1|  betaine-aldehyde dehydrogenase                     213   9e-62    
ref|WP_020722661.1|  betaine-aldehyde dehydrogenase                     213   1e-61    
ref|XP_006204897.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    213   1e-61    
gb|EFB16854.1|  hypothetical protein PANDA_002930                       213   1e-61    
ref|WP_006098251.1|  betaine-aldehyde dehydrogenase                     213   1e-61    
ref|XP_004271508.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    213   1e-61    
pdb|1AG8|A  Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria    213   1e-61    
ref|XP_002914982.2|  PREDICTED: aldehyde dehydrogenase X, mitocho...    213   1e-61    
ref|WP_008297989.1|  Phenylacetaldehyde dehydrogenase                   213   1e-61    
gb|EDL98822.1|  rCG55098                                                213   1e-61    
ref|NP_001127576.1|  aldehyde dehydrogenase X, mitochondrial prec...    213   1e-61    
ref|XP_009234277.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    213   2e-61    
ref|NP_001068835.1|  aldehyde dehydrogenase, mitochondrial precursor    213   2e-61    
gb|AGN03871.1|  retinol dehydrogenase 2                                 212   2e-61    
ref|XP_007118627.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    213   2e-61    
ref|XP_004392372.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    213   2e-61    
ref|XP_006735811.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    212   2e-61    
ref|XP_004017458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    213   2e-61    
ref|XP_004395895.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    213   2e-61    
ref|WP_041845367.1|  betaine-aldehyde dehydrogenase                     212   2e-61    
ref|WP_041847559.1|  betaine-aldehyde dehydrogenase                     212   2e-61    
ref|XP_008582577.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   2e-61    
ref|XP_003796031.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    212   2e-61    
ref|WP_034769244.1|  betaine-aldehyde dehydrogenase                     212   2e-61    
ref|XP_004677554.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   2e-61    
ref|WP_002654069.1|  betaine-aldehyde dehydrogenase                     212   2e-61    
ref|XP_003353634.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   2e-61    
ref|XP_004753300.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    212   3e-61    
ref|NP_001266946.1|  aldehyde dehydrogenase X, mitochondrial            212   3e-61    
gb|ABW03290.1|  aldehyde dehydrogenase 1 family, member B1              212   3e-61    
gb|AAH01619.1|  Aldehyde dehydrogenase 1 family, member B1              212   3e-61    
gb|AAP36452.1|  Homo sapiens aldehyde dehydrogenase 1 family, mem...    212   3e-61    
sp|P30837.3|AL1B1_HUMAN  RecName: Full=Aldehyde dehydrogenase X, ...    212   3e-61    
emb|CDP03348.1|  unnamed protein product                                212   3e-61    
ref|XP_003500134.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   3e-61    
ref|XP_004635977.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    212   3e-61    
ref|XP_005078799.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   3e-61    
ref|XP_002753228.2|  PREDICTED: retinal dehydrogenase 2                 205   3e-61    
ref|XP_007197093.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   3e-61    
ref|XP_008808790.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    211   4e-61    
ref|XP_006735810.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    212   4e-61    
ref|XP_004910950.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   4e-61    
ref|XP_005883979.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   4e-61    
ref|XP_002110539.1|  expressed hypothetical protein                     211   4e-61    
gb|AJF41235.1|  mitochondrial aldehyde dehydrogenase 2                  211   4e-61    
ref|XP_003805159.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   4e-61    
ref|XP_006973760.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   5e-61    
ref|XP_010926057.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    211   5e-61    
ref|XP_006096562.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    212   5e-61    
ref|NP_001011975.1|  aldehyde dehydrogenase X, mitochondrial prec...    211   5e-61    
ref|WP_035430826.1|  betaine-aldehyde dehydrogenase                     211   5e-61    
ref|XP_011450475.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    211   6e-61    
ref|WP_020062114.1|  betaine-aldehyde dehydrogenase                     211   6e-61    
ref|XP_007130063.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    211   6e-61    
ref|XP_007966861.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   7e-61    
gb|EHH23951.1|  Aldehyde dehydrogenase X, mitochondrial                 211   7e-61    
gb|EHH57231.1|  Aldehyde dehydrogenase X, mitochondrial                 211   8e-61    
ref|NP_001039196.1|  retinal dehydrogenase 2                            211   8e-61    
ref|XP_003911526.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   8e-61    
ref|XP_005581304.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   8e-61    
ref|WP_015955732.1|  betaine-aldehyde dehydrogenase                     210   8e-61    
ref|NP_001038076.1|  aldehyde dehydrogenase, mitochondrial precursor    211   8e-61    
gb|ACD02422.1|  mitochondrial aldehyde dehydrogenase 2                  211   8e-61    
ref|XP_006074312.1|  PREDICTED: retinal dehydrogenase 2-like            204   8e-61    
ref|XP_001767457.1|  predicted protein                                  211   8e-61    
ref|WP_035609083.1|  betaine-aldehyde dehydrogenase                     210   8e-61    
ref|XP_010368301.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   9e-61    
dbj|BAE30339.1|  unnamed protein product                                211   9e-61    
ref|WP_019153463.1|  betaine-aldehyde dehydrogenase                     210   1e-60    
ref|XP_005883980.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    212   1e-60    
ref|XP_007448232.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    210   1e-60    
ref|XP_002324977.1|  aldehyde dehydrogenase family protein              210   1e-60    
ref|XP_003462990.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    210   1e-60    
ref|XP_003569290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    210   1e-60    
ref|XP_006143784.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    210   1e-60    
ref|XP_009002916.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    209   1e-60    
ref|NP_733797.1|  retinal dehydrogenase 2 isoform 2                     209   1e-60    
ref|XP_003761415.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    210   1e-60    
ref|WP_000080305.1|  aldehyde dehydrogenase                             203   2e-60    
ref|WP_015783713.1|  betaine-aldehyde dehydrogenase                     209   2e-60    
gb|AIC55485.1|  ALDH1A2                                                 209   2e-60    
gb|AHM26658.1|  aldehyde dehydrogenase 2-3                              209   2e-60    
ref|XP_005996458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    210   2e-60    
ref|XP_005403230.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    210   2e-60    
ref|WP_026736388.1|  betaine-aldehyde dehydrogenase                     209   2e-60    
ref|XP_007529015.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    210   2e-60    
ref|XP_004658363.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    210   2e-60    
ref|WP_041075921.1|  betaine-aldehyde dehydrogenase                     209   2e-60    
ref|XP_005329685.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    210   2e-60    
ref|XP_008050620.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    210   2e-60    
ref|NP_001004907.1|  aldehyde dehydrogenase, mitochondrial              210   2e-60    
ref|XP_005362186.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    209   2e-60    
ref|XP_007966859.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   2e-60    
emb|CAJ83424.1|  aldehyde dehydrogenase 2 family (mitochondrial)        210   2e-60    
ref|XP_004315892.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    209   2e-60    
gb|ABO93608.1|  cytosolic aldehyde dehydrogenase                        209   2e-60    
ref|WP_036482120.1|  betaine-aldehyde dehydrogenase                     209   2e-60    
ref|XP_007966855.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   3e-60    
ref|WP_019503923.1|  betaine-aldehyde dehydrogenase                     209   3e-60    
ref|XP_007966860.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   3e-60    
ref|XP_007966858.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    211   3e-60    
ref|WP_026562048.1|  betaine-aldehyde dehydrogenase                     209   3e-60    
ref|WP_036654086.1|  betaine-aldehyde dehydrogenase                     209   3e-60    
ref|XP_004969048.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    209   3e-60    
ref|WP_026573699.1|  betaine-aldehyde dehydrogenase                     209   3e-60    
ref|XP_003994722.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    209   4e-60    
emb|CAD70567.1|  aldehyde dehydrogenase                                 209   4e-60    
ref|WP_033674165.1|  betaine-aldehyde dehydrogenase                     202   4e-60    
ref|NP_082546.1|  aldehyde dehydrogenase X, mitochondrial precursor     209   4e-60    
ref|XP_002736989.1|  PREDICTED: retinal dehydrogenase 1-like            208   4e-60    
ref|XP_005382913.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    209   4e-60    
ref|XP_001114412.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    209   4e-60    
ref|XP_010926277.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    208   4e-60    
ref|NP_001043453.1|  Os01g0591000                                       209   4e-60    
ref|XP_006865489.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    209   4e-60    
gb|EJR50331.1|  hypothetical protein IIK_01400                          202   4e-60    
ref|XP_006644328.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    208   4e-60    
ref|NP_003879.2|  retinal dehydrogenase 2 isoform 1                     209   4e-60    
gb|EMS47816.1|  Aldehyde dehydrogenase family 2 member C4               208   5e-60    
dbj|BAA34785.1|  RALDH2                                                 209   5e-60    
ref|WP_028782193.1|  betaine-aldehyde dehydrogenase                     208   5e-60    
ref|XP_002730825.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    208   5e-60    
ref|WP_004434073.1|  betaine-aldehyde dehydrogenase                     208   5e-60    
emb|CBH32543.1|  retinal dehydrogenase, putative, expressed             208   5e-60    
ref|WP_027845417.1|  betaine-aldehyde dehydrogenase                     208   5e-60    
ref|XP_006863194.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    209   5e-60    
ref|XP_010688155.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    208   6e-60    
ref|NP_001105046.1|  cytosolic aldehyde dehydrogenase RF2C              208   6e-60    
ref|XP_010602778.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    208   6e-60    
ref|XP_010926163.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    208   6e-60    
ref|WP_010896716.1|  betaine-aldehyde dehydrogenase                     208   6e-60    
ref|XP_004969047.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    208   6e-60    
ref|WP_026677159.1|  betaine-aldehyde dehydrogenase                     208   6e-60    
ref|WP_015121640.1|  NAD-dependent aldehyde dehydrogenase               207   6e-60    
ref|XP_004662559.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   7e-60    
ref|WP_042353774.1|  betaine-aldehyde dehydrogenase                     208   7e-60    
gb|AAL99608.1|AF348412_1  cytosolic aldehyde dehydrogenase RF2C         208   7e-60    
ref|XP_004421680.1|  PREDICTED: retinal dehydrogenase 2 isoform 2       207   7e-60    
ref|XP_002415064.1|  aldehyde dehydrogenase, putative                   208   7e-60    
ref|WP_017560580.1|  aldehyde dehydrogenase                             201   7e-60    
ref|XP_853628.1|  PREDICTED: aldehyde dehydrogenase, mitochondria...    208   7e-60    
ref|WP_034639974.1|  betaine-aldehyde dehydrogenase                     207   8e-60    
ref|XP_003341640.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    208   8e-60    
ref|XP_006211034.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   8e-60    
ref|WP_021327978.1|  Aldehyde Dehydrogenase                             207   8e-60    
gb|ELP34093.1|  retinal dehydrogenase                                   207   8e-60    
ref|XP_005316674.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   8e-60    
gb|EGF24028.1|  aldehyde dehydrogenase 2                                207   8e-60    
gb|EPQ18726.1|  Aldehyde dehydrogenase X, mitochondrial                 212   8e-60    
ref|XP_008775315.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    207   8e-60    
ref|XP_006744186.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   9e-60    
ref|XP_004452945.1|  PREDICTED: retinal dehydrogenase 2 isoform 2       207   1e-59    
ref|NP_571925.1|  retinal dehydrogenase 2                               208   1e-59    
ref|XP_863880.1|  PREDICTED: retinal dehydrogenase 2 isoform 2          207   1e-59    
ref|XP_007111937.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   1e-59    
ref|WP_005004742.1|  betaine-aldehyde dehydrogenase                     207   1e-59    
ref|WP_024094213.1|  putative aldehyde dehydrogenase DhaS               207   1e-59    
ref|WP_010034539.1|  betaine-aldehyde dehydrogenase                     207   1e-59    
ref|XP_004010618.1|  PREDICTED: retinal dehydrogenase 2 isoform 2       207   1e-59    
ref|XP_008845744.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    208   1e-59    
ref|XP_009248146.1|  PREDICTED: retinal dehydrogenase 2 isoform X3      207   1e-59    
ref|XP_005910502.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   1e-59    
ref|XP_006894566.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   1e-59    
ref|XP_004281483.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    207   1e-59    
gb|AAI63897.1|  Aldehyde dehydrogenase 1 family, member A2              207   1e-59    
ref|XP_007797890.1|  putative aldehyde dehydrogenase protein            208   1e-59    
gb|ACE74543.1|  retinaldehyde dehydrogenase 2                           202   1e-59    
ref|XP_004777347.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   1e-59    
ref|XP_008141411.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   1e-59    
ref|WP_026963171.1|  betaine-aldehyde dehydrogenase                     207   1e-59    
ref|XP_004578104.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      207   1e-59    
gb|ETP47697.1|  hypothetical protein F442_06403                         200   1e-59    
ref|XP_006009078.1|  PREDICTED: aldehyde dehydrogenase X, mitocho...    207   2e-59    
ref|WP_013082880.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       207   2e-59    
ref|XP_004274721.1|  PREDICTED: retinal dehydrogenase 2 isoform 2       206   2e-59    
ref|XP_007956676.1|  PREDICTED: retinal dehydrogenase 2 isoform X2      206   2e-59    



>ref|XP_009617291.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Nicotiana tomentosiformis]
Length=535

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = +3

Query  102  FPSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  281
            FPSASA LG   GV   I RFSTAAAVEE+ +P V+V +T+ +ING+FVDSASGKTFPTL
Sbjct  16   FPSASAPLGRSNGVARHINRFSTAAAVEEVTTPPVQVSFTKLLINGQFVDSASGKTFPTL  75

Query  282  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  461
            DPRTE+VIA+VAEG+AEDINRAVAAARKAFDEGPWPKMSAYERS+IM KFADLVEKH DE
Sbjct  76   DPRTEEVIANVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERSKIMFKFADLVEKHNDE  135

Query  462  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  641
            LA LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGV
Sbjct  136  LAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  195

Query  642  AGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            AGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  196  AGQIIPWNFPLLMFAWKVGPALACGNTIVLKTA  228



>ref|XP_009617290.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Nicotiana tomentosiformis]
Length=536

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 193/214 (90%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            FPSASA L G   GV   I RFSTAAAVEE+ +P V+V +T+ +ING+FVDSASGKTFPT
Sbjct  16   FPSASAPLAGRSNGVARHINRFSTAAAVEEVTTPPVQVSFTKLLINGQFVDSASGKTFPT  75

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRTE+VIA+VAEG+AEDINRAVAAARKAFDEGPWPKMSAYERS+IM KFADLVEKH D
Sbjct  76   LDPRTEEVIANVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERSKIMFKFADLVEKHND  135

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            ELA LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIG
Sbjct  136  ELAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIG  195

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  196  VAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTA  229



>ref|XP_006345041.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Solanum tuberosum]
Length=535

 Score =   367 bits (942),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +3

Query  102  FPSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  281
             PSASA LG  +GV   I RFSTAAAVEEL++P V+V +T+ +ING+FVDSASGKTFPTL
Sbjct  16   LPSASASLGRSHGVARHINRFSTAAAVEELITPPVQVNHTKLLINGQFVDSASGKTFPTL  75

Query  282  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  461
            DPRT +VIA+VAEG+ ED+NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH DE
Sbjct  76   DPRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHNDE  135

Query  462  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  641
            +A LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGV
Sbjct  136  IAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGV  195

Query  642  AGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            AGQIIPWNFPL M AWKVGPALACGNT+VLKTA
Sbjct  196  AGQIIPWNFPLLMMAWKVGPALACGNTIVLKTA  228



>ref|XP_004236119.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=535

 Score =   364 bits (934),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = +3

Query  105  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  284
            PS SA LG  +GV   I RFSTAAAVEE+++P V++ +T+ +ING+FVDSASGKTFPTLD
Sbjct  17   PSVSASLGRSHGVARHINRFSTAAAVEEIITPPVQINHTKLLINGQFVDSASGKTFPTLD  76

Query  285  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  464
            PRT +VIA+VAEG+ ED+NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH DE+
Sbjct  77   PRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHNDEI  136

Query  465  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  644
            A LETWDNGKPY QAA++E+P  VRLF YYAGWADKIHGLTVPADGPHHVQ LHEPIGVA
Sbjct  137  AALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPADGPHHVQILHEPIGVA  196

Query  645  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GQIIPWNFPL M AWKVGPALACGNT+VLKTA
Sbjct  197  GQIIPWNFPLLMMAWKVGPALACGNTIVLKTA  228



>ref|XP_010028184.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW83434.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=534

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            G  +GV S I R+STAAAVEEL+SP V++ YTQH+ING FVD+ASG+TFPT DPRT DV+
Sbjct  23   GRNHGVGSSISRYSTAAAVEELISPPVQISYTQHLINGHFVDAASGRTFPTYDPRTGDVL  82

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
            AHVAEG+A+DI+RAVAAARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+
Sbjct  83   AHVAEGDAKDIDRAVAAARKAFDEGPWPKMTAYERSRILLRFADLVEKHNDELAALETWN  142

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
             GKPYEQ+AKSELPM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  143  CGKPYEQSAKSELPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  202

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL MFAWKVGPALACGNT+VLKTA
Sbjct  203  FPLIMFAWKVGPALACGNTIVLKTA  227



>ref|XP_011071828.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Sesamum indicum]
Length=536

 Score =   362 bits (928),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 191/214 (89%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAFLGWKYGV-ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
             P++ A L  KYG+   G+QR++TA  +EE ++P V+V YT+ +ING+FVDSASGKTFPT
Sbjct  16   LPTSPASLARKYGLWGRGMQRYTTATVLEEPITPPVQVNYTKLLINGQFVDSASGKTFPT  75

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIAHVAEG+ ED+NRAV+AARKAFDEGPWPKMSAYERSRI+L+FADLVEKHM 
Sbjct  76   LDPRTGEVIAHVAEGDVEDVNRAVSAARKAFDEGPWPKMSAYERSRIILRFADLVEKHMQ  135

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            ELA LETWDNGKPYEQA  +ELP+ VRLFHYYAGWADKIHGLTVPADGPHHVQ LHEPIG
Sbjct  136  ELAQLETWDNGKPYEQALTAELPLFVRLFHYYAGWADKIHGLTVPADGPHHVQVLHEPIG  195

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL M+AWKVGPALACGNT+VLK+A
Sbjct  196  VAGQIIPWNFPLLMYAWKVGPALACGNTIVLKSA  229



>gb|AFK41217.1| unknown [Lotus japonicus]
Length=543

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 186/205 (91%), Gaps = 3/205 (1%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            GW+    S   R+STAA VEEL++P V + YTQH+INGKFVD+ASGKTFP  DPRT DVI
Sbjct  35   GWR---NSNSHRYSTAAEVEELITPQVSINYTQHLINGKFVDAASGKTFPAYDPRTGDVI  91

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
            AHVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADLVEKH DE+A LETW+
Sbjct  92   AHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLVEKHNDEIAALETWN  151

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
            NGKPYEQAAK+E+PM+VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  152  NGKPYEQAAKAEVPMLVRLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  211

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL MFAWKVGPALACGNT+VLKTA
Sbjct  212  FPLIMFAWKVGPALACGNTIVLKTA  236



>gb|KJB53132.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=451

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  156  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAWKV
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLIMFAWKV  219

Query  696  GPALACGNTVVLKTA  740
            GPALACGNT+VLKTA
Sbjct  220  GPALACGNTIVLKTA  234



>emb|CDP18933.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 188/211 (89%), Gaps = 1/211 (0%)
 Frame = +3

Query  111  ASAFLGWKYGVESGIQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  287
            +S+F G  YGV SG+ RFSTA AAVEE +SP V++ YT+ +ING+FVDSASGKTFPTLDP
Sbjct  17   SSSFRGANYGVVSGMNRFSTATAAVEEPISPPVQINYTKLLINGQFVDSASGKTFPTLDP  76

Query  288  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  467
            RT +VIAHVAEG+ EDINRAV+AARKAFDEGPWPKM AYER+R++L+FADLVEKH DELA
Sbjct  77   RTGEVIAHVAEGDTEDINRAVSAARKAFDEGPWPKMPAYERARVLLRFADLVEKHSDELA  136

Query  468  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  647
             LETWDNGK YEQAA +ELP  VRLFHYYAGWADKIHGLT PADGPHHVQ LHEPIGVAG
Sbjct  137  ALETWDNGKTYEQAATAELPTFVRLFHYYAGWADKIHGLTAPADGPHHVQILHEPIGVAG  196

Query  648  QIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            QIIPWNFPL MFAWK+GPALA GNTVVLKTA
Sbjct  197  QIIPWNFPLLMFAWKIGPALATGNTVVLKTA  227



>gb|KHN18468.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=542

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 186/205 (91%), Gaps = 5/205 (2%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            GW+      I RFSTAAAVEEL++P V ++YTQ++ING+FVD+ASGKTFPT DPR+ +VI
Sbjct  36   GWR-----NINRFSTAAAVEELITPQVSIRYTQNLINGQFVDAASGKTFPTYDPRSGEVI  90

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
            A VAEG+ EDINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+
Sbjct  91   AKVAEGDVEDINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWN  150

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
            NGK YEQAAK+ELPM VRLFHYYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  151  NGKTYEQAAKTELPMFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPWN  210

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL MFAWKVGPALACGNT+VLKTA
Sbjct  211  FPLVMFAWKVGPALACGNTIVLKTA  235



>gb|AFW86313.1| restorer of fertility2 [Zea mays]
Length=459

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AWK
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTLVLKTA  242



>gb|KJB53133.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=530

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  156  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAWKV
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLIMFAWKV  219

Query  696  GPALACGNTVVLKTA  740
            GPALACGNT+VLKTA
Sbjct  220  GPALACGNTIVLKTA  234



>ref|XP_007155410.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27404.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=535

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I RFSTAAAVE+L++P V ++YTQH+ING+FVD+ASGKTFP  DPR+ +VIA+VAEG+ E
Sbjct  33   INRFSTAAAVEDLITPQVPIRYTQHLINGQFVDAASGKTFPAYDPRSGEVIANVAEGDVE  92

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+NGKP+EQAA
Sbjct  93   DINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWNNGKPFEQAA  152

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            KSELP+ VRLFHYYAGWADKIHGLTVPADG +HVQTLHEP+GVAGQIIPWNFPL MFAWK
Sbjct  153  KSELPLFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPVGVAGQIIPWNFPLIMFAWK  212

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  213  VGPALACGNTIVLKTA  228



>gb|KJB53131.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=541

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  156  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  40   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  99

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQ+AK
Sbjct  100  IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAK  159

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
            SELPM +RLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAWKV
Sbjct  160  SELPMFIRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLIMFAWKV  219

Query  696  GPALACGNTVVLKTA  740
            GPALACGNT+VLKTA
Sbjct  220  GPALACGNTIVLKTA  234



>ref|XP_007155411.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27405.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=536

 Score =   357 bits (916),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I RFSTAAAVE+L++P V ++YTQH+ING+FVD+ASGKTFP  DPR+ +VIA+VAEG+ E
Sbjct  34   INRFSTAAAVEDLITPQVPIRYTQHLINGQFVDAASGKTFPAYDPRSGEVIANVAEGDVE  93

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV+AARKAFDEGPWPKM+AYERSRI+L+FADLVEKH DELA LETW+NGKP+EQAA
Sbjct  94   DINRAVSAARKAFDEGPWPKMTAYERSRILLRFADLVEKHSDELAALETWNNGKPFEQAA  153

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            KSELP+ VRLFHYYAGWADKIHGLTVPADG +HVQTLHEP+GVAGQIIPWNFPL MFAWK
Sbjct  154  KSELPLFVRLFHYYAGWADKIHGLTVPADGDYHVQTLHEPVGVAGQIIPWNFPLIMFAWK  213

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  214  VGPALACGNTIVLKTA  229



>gb|AHM26656.1| aldehyde dehydrogenase 2-1 [Zea mays subsp. mays]
Length=549

 Score =   357 bits (915),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMFAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTLVLKTA  242



>dbj|BAB92019.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=547

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAAAVEE ++P+V+V YT+ +ING FVD+ASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  45   LQRFSTAAAVEEPITPSVQVNYTKLLINGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAE  104

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  105  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  164

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  165  HIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQILHEPIGVAGQIIPWNFPLLMFAWK  224

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  225  VGPALACGNTLVLKTA  240



>gb|AAK58370.1|AF269064_1 T-cytoplasm male sterility restorer factor 2 [Zea mays]
Length=549

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AWK
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTLVLKTA  242



>gb|AAO72532.1| aldehyde dehydrogenase 1 precursor [Lotus corniculatus]
Length=542

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 184/205 (90%), Gaps = 4/205 (2%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            GW+    +   R+STAA VEEL++P V + YTQH+INGKFVD+ASGKTFP  DPRT DVI
Sbjct  35   GWR----NSNNRYSTAAVVEELITPQVSINYTQHLINGKFVDAASGKTFPAYDPRTGDVI  90

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
            AHVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADLVEKH DE+A LETW+
Sbjct  91   AHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLVEKHNDEIAALETWN  150

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
            NGKPYEQAAK+E+P  VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct  151  NGKPYEQAAKAEVPTFVRLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN  210

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL MFAWKVGPALACGNT+VLKTA
Sbjct  211  FPLLMFAWKVGPALACGNTIVLKTA  235



>ref|NP_001105891.1| mitochondrial aldehyde dehydrogenase 2 [Zea mays]
 gb|AAG43988.1|AF215823_1 T cytoplasm male sterility restorer factor 2 [Zea mays]
 gb|AAC49371.1| RF2 [Zea mays]
 gb|ACG38026.1| aldehyde dehydrogenase [Zea mays]
 gb|ACN28554.1| unknown [Zea mays]
 gb|AFW86312.1| restorer of fertility2 [Zea mays]
Length=549

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AWK
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTLVLKTA  242



>gb|KDP26565.1| hypothetical protein JCGZ_17723 [Jatropha curcas]
Length=537

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 187/213 (88%), Gaps = 2/213 (1%)
 Frame = +3

Query  108  SASAFL--GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  281
            S SA    G    +  GI R+STAAAVEE + P+V V +TQ +ING+FVD+ASGKTFPTL
Sbjct  18   SGSALFSRGSNSSLARGISRYSTAAAVEEPIVPSVSVSHTQLLINGQFVDAASGKTFPTL  77

Query  282  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  461
            DPRT +VIAHVAEG+ EDINRAV+AARKAFDEGPWPKM+AYERSRIML+FADL+E H DE
Sbjct  78   DPRTGEVIAHVAEGDVEDINRAVSAARKAFDEGPWPKMTAYERSRIMLRFADLLEMHNDE  137

Query  462  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  641
            +A LETWDNGKPYEQAAK+E+PM+ RLF YYAGWADKIHGLTVPADG HHVQTLHEPIGV
Sbjct  138  IAALETWDNGKPYEQAAKAEIPMVARLFRYYAGWADKIHGLTVPADGQHHVQTLHEPIGV  197

Query  642  AGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            AGQIIPWNFPL M+AWKVGPALACGNTVV+KTA
Sbjct  198  AGQIIPWNFPLLMYAWKVGPALACGNTVVIKTA  230



>ref|XP_007210569.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
 gb|EMJ11768.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
Length=543

 Score =   354 bits (909),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + RFSTAAA EEL+ P V++ +TQH+ING+FVD+ASGKTFPT DPRT +VIAHVAEG+AE
Sbjct  41   VNRFSTAAATEELIIPPVQISHTQHLINGQFVDAASGKTFPTYDPRTGEVIAHVAEGDAE  100

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKPYEQA 
Sbjct  101  DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPYEQAL  160

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
             +E+PM+ RLFHYYAGWADKIHGLTVPADG +H+QTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  161  HAEIPMLARLFHYYAGWADKIHGLTVPADGKYHIQTLHEPIGVAGQIIPWNFPLLMFAWK  220

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  221  VGPALACGNTIVLKTA  236



>ref|XP_003608978.1| Mitochondrial aldehyde dehydrogenase [Medicago truncatula]
Length=544

 Score =   354 bits (908),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG K        RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +V
Sbjct  32   LGRKSEGLINTNRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEV  91

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHVAEG+AEDINRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W
Sbjct  92   IAHVAEGDAEDINRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAW  151

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            +NGK YEQAAK+E+PM VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPW
Sbjct  152  NNGKLYEQAAKAEVPMFVRLFRYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPW  211

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL MFAWKVGPALACGNT+VLKTA
Sbjct  212  NFPLLMFAWKVGPALACGNTIVLKTA  237



>gb|AES91175.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=544

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG K        RFSTAAAV+EL++P V + YTQH+INGKFVD+ASGKTFPTLDPRT +V
Sbjct  32   LGRKSEGLINTNRFSTAAAVQELITPQVSINYTQHLINGKFVDAASGKTFPTLDPRTGEV  91

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHVAEG+AEDINRAV+AAR+AFD GPWPKMSAYER RI+L+FADLVEKH DE+A LE W
Sbjct  92   IAHVAEGDAEDINRAVSAAREAFDNGPWPKMSAYERCRILLRFADLVEKHNDEIAALEAW  151

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            +NGK YEQAAK+E+PM VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPW
Sbjct  152  NNGKLYEQAAKAEVPMFVRLFRYYAGWADKIHGLTVPADGDYHVQTLHEPIGVAGQIIPW  211

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL MFAWKVGPALACGNT+VLKTA
Sbjct  212  NFPLLMFAWKVGPALACGNTIVLKTA  237



>gb|AAZ79355.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=537

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 185/210 (88%), Gaps = 1/210 (0%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  290
            S  LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPR
Sbjct  21   SLSLGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPR  80

Query  291  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  470
            T +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA 
Sbjct  81   TGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAA  140

Query  471  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  650
            LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQ
Sbjct  141  LETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQ  200

Query  651  IIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  201  IIPWNFPLMMFAWKVGPALACGNTIVLKTA  230



>emb|CAN63005.1| hypothetical protein VITISV_013710 [Vitis vinifera]
Length=538

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  296
            LG  +     I RFSTAAA  VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT 
Sbjct  24   LGKNFNRGKSIHRFSTAAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTG  83

Query  297  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  476
            +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LE
Sbjct  84   EVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALE  143

Query  477  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  656
            TW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQII
Sbjct  144  TWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQII  203

Query  657  PWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  204  PWNFPLMMFAWKVGPALACGNTIVLKTA  231



>ref|XP_002283132.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI15054.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  296
            LG  +     I RFSTAAA  VEEL++P V++ YTQ +ING+FVD+ASGKTFPT DPRT 
Sbjct  24   LGKNFNRGKSIHRFSTAAAAAVEELITPTVQINYTQLLINGQFVDAASGKTFPTFDPRTG  83

Query  297  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  476
            +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA LE
Sbjct  84   EVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALE  143

Query  477  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  656
            TW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQII
Sbjct  144  TWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQII  203

Query  657  PWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  204  PWNFPLMMFAWKVGPALACGNTIVLKTA  231



>ref|XP_004138115.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
 gb|KGN63591.1| hypothetical protein Csa_1G005520 [Cucumis sativus]
Length=548

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 187/210 (89%), Gaps = 8/210 (4%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  290
            S FLG  YG       FST+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  39   SRFLGRGYG-------FSTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  91

Query  291  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  470
            T +VIAHVAEG+AED+NRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  92   TGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHTPELSA  151

Query  471  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  650
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  152  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  211

Query  651  IIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IIPWNFPL MFAWKVGPALACGNTVVLKTA
Sbjct  212  IIPWNFPLIMFAWKVGPALACGNTVVLKTA  241



>ref|XP_008374451.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Malus domestica]
Length=539

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + RFSTAAA EEL+ P V++ +TQH+INGKFVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  37   VSRFSTAAATEELIIPPVQISHTQHLINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  96

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEK+ +ELA LETW+NGK YEQA 
Sbjct  97   DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKNSEELAALETWNNGKTYEQAL  156

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
             +ELPM+ RLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  157  TAELPMLARLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  216

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLK+A
Sbjct  217  VGPALACGNTIVLKSA  232



>gb|KHG08400.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=540

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  156  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            +RFSTAAA+E+L+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT DVIA+VAEG+AED
Sbjct  39   KRFSTAAALEDLIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAED  98

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            I+RAVAAARKAFDEGPWPKM+ YERSRIML+FADLVEKH +ELA LETW+NGKP+EQAAK
Sbjct  99   IDRAVAAARKAFDEGPWPKMTPYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQAAK  158

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
            SELPM +RLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQIIPWNFPL MFAWKV
Sbjct  159  SELPMFIRLFHYYAGWADKIHGLTVPADGHHHVQILHEPIGVAGQIIPWNFPLLMFAWKV  218

Query  696  GPALACGNTVVLKTA  740
            GPALACGNT+VLKTA
Sbjct  219  GPALACGNTIVLKTA  233



>ref|XP_004155012.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=549

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 187/210 (89%), Gaps = 8/210 (4%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  290
            S FLG  YG       FST+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  39   SRFLGRGYG-------FSTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  91

Query  291  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  470
            T +VIAHVAEG+AED+NRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  92   TGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHTPELSA  151

Query  471  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  650
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  152  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  211

Query  651  IIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IIPWNFPL MFAWKVGPALACGNTVVLKTA
Sbjct  212  IIPWNFPLIMFAWKVGPALACGNTVVLKTA  241



>ref|XP_008239742.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Prunus mume]
Length=537

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + RFSTAAA EEL+ P V++ +TQH+ING+FVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  35   VNRFSTAAATEELIIPPVQISHTQHLINGQFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKPYEQA 
Sbjct  95   DINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPYEQAL  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
             +ELPM+ RLFHYYAGWADKIHGLTVPADG +H+QTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  155  HAELPMLARLFHYYAGWADKIHGLTVPADGKYHIQTLHEPIGVAGQIIPWNFPLLMFAWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLK+A
Sbjct  215  VGPALACGNTIVLKSA  230



>ref|XP_010678738.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=534

 Score =   352 bits (902),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + RFST +A+E+ + P V++K+TQ +ING FVD+ASGKTFPT DPRT DVI HVAEG+AE
Sbjct  32   LSRFSTTSALEDPIIPNVDIKHTQLLINGNFVDAASGKTFPTYDPRTGDVITHVAEGDAE  91

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKM+AYER+RI+L+FADLVE+H +ELA LETWDNGKP++QA+
Sbjct  92   DINRAVAAARKAFDEGPWPKMTAYERARIILRFADLVEQHSEELAALETWDNGKPFQQAS  151

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            KSELP+ VRLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  152  KSELPLFVRLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLIMFAWK  211

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  212  VGPALACGNTIVLKTA  227



>ref|XP_010101190.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB87864.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=546

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  147  SGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  326
            + I RFST+ A EE + P VE+ YT+H+ING FVD+ASGKTFPT DPRTE+VIAHVAEG+
Sbjct  42   NSITRFSTSVAAEEAIIPPVEIAYTKHLINGHFVDAASGKTFPTYDPRTEEVIAHVAEGD  101

Query  327  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  506
            AEDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADLVEKH DE+A LETW+NGKPYEQ
Sbjct  102  AEDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHNDEIAALETWNNGKPYEQ  161

Query  507  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
            AA SE+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGV GQIIPWNFPL MFA
Sbjct  162  AATSEVPMLARLFRYYAGWADKIHGLTVPADGKYHVQTLHEPIGVTGQIIPWNFPLLMFA  221

Query  687  WKVGPALACGNTVVLKTA  740
            WKVGPALACGN +V+KTA
Sbjct  222  WKVGPALACGNAIVIKTA  239



>emb|CDP00179.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 187/211 (89%), Gaps = 1/211 (0%)
 Frame = +3

Query  111  ASAFLGWKYGVES-GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  287
            AS   G K   ++  I R+STAAA+EE + P V V+YT+ +ING+FVD+ASGKTFPTLDP
Sbjct  21   ASRLTGGKSACQARAISRYSTAAALEEPIKPPVNVEYTKLLINGQFVDAASGKTFPTLDP  80

Query  288  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  467
            RT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPK++AY+R RI+L+FADLVEKH DE+A
Sbjct  81   RTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKLTAYDRQRILLRFADLVEKHNDEIA  140

Query  468  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  647
             LETWDNGKPYEQAAK E+PM VRL  YYAGWADKIHG+TVPADGP+HVQTLHEPIGVAG
Sbjct  141  ALETWDNGKPYEQAAKIEVPMFVRLMRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVAG  200

Query  648  QIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            QIIPWNFPL M+AWKVGPALACGNTVVLKTA
Sbjct  201  QIIPWNFPLLMYAWKVGPALACGNTVVLKTA  231



>gb|AAF73828.1|AF162665_1 aldehyde dehydrogenase [Oryza sativa]
Length=549

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  167  QIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNTVVLKTA
Sbjct  227  VGPALACGNTVVLKTA  242



>ref|XP_010251301.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=534

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG       GI RFSTA A EE+++P V+V++TQ +ING+FVD+ASG+TFPTLDPRT +V
Sbjct  22   LGRNSSWSRGIYRFSTATATEEVITPPVQVEHTQLLINGQFVDAASGRTFPTLDPRTGEV  81

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHVAEGE EDINRAV+AARKAFDEGPWPKM+AYERSRI+ +FADL+EKH DE+A +ETW
Sbjct  82   IAHVAEGEDEDINRAVSAARKAFDEGPWPKMTAYERSRIIYRFADLLEKHNDEIAAIETW  141

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            DNGKPYEQ+AK E+PM+ RLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPW
Sbjct  142  DNGKPYEQSAKVEIPMLTRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPW  201

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL M+AWKVGPALACGN VVLKTA
Sbjct  202  NFPLLMYAWKVGPALACGNAVVLKTA  227



>ref|XP_004965205.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Setaria italica]
Length=549

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAA  EE +SP V+V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+NRAVAAARKAFD GPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  107  DVNRAVAAARKAFDVGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  167  HIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTLVLKTA  242



>ref|NP_001057358.1| Os06g0270900 [Oryza sativa Japonica Group]
 dbj|BAB19052.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAD54414.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAF19272.1| Os06g0270900 [Oryza sativa Japonica Group]
 gb|EAZ36586.1| hypothetical protein OsJ_20928 [Oryza sativa Japonica Group]
 dbj|BAG93278.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94020.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99957.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98432.1| aldehyde dehydrogenase, partial [Oryza sativa]
Length=549

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNTVVLKTA
Sbjct  227  VGPALACGNTVVLKTA  242



>gb|EAZ00462.1| hypothetical protein OsI_22484 [Oryza sativa Indica Group]
Length=549

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTLDPRT ++IAHVAEG+AE
Sbjct  47   LQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPY QAA
Sbjct  107  DINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNTVVLKTA
Sbjct  227  VGPALACGNTVVLKTA  242



>ref|XP_008221788.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Prunus mume]
Length=534

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 188/214 (88%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAF-LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            F SAS F  G    V  GI ++ST A+ E  + P+V+V YTQ +ING+FVD+ASGKTFPT
Sbjct  14   FTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTQLLINGQFVDAASGKTFPT  73

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIAHVAEG++EDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADLVEKH D
Sbjct  74   LDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLVEKHND  133

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+ATLETWDNGKP+EQAAK+E+PMIVR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL MFAWKV PALACGNTVVLKTA
Sbjct  194  VAGQIIPWNFPLLMFAWKVAPALACGNTVVLKTA  227



>ref|XP_010546022.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Tarenaya hassleriana]
Length=539

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = +3

Query  165  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  344
            +TAAAVEE+++P V+V YTQH+ING FVDSASGKTFPTLDPRT +VIAHVAEG+AEDI+R
Sbjct  41   TTAAAVEEIINPPVQVSYTQHLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDIDR  100

Query  345  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  524
            AV AARKAFDEGPWPKM AYERSRI+L+FADLVEK+ +ELA LETWDNGKPYEQ++KSE+
Sbjct  101  AVKAARKAFDEGPWPKMPAYERSRILLRFADLVEKNSEELAILETWDNGKPYEQSSKSEI  160

Query  525  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA  704
            PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWKVGPA
Sbjct  161  PMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPA  220

Query  705  LACGNTVVLKTA  740
            LACGNT+VLKTA
Sbjct  221  LACGNTLVLKTA  232



>ref|XP_007036177.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
 gb|EOY20678.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
Length=567

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I+R ST+ A+EEL+ P V++ YTQ++I+GKFVD+ASGKTFPT DPRT +VIAHVAEG+AE
Sbjct  38   IKRLSTSTALEELIVPPVQIAYTQNLIDGKFVDAASGKTFPTYDPRTGEVIAHVAEGDAE  97

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+NRAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DELA LETW+NGK +EQAA
Sbjct  98   DVNRAVAAARKAFDEGPWPKMTPYERSRILLRFADLVEKHSDELAALETWNNGKLHEQAA  157

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K+ELP+++RLFHYYAGWADKIHGLTVPADG HHVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  158  KAELPLLIRLFHYYAGWADKIHGLTVPADGNHHVQTLHEPIGVAGQIIPWNFPLLMFAWK  217

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  218  VGPALACGNTIVLKTA  233



>ref|XP_002877590.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53849.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RF T++A EE+++P+V+V +TQ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEEIINPSVQVSHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  155  TVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  215  VGPALACGNTIVLKTA  230



>ref|XP_009363534.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   349 bits (895),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 189/214 (88%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAFL-GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            F SAS F  G    V  GI ++ST A++E  +SP+V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASMFSKGRSSSVVRGIGKYSTDASIESPISPSVKVNYTQLLINGQFVDSASGKTFPT  73

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++L+FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLLRFADLIEKHND  133

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+A LETWDNGKP+EQAAK E+PM+VR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMVVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL +FAWKV PALACGNT+VLK++
Sbjct  194  VAGQIIPWNFPLLLFAWKVAPALACGNTIVLKSS  227



>ref|XP_009391259.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   349 bits (895),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 188/214 (88%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAFLGWKYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            F S +A L  K G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPT
Sbjct  12   FRSLAAPLFRKDGSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPT  71

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPR+ +VIA VAEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH D
Sbjct  72   LDPRSGEVIAQVAEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHND  131

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+A LETWDNGKP+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIG
Sbjct  132  EIAALETWDNGKPFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIG  191

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL M+AWKVGPALACGNT+VLKTA
Sbjct  192  VAGQIIPWNFPLLMYAWKVGPALACGNTIVLKTA  225



>ref|XP_010914166.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=571

 Score =   350 bits (897),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTA AVEE ++P V+V +TQ +ING+FVD+ASGKTFPTLDPRT ++IAHVAEG+ E
Sbjct  69   LQRFSTAVAVEEPITPPVQVHHTQLLINGQFVDAASGKTFPTLDPRTGEMIAHVAEGDVE  128

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+NRAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DE+A LETWDNGKPYEQAA
Sbjct  129  DVNRAVAAARKAFDEGPWPKMTGYERSRILLRFADLVEKHNDEIAALETWDNGKPYEQAA  188

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  189  NVEVPMLVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWK  248

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLK+A
Sbjct  249  VGPALACGNTIVLKSA  264



>ref|XP_010426271.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   348 bits (894),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGN++VLKTA
Sbjct  215  VGPALACGNSIVLKTA  230



>ref|XP_010503421.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGN++VLKTA
Sbjct  215  VGPALACGNSIVLKTA  230



>ref|XP_007221800.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
 gb|EMJ22999.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
Length=534

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 188/214 (88%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAF-LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            F SAS F  G    V  GI ++ST A+ E  + P+V+V YT+ +ING+FVD+ASGKTFPT
Sbjct  14   FTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTRLLINGQFVDAASGKTFPT  73

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIAHVAEG++EDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADLVEKH D
Sbjct  74   LDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLVEKHND  133

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+ATLETWDNGKP+EQAAK+E+PMIVR F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL MFAWKV PALACGNTVVLKTA
Sbjct  194  VAGQIIPWNFPLLMFAWKVAPALACGNTVVLKTA  227



>ref|XP_010928601.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RFSTAAAVEE ++P V+V++TQ +ING+FVD+ASGKTFPTLDPRT DVIA VAEG+AE
Sbjct  41   LRRFSTAAAVEEHITPPVDVQHTQLLINGQFVDAASGKTFPTLDPRTGDVIACVAEGDAE  100

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  101  DINRAVAAARKAFDEGPWPRMTAYERSRILLRFADLMEKHNDEIAALETWDNGKPYEQSA  160

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM++RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL MF WK
Sbjct  161  NIEVPMLIRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMFGWK  220

Query  693  VGPALACGNTVVLKTA  740
            +GPALACGNT+VLKTA
Sbjct  221  IGPALACGNTIVLKTA  236



>ref|XP_004297642.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=535

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 189/215 (88%), Gaps = 2/215 (1%)
 Frame = +3

Query  102  FPSASAFLGWKYGVESGIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFP  275
            F SAS+F   +  V  GI ++STAAA  VE+ ++P V+V +T+ +ING FVD+ASGKTFP
Sbjct  14   FTSASSFSKGRSSVSRGIGKYSTAAAAAVEDPITPPVKVGHTKLLINGHFVDAASGKTFP  73

Query  276  TLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHM  455
            TLDPRT DVIAHVAEG+AED++RAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EKH 
Sbjct  74   TLDPRTGDVIAHVAEGDAEDVDRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHN  133

Query  456  DELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPI  635
            DELA LETWDNGKP+EQ+AK E+PM+ R F YYAG+ADKIHGLTVPADGP+HVQTLHEPI
Sbjct  134  DELAALETWDNGKPFEQSAKIEIPMVARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPI  193

Query  636  GVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GVAGQIIPWNFPL MFAWKV PALACGNT+VLKTA
Sbjct  194  GVAGQIIPWNFPLVMFAWKVAPALACGNTIVLKTA  228



>ref|XP_010682576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            G    V  G+QR+STAAA++E ++P VEV YT+ +ING+FVD+ASGKTF T+DPRT +VI
Sbjct  23   GRSSCVRRGLQRYSTAAAIDEPITPPVEVNYTKLLINGQFVDAASGKTFHTVDPRTGNVI  82

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
            A VAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSRI+L+ ADL+EKH D +A LETWD
Sbjct  83   ADVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRILLRGADLIEKHNDVIAALETWD  142

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
            NGKPYEQ+AK E+PM+VRLF YYAGWADKIHGLT PADGP+HVQTLHEPIGVAGQIIPWN
Sbjct  143  NGKPYEQSAKVEIPMLVRLFRYYAGWADKIHGLTCPADGPYHVQTLHEPIGVAGQIIPWN  202

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL MFAWKVGPALACGN+VVLK+A
Sbjct  203  FPLLMFAWKVGPALACGNSVVLKSA  227



>ref|XP_008793883.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=540

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RFSTA AVEE ++P V+V+ TQ +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct  38   LRRFSTAVAVEEPIAPPVQVQCTQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAE  97

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+NRAVAAAR+AFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  98   DVNRAVAAAREAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  157

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YY GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MF WK
Sbjct  158  NLEVPMLTRLMRYYGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFGWK  217

Query  693  VGPALACGNTVVLKTA  740
            +GPALACGNTVVLKTA
Sbjct  218  IGPALACGNTVVLKTA  233



>emb|CDY36910.1| BnaA06g16950D [Brassica napus]
Length=539

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 190/218 (87%), Gaps = 5/218 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  266
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  15   FSASSPFLSRSQGKNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  74

Query  267  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  446
            TFPTLDPRT +VIAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  75   TFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  134

Query  447  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  626
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  135  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  194

Query  627  EPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            EPIGVAGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  195  EPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTA  232



>ref|XP_009149853.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Brassica rapa]
Length=539

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 190/218 (87%), Gaps = 5/218 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  266
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  15   FSASSPFLSRSQGRNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  74

Query  267  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  446
            TFPTLDPRT +VIAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  75   TFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  134

Query  447  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  626
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  135  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  194

Query  627  EPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            EPIGVAGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  195  EPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTA  232



>ref|XP_010515110.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Camelina sativa]
Length=537

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RF T++A EEL+SP+V+V +TQ +I+G FVDSASG+TFPTLDPRT +VIAHVAEG+AE
Sbjct  35   LRRFGTSSAAEELISPSVQVSHTQLLIDGNFVDSASGQTFPTLDPRTGEVIAHVAEGDAE  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGN++VLKTA
Sbjct  215  VGPALACGNSIVLKTA  230



>ref|XP_007153639.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
 gb|ESW25633.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
Length=535

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + ++STAAA+EE + PAV+V+YTQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +E
Sbjct  33   LCKYSTAAAIEEPIKPAVQVEYTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSE  92

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+RAVAAARKAFD GPWP+M+AYER RI+L+ ADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  93   DIDRAVAAARKAFDHGPWPRMTAYERQRILLRAADLIEKHNDEIAALETWDNGKPYEQSA  152

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  153  KIEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAWK  212

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  213  VGPALACGNTIVLKTA  228



>emb|CDY44985.1| BnaCnng12150D [Brassica napus]
Length=538

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 190/218 (87%), Gaps = 5/218 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYG--VESG---IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGK  266
            F ++S FL    G  + +G   ++RF T++A EE++SP+V+V YT+ +I+G FVD+ASGK
Sbjct  14   FSASSPFLSRSQGRNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKLLIDGNFVDAASGK  73

Query  267  TFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVE  446
            TFPTLDPRT +VIAHVAEG+AED+NRAV AARKAFDEGPWPKM+AYERSR+ML+FADLVE
Sbjct  74   TFPTLDPRTGEVIAHVAEGDAEDVNRAVKAARKAFDEGPWPKMTAYERSRVMLRFADLVE  133

Query  447  KHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLH  626
            KH +ELA LE+WDNGK YEQA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLH
Sbjct  134  KHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLTVPADGNYHVQTLH  193

Query  627  EPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            EPIGVAGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  194  EPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTA  231



>ref|XP_008453101.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis melo]
Length=554

 Score =   347 bits (891),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 8/210 (4%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  290
            S FLG   G       F T+A A EEL++P V++ YTQ++ING+FVDSASGKTFPT DPR
Sbjct  45   SRFLGRGNG-------FGTSALAEEELITPPVQINYTQNLINGQFVDSASGKTFPTYDPR  97

Query  291  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  470
            T +VIAHVAEG+AEDINRAV+AARKAFDEGPWP+MSAYERSRI+L+FADL+EKH  EL+ 
Sbjct  98   TGEVIAHVAEGDAEDINRAVSAARKAFDEGPWPRMSAYERSRILLRFADLIEKHAPELSA  157

Query  471  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  650
            LETW+NGKPYEQ+ KSELP++VRLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQ
Sbjct  158  LETWNNGKPYEQSLKSELPLLVRLFHYYAGWADKIHGLTVPADGNHHVQVLHEPIGVAGQ  217

Query  651  IIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  218  IIPWNFPLIMFAWKVGPALACGNTIVLKTA  247



>ref|XP_002511424.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF52026.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=534

 Score =   347 bits (889),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I RFSTAA  EE ++P V++ YTQH ING+FVD+ASGKTFP  DPRT  VIA VAEG+AE
Sbjct  32   IYRFSTAAVAEEPITPPVQISYTQHFINGQFVDAASGKTFPAYDPRTGQVIAQVAEGDAE  91

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FA+LVEK+ DELA LETW+NGKPYEQ+A
Sbjct  92   DINRAVAAARKAFDEGPWPKMTAYERSRIILRFAELVEKNNDELAALETWNNGKPYEQSA  151

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            KSELP++ RLFHYYAGWADKIHGLTVPADG HHVQ LHEPIGVAGQIIPWNFPL +FAWK
Sbjct  152  KSELPLLSRLFHYYAGWADKIHGLTVPADGNHHVQILHEPIGVAGQIIPWNFPLILFAWK  211

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  212  VGPALACGNTIVLKTA  227



>ref|XP_009363532.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   347 bits (889),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 186/214 (87%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAF-LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            F SAS F  G    V  GI ++ST A++E  +SP V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASLFSKGRTSSVVRGIGKYSTDASIESPISPTVKVNYTQLLINGQFVDSASGKTFPT  73

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHND  133

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+A LETWDNGKP+EQAAK E+PM+ R F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMLARFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL MFAWKV PALACGNT+VLK+A
Sbjct  194  VAGQIIPWNFPLLMFAWKVAPALACGNTIVLKSA  227



>ref|XP_008389628.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Malus domestica]
Length=534

 Score =   346 bits (888),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 187/214 (87%), Gaps = 1/214 (0%)
 Frame = +3

Query  102  FPSASAFLGWKYG-VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            F SAS F   +   V  GI ++ST A++E  +SP+V+V YTQ +ING+FVDSASGKTFPT
Sbjct  14   FTSASMFSKXRSSSVVRGIGKYSTDASIESPISPSVKVNYTQLLINGQFVDSASGKTFPT  73

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIAHVAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+EKH D
Sbjct  74   LDPRTGEVIAHVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIEKHND  133

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+A LETWDNGKP+EQAAK E+PM+ R F YYAG+ADKIHGLTVPADG +HVQTLHEPIG
Sbjct  134  EIAALETWDNGKPFEQAAKIEVPMVARFFRYYAGFADKIHGLTVPADGEYHVQTLHEPIG  193

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL MFAWKV PALACGNT+VLK+A
Sbjct  194  VAGQIIPWNFPLLMFAWKVAPALACGNTIVLKSA  227



>ref|XP_006404308.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
 dbj|BAJ34644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45761.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
Length=538

 Score =   346 bits (888),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  156  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            +RF T++A EE++SP+V+V +TQ +I+G FVD+ASGKTFPTLDPRT +VIAHVAEG+AED
Sbjct  37   RRFGTSSAAEEIISPSVQVSHTQLLIDGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAED  96

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            INRAV AARKAFDEGPWPKM+AYERSRIML+FADLVEKH ++LA+LE+WDNGK YEQA  
Sbjct  97   INRAVKAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHSEQLASLESWDNGKTYEQAKT  156

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
            SE+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWKV
Sbjct  157  SEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWKV  216

Query  696  GPALACGNTVVLKTA  740
            GPALACGNT+VLKTA
Sbjct  217  GPALACGNTIVLKTA  231



>ref|XP_004298932.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=532

 Score =   346 bits (887),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 183/197 (93%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFS-TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            + RFS TAAA EEL++P V +++T+ +ING+FVDSASGKTFPT DPRT +VIAHVAEG+A
Sbjct  29   VSRFSSTAAASEELITPPVHIEHTKLLINGQFVDSASGKTFPTYDPRTGEVIAHVAEGDA  88

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            EDINRAVAAARKAFDEGPWPKMSAYERSRI+L+FADLVEKH +ELA LETW+NGKP+ QA
Sbjct  89   EDINRAVAAARKAFDEGPWPKMSAYERSRILLRFADLVEKHSEELAALETWNNGKPFVQA  148

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            +++ELPM+VRL HYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MF W
Sbjct  149  SQAELPMVVRLLHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFVW  208

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNT+VLK+A
Sbjct  209  KVGPALACGNTIVLKSA  225



>ref|XP_010913576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   346 bits (888),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RFSTA AVEE ++P V+V +TQ +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ E
Sbjct  41   LRRFSTAVAVEEPITPPVQVHHTQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVE  100

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+N AVAAARKAFDEGPWPKM+ YERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct  101  DVNHAVAAARKAFDEGPWPKMTGYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA  160

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
             +E+PM+VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  161  NAEVPMLVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWK  220

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGN +VLKTA
Sbjct  221  VGPALACGNAIVLKTA  236



>ref|XP_004508853.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=536

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +3

Query  156  QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
             RFSTAAAVEEL++P V + YTQH+ING+FVD+ASGKTFPT DPRT +VIA VAEG+AED
Sbjct  35   NRFSTAAAVEELITPQVSINYTQHLINGQFVDAASGKTFPTYDPRTGEVIARVAEGDAED  94

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            INRAV+AARKAFD+GPWPKM+AYER RI+L+FADL+EKH DE+A LE+W+NGK YEQAAK
Sbjct  95   INRAVSAARKAFDDGPWPKMTAYERCRILLRFADLIEKHNDEIAALESWNNGKLYEQAAK  154

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
             ELPM+VRLF YYAGW DKIHG+TVPADG +H+QTLHEPIGV GQIIPWNFPL MFAWKV
Sbjct  155  IELPMVVRLFRYYAGWTDKIHGMTVPADGDYHIQTLHEPIGVVGQIIPWNFPLLMFAWKV  214

Query  696  GPALACGNTVVLKTA  740
            GPALACGNT+VLK+A
Sbjct  215  GPALACGNTIVLKSA  229



>gb|EYU42550.1| hypothetical protein MIMGU_mgv1a004919mg [Erythranthe guttata]
Length=504

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 179/197 (91%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRF-STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            +QRF S+AA ++E + P +++ YT+ +ING+FVDSASGKTFPTLDPRT +VIAHVAEG+A
Sbjct  1    MQRFTSSAAVIDEPIIPPLQINYTKLLINGQFVDSASGKTFPTLDPRTGEVIAHVAEGDA  60

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            EDINRAV+AARKAFDEGPWP+M+AYERSRIML+FADL EKH  ELA LETWDNGKPYEQA
Sbjct  61   EDINRAVSAARKAFDEGPWPRMTAYERSRIMLRFADLAEKHTQELAQLETWDNGKPYEQA  120

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
              +ELP+ VRLFHYYAGWADKIHGLTVPADGPHHVQ LHEPIGVAGQIIPWNFPL M AW
Sbjct  121  LTAELPLFVRLFHYYAGWADKIHGLTVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMLAW  180

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNT+VLK+A
Sbjct  181  KVGPALACGNTIVLKSA  197



>ref|XP_003527026.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN19318.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=540

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG   G      RFSTAAAVE+L++P V + YT+H+ING+FVD+ASGKTFPT DPRT +V
Sbjct  28   LGRNSGKWGNFNRFSTAAAVEDLITPQVPITYTKHLINGQFVDAASGKTFPTYDPRTGEV  87

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IA VAEG+AEDINRAV+AARKAFDEGPWPK++AYER +I+L+FADLVEKH DELA LETW
Sbjct  88   IAQVAEGDAEDINRAVSAARKAFDEGPWPKLTAYERCKIILRFADLVEKHGDELAALETW  147

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            +NGKPYEQ+A +ELP  VRLF YYAGWADKIHGLTVPADG +HV+TLHEPIGVAGQIIPW
Sbjct  148  NNGKPYEQSATAELPTFVRLFRYYAGWADKIHGLTVPADGNYHVETLHEPIGVAGQIIPW  207

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL MFAWKVGPALACGNTV+LKTA
Sbjct  208  NFPLLMFAWKVGPALACGNTVILKTA  233



>ref|XP_008367527.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Malus domestica]
Length=541

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFS-TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            + RFS TA A EEL+ P V++ +TQH+INGKFVD+ASGK FPT DPRT +VIAHVAEG+A
Sbjct  38   VSRFSSTAVATEELIIPPVQISHTQHLINGKFVDAASGKKFPTYDPRTGEVIAHVAEGDA  97

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            EDINRAVAAARKAFDEGPWPKM AYERSRI+L+FADLVEK+ +ELA LETW+NGKPYEQA
Sbjct  98   EDINRAVAAARKAFDEGPWPKMGAYERSRILLRFADLVEKNSEELAALETWNNGKPYEQA  157

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
              +E+PM+ RLFHYYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAW
Sbjct  158  LTAEVPMLARLFHYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAW  217

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNT+VLK+A
Sbjct  218  KVGPALACGNTIVLKSA  234



>gb|EPS72983.1| mitochondrial benzaldehyde dehydrogenase, partial [Genlisea aurea]
Length=512

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +3

Query  147  SGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  326
            +GI R+STAA +E+ + P V V+Y + +ING+FVD+ASGKTFPTLDPRT +VIAHVAEGE
Sbjct  8    NGIYRYSTAAVLEDPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGE  67

Query  327  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  506
            AEDINRAVA+ARKAFDEGPWP+++AYER RI+L+FADLVEK  DE+A LETWD+GKPYEQ
Sbjct  68   AEDINRAVASARKAFDEGPWPRLTAYERQRILLRFADLVEKSNDEIAALETWDSGKPYEQ  127

Query  507  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
            AA+ E+PM VRLF YYAGWADKIHG+T+PADGPHHVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  128  AAQIEVPMFVRLFRYYAGWADKIHGMTLPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFA  187

Query  687  WKVGPALACGNTVVLKTA  740
            WKVGPALACGNTVVLKTA
Sbjct  188  WKVGPALACGNTVVLKTA  205



>ref|XP_009391258.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA V
Sbjct  26   GSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDNGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            P+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M+AWKVGPALACGNT+VLKTA
Sbjct  206  LMYAWKVGPALACGNTIVLKTA  227



>ref|XP_009391257.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 1/204 (0%)
 Frame = +3

Query  132  KYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  308
            K G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA
Sbjct  29   KDGSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIA  88

Query  309  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  488
             VAEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDN
Sbjct  89   QVAEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDN  148

Query  489  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  668
            GKP+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNF
Sbjct  149  GKPFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNF  208

Query  669  PLAMFAWKVGPALACGNTVVLKTA  740
            PL M+AWKVGPALACGNT+VLKTA
Sbjct  209  PLLMYAWKVGPALACGNTIVLKTA  232



>gb|KDP31120.1| hypothetical protein JCGZ_11496 [Jatropha curcas]
Length=541

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I RFSTA+  EE ++P V+++YTQ++INGKFVD+ASGKTFP  DPRT +VIAHVAEG+AE
Sbjct  39   ICRFSTASVAEEPITPPVQIRYTQNLINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDAE  98

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+RAVAAARKAFDEGPWPKM+ YERSRI+L+FADLVEKH DELA LETW+NGKPYEQ+A
Sbjct  99   DIDRAVAAARKAFDEGPWPKMTPYERSRILLRFADLVEKHNDELAALETWNNGKPYEQSA  158

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            KSELPM+ RLF YYAGWADKIHGLTVP D  HH+Q LHEPIGVAGQIIPWNFPL +FAWK
Sbjct  159  KSELPMLARLFRYYAGWADKIHGLTVPGDSNHHIQVLHEPIGVAGQIIPWNFPLILFAWK  218

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  219  VGPALACGNTIVLKTA  234



>ref|XP_009612265.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=536

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  36   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  95

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            NRAVAAARKAFDEGPWPKM+AYERS+I+L+ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  96   NRAVAAARKAFDEGPWPKMNAYERSKILLRLADLIEKHNDQIATLETWDTGKPYEQAAKI  155

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+WK+G
Sbjct  156  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIG  215

Query  699  PALACGNTVVLKTA  740
            PALACGNTVVLKTA
Sbjct  216  PALACGNTVVLKTA  229



>ref|XP_010682575.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            G    V  G+QR+STAAA++E ++P VEV YT+ +ING+FVD+ASGKTF T+DPRT +VI
Sbjct  23   GRSSCVRRGLQRYSTAAAIDEPITPPVEVNYTKLLINGQFVDAASGKTFHTVDPRTGNVI  82

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
            A VAEG+AED+NRAV+AARKAFDEGPWPKM+AYERSRI+L+ ADL+EKH D +A LETWD
Sbjct  83   ADVAEGDAEDVNRAVSAARKAFDEGPWPKMTAYERSRILLRGADLIEKHNDVIAALETWD  142

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
            NGKPYEQ+AK E+PM+VRLF YYAGWADKIHGLT PADGP+HVQTLHEPIGVAGQIIPWN
Sbjct  143  NGKPYEQSAKVEIPMLVRLFRYYAGWADKIHGLTCPADGPYHVQTLHEPIGVAGQIIPWN  202

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL MFAWKVGPALACGN+VVLK+A
Sbjct  203  FPLLMFAWKVGPALACGNSVVLKSA  227



>ref|XP_009391256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G  SG+ +RFS AAA+EE +SP V+VKY+Q +INGKFVDSASGKTFPTLDPR+ +VIA V
Sbjct  33   GSASGVFRRFSIAAAIEEPISPPVQVKYSQLLINGKFVDSASGKTFPTLDPRSGEVIAQV  92

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+AED+NRAV AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  93   AEGDAEDVNRAVTAARKAFDEGPWPRMTAYERSRILNRFADLIEKHNDEIAALETWDNGK  152

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            P+EQA++ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL
Sbjct  153  PFEQASQIEIPMLARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPL  212

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M+AWKVGPALACGNT+VLKTA
Sbjct  213  LMYAWKVGPALACGNTIVLKTA  234



>ref|XP_009759823.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=542

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  42   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  101

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            NRAVAAARKAFDEGPWPKM+AYERS+I+L+ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  102  NRAVAAARKAFDEGPWPKMNAYERSKILLRLADLIEKHNDQIATLETWDTGKPYEQAAKI  161

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+WK+G
Sbjct  162  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIG  221

Query  699  PALACGNTVVLKTA  740
            PALACGNTVVLKTA
Sbjct  222  PALACGNTVVLKTA  235



>ref|XP_006290873.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
 gb|EOA23771.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
Length=537

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RF T++A EE+++P+V+V +TQ +I+G FVD+ASGKTFPTLDPRT +VIA VAEG+AE
Sbjct  35   LRRFGTSSAAEEIINPSVQVSHTQLLIDGNFVDAASGKTFPTLDPRTGEVIAQVAEGDAE  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV AARKAFDEGPWPKMSAYERSR+ML+FADLVEKH +ELA+LETWDNGKPY+Q+ 
Sbjct  95   DINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLETWDNGKPYQQSK  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  155  NVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  215  VGPALACGNTIVLKTA  230



>ref|XP_011028588.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   343 bits (881),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 185/216 (86%), Gaps = 4/216 (2%)
 Frame = +3

Query  105  PSASAFLGWKYG----VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTF  272
            PSAS  L    G       G+ RFS AAA+EE ++P V++ YT+ +ING+FVD+ASGKTF
Sbjct  17   PSASTPLLLSRGKNPITGRGVYRFSNAAALEETITPPVQISYTKLLINGQFVDAASGKTF  76

Query  273  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  452
            PT DPRT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH
Sbjct  77   PTHDPRTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKH  136

Query  453  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  632
              ELA LE+W++GKPYEQ+AKSELP   RLF YYAGWADKIHGLTVPADG HHVQTLHEP
Sbjct  137  RGELAALESWNSGKPYEQSAKSELPSFARLFRYYAGWADKIHGLTVPADGNHHVQTLHEP  196

Query  633  IGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IGVAGQIIPWNFPL MFAWKVGPALACGNT+VLK+A
Sbjct  197  IGVAGQIIPWNFPLIMFAWKVGPALACGNTIVLKSA  232



>ref|XP_008781996.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Phoenix dactylifera]
Length=543

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + RFSTA AVEE ++P V+V+YTQ +ING+FVD+ASG+TFPTLDPRT +VIAHVAEG+ E
Sbjct  41   LHRFSTAVAVEEPITPPVQVQYTQLLINGQFVDAASGRTFPTLDPRTGEVIAHVAEGDVE  100

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+NRAVAAARKAFD+GPWP+M+ YERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  101  DVNRAVAAARKAFDQGPWPRMTGYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  160

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM  RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AWK
Sbjct  161  NVEIPMFARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMYAWK  220

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLK A
Sbjct  221  VGPALACGNTIVLKAA  236



>ref|XP_006844236.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
 gb|ERN05911.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
Length=501

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +3

Query  162  FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN  341
            FS+A A EE ++P V+V+YTQ +I GK+VDSASGKTFPTLDPRT +VIAHVAEG+AEDIN
Sbjct  2    FSSAVAAEEPITPPVQVEYTQLLIGGKYVDSASGKTFPTLDPRTGEVIAHVAEGDAEDIN  61

Query  342  RAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE  521
            RAV+AARKAFD+GPWP+M+AYERSRI+ +FADLVEKH DELA LETWDNGKPYEQA+ +E
Sbjct  62   RAVSAARKAFDDGPWPRMTAYERSRILYRFADLVEKHNDELAALETWDNGKPYEQASLAE  121

Query  522  LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGP  701
            +PM VRL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AWKVGP
Sbjct  122  IPMFVRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMYAWKVGP  181

Query  702  ALACGNTVVLKTA  740
            ALACGNTVVLKTA
Sbjct  182  ALACGNTVVLKTA  194



>ref|XP_006656871.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=549

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRFSTAAA EE +SP  +V+  Q +I GKFVDSASGKTF TLDPRT +VIAHV+EG+AE
Sbjct  47   LQRFSTAAAAEEPISPPFQVQDKQLLIGGKFVDSASGKTFSTLDPRTGEVIAHVSEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV+AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DELA LETWDNGKPY QAA
Sbjct  107  DINRAVSAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYAQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct  167  NIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNTVVLKTA
Sbjct  227  VGPALACGNTVVLKTA  242



>ref|XP_010460154.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Camelina sativa]
Length=534

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 183/202 (91%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G+  G+QR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGVQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDEIAALETWDNGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            P+EQAA+ E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQAAQIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M +WK+GPALACGNT+VLKTA
Sbjct  206  LMLSWKLGPALACGNTIVLKTA  227



>ref|XP_010477684.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 183/202 (91%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G+  GIQR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGIQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERS+I+ + ADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRLADLIEKHNDEIAALETWDNGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            P+EQ+AK E+PMIVR+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQSAKIEVPMIVRVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M +WK+GPALACGNT+VLKTA
Sbjct  206  LMLSWKLGPALACGNTLVLKTA  227



>ref|XP_007031424.1| Aldehyde dehydrogenase 2B4 isoform 2, partial [Theobroma cacao]
 gb|EOY02350.1| Aldehyde dehydrogenase 2B4 isoform 2, partial [Theobroma cacao]
Length=405

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  150  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            GI  FST+AA++E +SP++ + +TQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEG+A
Sbjct  11   GINSFSTSAAIDEPISPSILIDHTQLLINGQFVDAASGKTFPTLDPRTGDVIAHVAEGDA  70

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED+NRAVAAARKAFDEGPWPK++AYERSRIM +FADL+EKH +E+ATLETWDNGKPYEQA
Sbjct  71   EDVNRAVAAARKAFDEGPWPKLTAYERSRIMFRFADLLEKHTEEVATLETWDNGKPYEQA  130

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK E+P +VR+F YYAGWADKIHGLTVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  131  AKIEIPKVVRMFRYYAGWADKIHGLTVPADGQHHVQTLHEPYGVTGLIIPWNFPLLLYSW  190

Query  690  KVGPALACGNTVVLKTA  740
            KV PALACGNT VLKTA
Sbjct  191  KVAPALACGNTAVLKTA  207



>gb|KDO69714.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=393

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 184/217 (85%), Gaps = 4/217 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  269
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  270  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  449
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  450  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  629
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  630  PIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PIGVAGQI+PWNFPL +F WKV PAL CGNT+VLK+A
Sbjct  195  PIGVAGQIVPWNFPLLLFTWKVAPALTCGNTIVLKSA  231



>gb|KDO69715.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=394

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 184/217 (85%), Gaps = 4/217 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  269
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  270  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  449
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  450  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  629
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  630  PIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PIGVAGQI+PWNFPL +F WKV PAL CGNT+VLK+A
Sbjct  195  PIGVAGQIVPWNFPLLLFTWKVAPALTCGNTIVLKSA  231



>emb|CAA71003.1| aldehyde dehydrogenase (NAD+) [Nicotiana tabacum]
Length=542

 Score =   342 bits (877),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct  42   QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI  101

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            NRAVAAARKAFDEGPWPKM+AYERS+I ++ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct  102  NRAVAAARKAFDEGPWPKMNAYERSKIFVRLADLIEKHNDQIATLETWDTGKPYEQAAKI  161

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+WK+G
Sbjct  162  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIG  221

Query  699  PALACGNTVVLKTA  740
            PALACGNTVVLKTA
Sbjct  222  PALACGNTVVLKTA  235



>ref|XP_004238676.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=529

 Score =   341 bits (875),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            ++STAAA EE V P V V +T+ +ING+FVDSASGKTFPTLDPRT +VIAH+AEG+AEDI
Sbjct  29   KYSTAAAFEEPVKPTVNVDHTKLLINGQFVDSASGKTFPTLDPRTGEVIAHIAEGDAEDI  88

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            NRAVAAARKAFDEGPWP+M+AYERS+I+L+ ADL+EKH D++ATLETWD GKPY QAAK 
Sbjct  89   NRAVAAARKAFDEGPWPRMTAYERSKILLRLADLIEKHNDQIATLETWDTGKPYAQAAKI  148

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+WK+G
Sbjct  149  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIG  208

Query  699  PALACGNTVVLKTA  740
            PALACGNT+VLKTA
Sbjct  209  PALACGNTIVLKTA  222



>ref|XP_003517756.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN12100.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=538

 Score =   341 bits (875),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            +FSTAAA+EE + P V+V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  38   KFSTAAAIEEPIKPPVKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  97

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH DELA LETWDNGKPYEQ+A+ 
Sbjct  98   DRAVAAARKAFDHGPWPKMTAYERQRILLRAADLFEKHNDELAALETWDNGKPYEQSAQI  157

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVG
Sbjct  158  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAWKVG  217

Query  699  PALACGNTVVLKTA  740
            PALACGNT+VLKTA
Sbjct  218  PALACGNTIVLKTA  231



>ref|XP_006355977.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=529

 Score =   341 bits (874),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            ++STAAA+EE + P V V +T+  ING+FVDSASGKTFPTLDPRT +VIAH+AEG+AEDI
Sbjct  29   KYSTAAALEEPIKPTVNVDHTKLFINGQFVDSASGKTFPTLDPRTGEVIAHIAEGDAEDI  88

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            NRAVAAARKAFDEGPWP+M+AYERS+I+L+ ADL+EKH D++ATLETWD GKPY QAAK 
Sbjct  89   NRAVAAARKAFDEGPWPRMTAYERSKILLRLADLIEKHNDQIATLETWDTGKPYAQAAKI  148

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+WK+G
Sbjct  149  EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIG  208

Query  699  PALACGNTVVLKTA  740
            PALACGNT+VLKTA
Sbjct  209  PALACGNTIVLKTA  222



>gb|KHG27537.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   341 bits (874),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +3

Query  162  FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN  341
            ++TAAA+E+  +P+++V YT+ +ING FVDSASGKTFPT DPRT DVIAHVAEG+AEDIN
Sbjct  32   YTTAAALEKPFTPSIKVNYTKLLINGNFVDSASGKTFPTYDPRTGDVIAHVAEGDAEDIN  91

Query  342  RAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE  521
            RAV+AARKAFDEGPWPKM+AYERSRI+ +FADL+++H +ELATLETWDNGKPYEQAAK E
Sbjct  92   RAVSAARKAFDEGPWPKMTAYERSRILFRFADLIDQHTEELATLETWDNGKPYEQAAKIE  151

Query  522  LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGP  701
            LPMI RL  YYAGWADKIHGLTVPAD PH VQT+HEPIGVAGQIIPWNFPL MFAWKVGP
Sbjct  152  LPMISRLIRYYAGWADKIHGLTVPADSPHLVQTIHEPIGVAGQIIPWNFPLLMFAWKVGP  211

Query  702  ALACGNTVVLKTA  740
            ALACGNTVV+KTA
Sbjct  212  ALACGNTVVIKTA  224



>gb|KJB50197.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=531

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = +3

Query  144  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  323
             S +  ++TAAA+E+ ++P++ V YT+ +ING FVDSASGKTFPT DPRT DVIAHVAEG
Sbjct  26   RSVVCSYTTAAALEKPITPSINVNYTKLLINGNFVDSASGKTFPTYDPRTGDVIAHVAEG  85

Query  324  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  503
            +AEDINRAV+AARKAFDEGPWPKM+AYERSR++ +FADL+++H +ELATLETWDNGKPYE
Sbjct  86   DAEDINRAVSAARKAFDEGPWPKMTAYERSRVLFRFADLIDQHTEELATLETWDNGKPYE  145

Query  504  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  683
            QAAK ELPMI RL  YYAGWADKIHGLTVPAD PH VQT+HEPIGVAGQIIPWNFP+ MF
Sbjct  146  QAAKIELPMISRLIRYYAGWADKIHGLTVPADSPHLVQTIHEPIGVAGQIIPWNFPVLMF  205

Query  684  AWKVGPALACGNTVVLKTA  740
            AWKVGPALACGNTVV+KTA
Sbjct  206  AWKVGPALACGNTVVIKTA  224



>gb|ABK92547.1| unknown [Populus trichocarpa]
Length=432

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ E
Sbjct  34   IYRFITAKALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDNE  93

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+A
Sbjct  94   DVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQSA  153

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            KSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNFPL M AWK
Sbjct  154  KSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFPLIMLAWK  213

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLK+A
Sbjct  214  VGPALACGNTIVLKSA  229



>ref|XP_011044320.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=538

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  150  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            GI RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ 
Sbjct  35   GIYRFITATALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDT  94

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+
Sbjct  95   EDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQS  154

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AKSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNFPL M AW
Sbjct  155  AKSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFPLIMLAW  214

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNT+VLK+A
Sbjct  215  KVGPALACGNTIVLKSA  231



>gb|KDO69713.1| hypothetical protein CISIN_1g012806mg [Citrus sinensis]
Length=456

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 184/217 (85%), Gaps = 4/217 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  269
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  270  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  449
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  450  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  629
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  630  PIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PIGVAGQI+PWNFPL +F WKV PAL CGNT+VLK+A
Sbjct  195  PIGVAGQIVPWNFPLLLFTWKVAPALTCGNTIVLKSA  231



>gb|KHN00347.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=539

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            +FSTAAA+EE + P ++V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  39   KFSTAAAIEEPIKPPIKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  98

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH D+LA LETWDNGKPYEQ+A+ 
Sbjct  99   DRAVAAARKAFDRGPWPKMTAYERQRILLRAADLFEKHNDDLAALETWDNGKPYEQSAQI  158

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVG
Sbjct  159  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAWKVG  218

Query  699  PALACGNTVVLKTA  740
            PALACGNT+VLKTA
Sbjct  219  PALACGNTIVLKTA  232



>ref|XP_002301540.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE80813.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
Length=540

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            I R++T  AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ 
Sbjct  37   ISRYNTTLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDV  96

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED+NRAV+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKPYEQ+
Sbjct  97   EDVNRAVSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPYEQS  156

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK E+PM VR+F YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFP+ MF+W
Sbjct  157  AKIEIPMTVRIFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPMLMFSW  216

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNTVV+KTA
Sbjct  217  KVGPALACGNTVVIKTA  233



>ref|XP_010653335.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI32132.3| unnamed protein product [Vitis vinifera]
 gb|AFY12671.1| mitochondrial aldehyde dehydrogenase 2B8 [Vitis quinquangularis]
Length=538

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            +G       GI R+STAA VEE ++P+V V YTQ +ING+FVD+A+GKTF TLDPRT +V
Sbjct  26   IGRNSSRRGGIFRYSTAAVVEEPINPSVNVNYTQLLINGQFVDAATGKTFETLDPRTGNV  85

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IA VAEG+AED+NRAV+AARKAFDEGPWP+MS YERS+I+L+FADL+EKH DE+A LETW
Sbjct  86   IASVAEGDAEDVNRAVSAARKAFDEGPWPRMSPYERSKILLRFADLLEKHNDEIAALETW  145

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            DNGKP+EQAAK+E+P+++RL  YYAGWADKIHGLTVPADG H VQTLHEPIGVAGQIIPW
Sbjct  146  DNGKPFEQAAKAEVPLVIRLMRYYAGWADKIHGLTVPADGLHQVQTLHEPIGVAGQIIPW  205

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL M+AWK+GPALACGNT+VLKTA
Sbjct  206  NFPLLMYAWKIGPALACGNTIVLKTA  231



>ref|XP_007031423.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
 gb|EOY02349.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
Length=511

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  150  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            GI  FST+AA++E +SP++ + +TQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEG+A
Sbjct  8    GINSFSTSAAIDEPISPSILIDHTQLLINGQFVDAASGKTFPTLDPRTGDVIAHVAEGDA  67

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED+NRAVAAARKAFDEGPWPK++AYERSRIM +FADL+EKH +E+ATLETWDNGKPYEQA
Sbjct  68   EDVNRAVAAARKAFDEGPWPKLTAYERSRIMFRFADLLEKHTEEVATLETWDNGKPYEQA  127

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK E+P +VR+F YYAGWADKIHGLTVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  128  AKIEIPKVVRMFRYYAGWADKIHGLTVPADGQHHVQTLHEPYGVTGLIIPWNFPLLLYSW  187

Query  690  KVGPALACGNTVVLKTA  740
            KV PALACGNT VLKTA
Sbjct  188  KVAPALACGNTAVLKTA  204



>ref|XP_003519638.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
Length=539

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            +FSTAAA+EE + P ++V++TQ +I+GKFVD+A+GKTFPTLDPRT DVI+HVAEG+ ED+
Sbjct  39   KFSTAAAIEEPIKPPLKVEHTQLLIDGKFVDAATGKTFPTLDPRTGDVISHVAEGDHEDV  98

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            +RAVAAARKAFD GPWPKM+AYER RI+L+ ADL EKH D+LA LETWDNGKPYEQ+A+ 
Sbjct  99   DRAVAAARKAFDRGPWPKMTAYERQRILLRAADLFEKHNDDLAALETWDNGKPYEQSAQI  158

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVG
Sbjct  159  EIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAWKVG  218

Query  699  PALACGNTVVLKTA  740
            PALACGNT+VLKTA
Sbjct  219  PALACGNTIVLKTA  232



>ref|XP_010029207.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            +G   G   GI  +S+++ V+E V+P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DV
Sbjct  20   IGRSRGWTRGIGSYSSSSVVDEPVTPSVKITDTQLLINGKFVDAASGKTFPTLDPRTGDV  79

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            I HVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH+D+LA +ETW
Sbjct  80   ITHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLLEKHIDDLAAIETW  139

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            DNGKPY+QAA+ E+P  +RL  YYAGWADKIHGLTVP DG +HVQTLHEPIGVAGQIIPW
Sbjct  140  DNGKPYKQAAEDEIPGFIRLMRYYAGWADKIHGLTVPVDGKYHVQTLHEPIGVAGQIIPW  199

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL MFAWK+GPALACGNTVVLKTA
Sbjct  200  NFPLLMFAWKIGPALACGNTVVLKTA  225



>ref|XP_004509835.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=538

 Score =   339 bits (870),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 179/197 (91%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            + ++STAAAVEE  + P V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG A
Sbjct  35   LSKYSTAAAVEEQPIKPTVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHA  94

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED++RAVAAAR+AFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKP+EQ+
Sbjct  95   EDVDRAVAAARQAFDHGPWPKMTAYERQRILLRAADLIEKHNDELAALETWDNGKPFEQS  154

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK+E+PM+VRL  YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNFPL MF W
Sbjct  155  AKTEVPMLVRLIRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFGW  214

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNTVVLKTA
Sbjct  215  KVGPALACGNTVVLKTA  231



>gb|ACM89738.1| mitochondrial benzaldehyde dehydrogenase [Antirrhinum majus]
Length=534

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 177/199 (89%), Gaps = 2/199 (1%)
 Frame = +3

Query  150  GIQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  323
            G+ R+ TAAA  +EE + P V V+Y + +ING+FVD+ASGKTFPTLDPR+ +VIAHVAEG
Sbjct  29   GVYRYGTAAAAALEEPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRSGEVIAHVAEG  88

Query  324  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  503
            +AEDINRAVAAARKAFDEGPWPKM AYER +IML+FADLVEKH DE+A LE WD+GKPYE
Sbjct  89   DAEDINRAVAAARKAFDEGPWPKMPAYERQKIMLRFADLVEKHNDEVAALEAWDSGKPYE  148

Query  504  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  683
            Q A+ E+PM VRLF YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNFPL MF
Sbjct  149  QCAQVEIPMFVRLFRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNFPLVMF  208

Query  684  AWKVGPALACGNTVVLKTA  740
             WKVGPALACGN+VVLKTA
Sbjct  209  GWKVGPALACGNSVVLKTA  227



>ref|XP_004509834.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=539

 Score =   339 bits (870),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 179/197 (91%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            + ++STAAAVEE  + P V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG A
Sbjct  36   LSKYSTAAAVEEQPIKPTVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHA  95

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED++RAVAAAR+AFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKP+EQ+
Sbjct  96   EDVDRAVAAARQAFDHGPWPKMTAYERQRILLRAADLIEKHNDELAALETWDNGKPFEQS  155

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK+E+PM+VRL  YYAGWADKIHGLT+PADGPHHVQTLHEPIGVAGQIIPWNFPL MF W
Sbjct  156  AKTEVPMLVRLIRYYAGWADKIHGLTIPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFGW  215

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNTVVLKTA
Sbjct  216  KVGPALACGNTVVLKTA  232



>ref|XP_010498885.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   339 bits (869),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G+  G+QR+S  AAA+E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGVQRYSNFAAALENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWD GK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDEIAALETWDCGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            P+EQ+AK E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQSAKIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M +WK+GPALACGNT+VLKTA
Sbjct  206  LMLSWKLGPALACGNTLVLKTA  227



>gb|KFK34098.1| hypothetical protein AALP_AA5G101700 [Arabis alpina]
Length=540

 Score =   339 bits (870),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 179/198 (90%), Gaps = 2/198 (1%)
 Frame = +3

Query  153  IQRF--STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  326
            ++RF  S++A  EE++SP+V+V YT+ +I+G FVDSASGKTFPTLDPRT +VIA VAEG+
Sbjct  36   VRRFGSSSSAVAEEIISPSVQVSYTKLLIDGNFVDSASGKTFPTLDPRTGEVIADVAEGD  95

Query  327  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  506
            AEDINRAV AARKAFDEGPWP+MSAYERSRIML+FADLVEKH +ELA+LE+WDNGKPY Q
Sbjct  96   AEDINRAVKAARKAFDEGPWPRMSAYERSRIMLRFADLVEKHSEELASLESWDNGKPYSQ  155

Query  507  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
            +  +E+PM  RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  156  SKGTEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFA  215

Query  687  WKVGPALACGNTVVLKTA  740
            WKVGPALACGNT+VLK+A
Sbjct  216  WKVGPALACGNTIVLKSA  233



>ref|XP_010551563.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=540

 Score =   339 bits (869),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 185/216 (86%), Gaps = 4/216 (2%)
 Frame = +3

Query  105  PSASAFLGWKYGVESGIQRFSTAAA----VEELVSPAVEVKYTQHIINGKFVDSASGKTF  272
            PS  +  G    V  G+ R+STAAA    +E  +SP V+V+ TQ +I+GKFVDSASGKTF
Sbjct  18   PSLLSLGGKSPHVSRGVHRYSTAAAAAAALEVPISPPVKVELTQLLIDGKFVDSASGKTF  77

Query  273  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  452
            PTLDPRT DVIAHVAEG+ ED+NRAV+AAR AFDEGPWP+M+AYERS+I+L+ ADLVEKH
Sbjct  78   PTLDPRTGDVIAHVAEGDVEDVNRAVSAARMAFDEGPWPRMTAYERSKILLRCADLVEKH  137

Query  453  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  632
             DE+A LETWDNGKPY+QAAK E+PM+ RLF YYAGWADKIHGLTVPADGPHHVQTLHEP
Sbjct  138  NDEIAALETWDNGKPYDQAAKVEVPMLTRLFRYYAGWADKIHGLTVPADGPHHVQTLHEP  197

Query  633  IGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IGVAGQIIPWNFPL M AWK+GPALACGNTVVLKTA
Sbjct  198  IGVAGQIIPWNFPLLMLAWKLGPALACGNTVVLKTA  233



>gb|KDO82494.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=392

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNT  233

Query  723  VVLKTA  740
            +VLKTA
Sbjct  234  IVLKTA  239



>dbj|BAB62757.1| mitochondrial aldehyde dehydrogenase ALDH2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ90704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   339 bits (870),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D++RAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  107  DVDRAVVAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ WK
Sbjct  167  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTIVLKTA  242



>gb|KCW56067.1| hypothetical protein EUGRSUZ_I01824, partial [Eucalyptus grandis]
Length=511

 Score =   338 bits (867),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 182/205 (89%), Gaps = 4/205 (2%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            GW  G+ S    +S+++ V+E V+P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DVI
Sbjct  4    GWTRGIGS----YSSSSVVDEPVTPSVKITDTQLLINGKFVDAASGKTFPTLDPRTGDVI  59

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
             HVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH+D+LA +ETWD
Sbjct  60   THVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLLEKHIDDLAAIETWD  119

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
            NGKPY+QAA+ E+P  +RL  YYAGWADKIHGLTVP DG +HVQTLHEPIGVAGQIIPWN
Sbjct  120  NGKPYKQAAEDEIPGFIRLMRYYAGWADKIHGLTVPVDGKYHVQTLHEPIGVAGQIIPWN  179

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL MFAWK+GPALACGNTVVLKTA
Sbjct  180  FPLLMFAWKIGPALACGNTVVLKTA  204



>ref|XP_011463376.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=531

 Score =   338 bits (868),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  120  FLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTE  296
             LG    V  GI ++STAAA VE+ ++P V V +T+ +ING+FVD+ASGKTFPTLDPRT 
Sbjct  17   LLGRSSSVSRGIGKYSTAAAAVEDPITPPVIVGHTKLLINGQFVDAASGKTFPTLDPRTG  76

Query  297  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE  476
            DVIAHVAEG+AED+NRAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EK  DELA LE
Sbjct  77   DVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKQNDELAALE  136

Query  477  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQII  656
            TWDNGKP+EQ+AK E+PM  R F YYAG+ADKIHGLTVPADGP+HVQTLHEPIGVAGQII
Sbjct  137  TWDNGKPFEQSAKIEVPMFARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPIGVAGQII  196

Query  657  PWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PWNFPL MFAWKV PALACGNT+VLKTA
Sbjct  197  PWNFPLLMFAWKVAPALACGNTIVLKTA  224



>ref|XP_011086550.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Sesamum indicum]
Length=532

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  141  VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  320
            V  GI R+STAAA E+ + P V V+Y + +ING+FVD+ASGKTFPTLDPRT +VIAHVAE
Sbjct  26   VGRGIYRYSTAAAHEDPIKPPVSVQYDKLLINGQFVDAASGKTFPTLDPRTGEVIAHVAE  85

Query  321  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  500
            G+AEDINRAVAAARKAFDEGPWPKM+AYER RI+L+FADLVEKH D++A LETWD+GK Y
Sbjct  86   GDAEDINRAVAAARKAFDEGPWPKMTAYERQRILLRFADLVEKHNDDIAALETWDSGKLY  145

Query  501  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM  680
            EQ A+ E+PM VRLF YYAGWADKIHGLT+PADG  HVQTLHEPIGVAGQIIPWNFPL M
Sbjct  146  EQCAQIEVPMFVRLFRYYAGWADKIHGLTIPADGALHVQTLHEPIGVAGQIIPWNFPLVM  205

Query  681  FAWKVGPALACGNTVVLKTA  740
            FAWKVGPALACGNT+VLKTA
Sbjct  206  FAWKVGPALACGNTIVLKTA  225



>ref|XP_002274863.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Vitis vinifera]
 emb|CBI34947.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 176/198 (89%), Gaps = 1/198 (1%)
 Frame = +3

Query  150  GIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  326
            G  RFSTA A EE  ++P V++ YTQ +ING+FVD+ASGKTFPTLDPRT DVIAHVAEGE
Sbjct  31   GSSRFSTAVATEEEPITPPVQIDYTQLLINGRFVDAASGKTFPTLDPRTGDVIAHVAEGE  90

Query  327  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  506
            AEDINRAV+AARKAFDEGPWPKM+ YERS I+ +FADL+EKH  E+A LE+WDNGKPYEQ
Sbjct  91   AEDINRAVSAARKAFDEGPWPKMTPYERSCILFRFADLLEKHCSEIAALESWDNGKPYEQ  150

Query  507  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
            AA  E+PM++R+F YYAGWADKIHGLTVPADG HHVQTLHEPIGVAGQIIPWNFPL ++ 
Sbjct  151  AANVEIPMVIRVFRYYAGWADKIHGLTVPADGLHHVQTLHEPIGVAGQIIPWNFPLLLYG  210

Query  687  WKVGPALACGNTVVLKTA  740
            WKVGPALACGNT+VLKTA
Sbjct  211  WKVGPALACGNTIVLKTA  228



>ref|NP_190383.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
 sp|Q9SU63.1|AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B4, mitochondrial; 
Short=ALDH2a; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG42016.1|AF327426_1 putative (NAD+) aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAK15569.1|AF349522_1 putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAK49627.1|AF372911_1 AT3g48000/T17F15_130 [Arabidopsis thaliana]
 emb|CAB41139.1| aldehyde dehydrogenase (NAD+)-like protein [Arabidopsis thaliana]
 dbj|BAA96792.1| aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAL91287.1| AT3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AAM27003.1| aldehyde dehydrogenase ALDH2a [Arabidopsis thaliana]
 gb|AAN31892.1| putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAP21179.1| At3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AEE78355.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
Length=538

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            ++RF T+ AA EE+++P+V+V +TQ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+A
Sbjct  35   LRRFGTSSAAAEEIINPSVQVSHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDA  94

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            EDINRAV AAR AFDEGPWPKMSAYERSR++L+FADLVEKH +ELA+LETWDNGKPY+Q+
Sbjct  95   EDINRAVKAARTAFDEGPWPKMSAYERSRVLLRFADLVEKHSEELASLETWDNGKPYQQS  154

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
              +E+PM  RLF YYAGWADKIHGLT+PADG + V TLHEPIGVAGQIIPWNFPL MFAW
Sbjct  155  LTAEIPMFARLFRYYAGWADKIHGLTIPADGNYQVHTLHEPIGVAGQIIPWNFPLLMFAW  214

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNT+VLKTA
Sbjct  215  KVGPALACGNTIVLKTA  231



>ref|XP_002318034.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEE96254.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=536

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I RF TA A+EE ++P V++ YTQH INGKFVD+ASGKTFP  DPRT +VIAHVAEG+ E
Sbjct  34   IYRFITAKALEEPITPPVQISYTQHFINGKFVDAASGKTFPAYDPRTGEVIAHVAEGDNE  93

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D+NRAVAAARKAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+A
Sbjct  94   DVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQSA  153

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            KSELP   RLF YYAGWADKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNFPL M AWK
Sbjct  154  KSELPSFARLFRYYAGWADKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFPLIMLAWK  213

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLK+A
Sbjct  214  VGPALACGNTIVLKSA  229



>gb|KCW86739.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I+ +STAAA+EE ++P V V +TQ  ING++VDSASGKTFPT DPRT +VIAHVAEGEAE
Sbjct  42   IKSYSTAAAIEEPINPGVTVNHTQLFINGQYVDSASGKTFPTFDPRTGEVIAHVAEGEAE  101

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWP+M+AYER+ ++ +FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  102  DINRAVAAARKAFDEGPWPRMTAYERANVLFRFADLLEKHNDEIAALETWDNGKPYEQAA  161

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K ELPMIVR   YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL M+AWK
Sbjct  162  KIELPMIVRQIRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNFPLLMYAWK  221

Query  693  VGPALACGNTVVLKTA  740
            VGPALA GNTVVLKTA
Sbjct  222  VGPALATGNTVVLKTA  237



>ref|XP_010044646.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW86738.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I+ +STAAA+EE ++P V V +TQ  ING++VDSASGKTFPT DPRT +VIAHVAEGEAE
Sbjct  42   IKSYSTAAAIEEPINPGVTVNHTQLFINGQYVDSASGKTFPTFDPRTGEVIAHVAEGEAE  101

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAVAAARKAFDEGPWP+M+AYER+ ++ +FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct  102  DINRAVAAARKAFDEGPWPRMTAYERANVLFRFADLLEKHNDEIAALETWDNGKPYEQAA  161

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K ELPMIVR   YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL M+AWK
Sbjct  162  KIELPMIVRQIRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNFPLLMYAWK  221

Query  693  VGPALACGNTVVLKTA  740
            VGPALA GNTVVLKTA
Sbjct  222  VGPALATGNTVVLKTA  237



>ref|XP_009399660.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=542

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 182/213 (85%), Gaps = 2/213 (1%)
 Frame = +3

Query  108  SASAFLGWK-YGVESGIQR-FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL  281
            S S F G + +G  SG+ R FSTA A+EE + P V+V +TQ +ING+FVDSASG+TFPTL
Sbjct  23   SRSVFGGDRIHGSASGVLRGFSTATAIEEPIQPPVQVNHTQLLINGQFVDSASGRTFPTL  82

Query  282  DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE  461
            DPRT ++IAHVAEG+ ED+NRAV AARKAFDEGPWPKM+ Y+RS I+ +FADL+EKH DE
Sbjct  83   DPRTGELIAHVAEGDVEDVNRAVVAARKAFDEGPWPKMTGYQRSCILYRFADLIEKHNDE  142

Query  462  LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV  641
            +A LETWDNGKPYEQAAK+E+P + RL  YYAGWADKIHGL VPAD PHHVQ LHEPIGV
Sbjct  143  IAALETWDNGKPYEQAAKAEIPTLARLMRYYAGWADKIHGLIVPADSPHHVQVLHEPIGV  202

Query  642  AGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            AGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  203  AGQIIPWNFPLLMFAWKVGPALACGNTIVLKTA  235



>ref|XP_004297641.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=535

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 180/201 (90%), Gaps = 1/201 (0%)
 Frame = +3

Query  141  VESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            V  GI ++STAAA VE+ ++P V V +T+ +ING+FVD+ASGKTFPTLDPRT DVIAHVA
Sbjct  28   VSRGIGKYSTAAAAVEDPITPPVIVGHTKLLINGQFVDAASGKTFPTLDPRTGDVIAHVA  87

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+AED+NRAVAAARKAFDEGPWPKM+AYERSR++ +FADL+EK  DELA LETWDNGKP
Sbjct  88   EGDAEDVNRAVAAARKAFDEGPWPKMTAYERSRVLFRFADLIEKQNDELAALETWDNGKP  147

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
            +EQ+AK E+PM  R F YYAG+ADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL 
Sbjct  148  FEQSAKIEVPMFARFFRYYAGYADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLL  207

Query  678  MFAWKVGPALACGNTVVLKTA  740
            MFAWKV PALACGNT+VLKTA
Sbjct  208  MFAWKVAPALACGNTIVLKTA  228



>ref|XP_003552014.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN39739.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 7/211 (3%)
 Frame = +3

Query  111  ASAFLGWKYGVESGIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  287
             + FLG ++       ++ST++A+EE  V P+V+V++TQ +I+GKFVD+ASGKTFPTLDP
Sbjct  25   GNGFLGSRHC------KYSTSSAIEEEPVKPSVQVEHTQLLIDGKFVDAASGKTFPTLDP  78

Query  288  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  467
            RT +VIAHVAEG +ED++RAVAAARKAFD GPWPKM+AYER RI+L+ ADL+EKH DELA
Sbjct  79   RTGEVIAHVAEGHSEDVDRAVAAARKAFDHGPWPKMTAYERQRILLRAADLLEKHNDELA  138

Query  468  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  647
             LETWDNGKPYEQAAK E+PM+VRL  YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAG
Sbjct  139  ALETWDNGKPYEQAAKIEVPMLVRLIRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAG  198

Query  648  QIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            QIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  199  QIIPWNFPLLMFAWKVGPALACGNTIVLKTA  229



>gb|AFK49345.1| unknown [Medicago truncatula]
Length=272

 Score =   328 bits (840),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = +3

Query  159  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKV
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKV  219

Query  696  GPALACGNTVVLK  734
            GPALACGNTVVLK
Sbjct  220  GPALACGNTVVLK  232



>ref|XP_006476755.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Citrus sinensis]
Length=538

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 185/217 (85%), Gaps = 4/217 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  269
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  270  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  449
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  450  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  629
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  630  PIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PIGVAGQI+PWNFP+ +F WKV PALACGNT+VLK+A
Sbjct  195  PIGVAGQIVPWNFPVLLFTWKVAPALACGNTIVLKSA  231



>gb|KDO82492.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=456

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNT  233

Query  723  VVLKTA  740
            +VLKTA
Sbjct  234  IVLKTA  239



>gb|KDO82493.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=459

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNT  233

Query  723  VVLKTA  740
            +VLKTA
Sbjct  234  IVLKTA  239



>ref|XP_006439784.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53024.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=538

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 184/217 (85%), Gaps = 4/217 (2%)
 Frame = +3

Query  102  FPSASAFLGWKYGVES----GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKT  269
            FPSAS  L    G ES    GI RFSTAA VEE + P V++ YT+++ING+FVD+ASGKT
Sbjct  15   FPSASPSLLRSLGRESSRARGISRFSTAAVVEEPIIPPVQISYTKNLINGQFVDAASGKT  74

Query  270  FPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEK  449
            FP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ ADL+EK
Sbjct  75   FPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEK  134

Query  450  HMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHE  629
            +M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+QTLHE
Sbjct  135  NMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHIQTLHE  194

Query  630  PIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PIGVAGQI+PWNFPL +F WKV PAL CGNT+VLK+A
Sbjct  195  PIGVAGQIVPWNFPLLLFTWKVAPALTCGNTIVLKSA  231



>dbj|BAB92017.1| mitochondrial aldehyde dehydrogenase [Secale cereale]
Length=549

 Score =   337 bits (864),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVSETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D++RAV AARKAFD GPWPKM+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  107  DVDRAVIAARKAFDHGPWPKMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            + E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ WK
Sbjct  167  QIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTIVLKTA  242



>gb|EMT04899.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=549

 Score =   337 bits (863),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPT+DPRT +VIA VAEG+AE
Sbjct  47   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTVDPRTGEVIARVAEGDAE  106

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D++RAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  107  DVDRAVVAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  166

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ WK
Sbjct  167  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGWK  226

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  227  VGPALACGNTIVLKTA  242



>gb|EYU31278.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
 gb|EYU31279.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
Length=533

 Score =   336 bits (862),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 183/216 (85%), Gaps = 5/216 (2%)
 Frame = +3

Query  108  SASAFLGWKYGVES----GIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTF  272
            S SA L  + G +S    GI R++TAAA +EE + P V VKY + +ING+FVD+ASGKTF
Sbjct  11   SRSAPLLSRRGKQSYTSRGIFRYTTAAAALEEPIKPPVNVKYDKLLINGQFVDAASGKTF  70

Query  273  PTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKH  452
            PTLDPRT +VI HV EG+AEDINRAV+AARKAFDEGPWPKM+AYER RI+L+FADLVEKH
Sbjct  71   PTLDPRTGEVITHVPEGDAEDINRAVSAARKAFDEGPWPKMTAYERQRILLRFADLVEKH  130

Query  453  MDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEP  632
             DE+A LETWD+GK +EQ AK E+PM VRLF YYAGW DKIHG+T+P DGPHHVQTLHEP
Sbjct  131  NDEIAALETWDSGKLFEQCAKIEVPMFVRLFRYYAGWTDKIHGMTIPGDGPHHVQTLHEP  190

Query  633  IGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IGV GQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  191  IGVCGQIIPWNFPLVMFAWKVGPALACGNTIVLKTA  226



>gb|EMS51754.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Triticum 
urartu]
Length=550

 Score =   337 bits (863),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPT+DPRT +VIA VAEG+AE
Sbjct  48   LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTVDPRTGEVIARVAEGDAE  107

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D++RAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct  108  DVDRAVVAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA  167

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ WK
Sbjct  168  HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGWK  227

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  228  VGPALACGNTIVLKTA  243



>ref|XP_010552639.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=533

 Score =   336 bits (861),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            I R+STAAA + E + P V+V+YT  +I+GKFVD+ASGKTF TLDPRT +VI+HVAEG++
Sbjct  30   ISRYSTAAAALGEPIPPPVKVEYTHLLIDGKFVDAASGKTFTTLDPRTGEVISHVAEGDS  89

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADL+EKH DE+A LETWDNGKPYEQ+
Sbjct  90   EDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLIEKHNDEIAALETWDNGKPYEQS  149

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK E+PM+ RLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL M AW
Sbjct  150  AKIEVPMLARLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLLMLAW  209

Query  690  KVGPALACGNTVVLKTA  740
            K+GPALACGNTVVLKTA
Sbjct  210  KLGPALACGNTVVLKTA  226



>gb|KEH35052.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=431

 Score =   333 bits (853),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFP+ +FAWKVGPALACGNTVV+KTA
Sbjct  210  NFPILLFAWKVGPALACGNTVVVKTA  235



>gb|KEH35053.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=446

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFP+ +FAWKVGPALACGNTVV+KTA
Sbjct  210  NFPILLFAWKVGPALACGNTVVVKTA  235



>gb|KEH35051.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=456

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFP+ +FAWKVGPALACGNTVV+KTA
Sbjct  210  NFPILLFAWKVGPALACGNTVVVKTA  235



>gb|KJB11462.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=374

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 176/197 (89%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            I  FSTAAA ++E + P++++ +TQ +ING+F+D+ASG+TFPT+DPRT DVIA VAEG+ 
Sbjct  27   INSFSTAAAAIDEPIHPSIQIDHTQLLINGQFIDAASGRTFPTIDPRTGDVIARVAEGDL  86

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            EDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH  E+A LETWDNGKPYEQA
Sbjct  87   EDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTGEVAKLETWDNGKPYEQA  146

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  147  AKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNFPLLLYSW  206

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNTVVLKTA
Sbjct  207  KVGPALACGNTVVLKTA  223



>ref|XP_010477682.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 180/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G+  GIQR+S  AA +E  ++P V+V++TQ +ING+FVD+ASGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGIQRYSNFAADLENTITPPVKVEHTQLLINGRFVDAASGKTFPTLDPRNGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+ ED+NRAVAAARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DELA LE+WD GK
Sbjct  86   AEGDVEDVNRAVAAARKAFDEGPWPRMTAYERSRILFRFADLIEKHNDELAALESWDCGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            P+EQ+AK E+PM+ R+F YYAGWADKIHG+TVPADGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PFEQSAKIEVPMLARVFRYYAGWADKIHGMTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M +WK+GPALACGNT+VLKTA
Sbjct  206  LMLSWKLGPALACGNTLVLKTA  227



>ref|XP_003532011.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN10599.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 184/211 (87%), Gaps = 7/211 (3%)
 Frame = +3

Query  111  ASAFLGWKYGVESGIQRFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDP  287
             + FLG +        +FST+AA+EE  + P+++V++TQ +I+GKFVD+ASGKTF TLDP
Sbjct  25   GNGFLGSRQ------SKFSTSAAIEEEPIKPSIQVEHTQLLIDGKFVDAASGKTFQTLDP  78

Query  288  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  467
            RT +VIAHVAEG +ED++RAV+AARKAFD GPWPKM+AYER RI+L+ ADL+EKH DELA
Sbjct  79   RTGEVIAHVAEGHSEDVDRAVSAARKAFDHGPWPKMTAYERQRILLRVADLIEKHNDELA  138

Query  468  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  647
             LETWDNGKPYEQAAK E+PM+VRL  YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAG
Sbjct  139  ALETWDNGKPYEQAAKIEVPMLVRLIRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAG  198

Query  648  QIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            QIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  199  QIIPWNFPLLMFAWKVGPALACGNTIVLKTA  229



>gb|AAL77004.1| aldehyde dehydrogenase [Allium cepa]
Length=282

 Score =   327 bits (837),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +3

Query  147  SGIQRF-STAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  320
            S IQ F STAAAVEE  ++P V+V+YTQ +INGK+VDSASGKTFP+LDPRT +VIAHV+E
Sbjct  30   SRIQNFGSTAAAVEEQPITPPVKVEYTQLLINGKYVDSASGKTFPSLDPRTGEVIAHVSE  89

Query  321  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  500
            G+AEDI+RAVAAARKAFDEGPW KM+AYERS I+L+FADL+EKH D +A LETWDNGKPY
Sbjct  90   GDAEDIDRAVAAARKAFDEGPWLKMTAYERSNILLRFADLIEKHNDHIAALETWDNGKPY  149

Query  501  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM  680
            EQAA  E+PM+VRL  YYAGW DKIHGL  PADGPHHVQ L+EPIGVAGQIIPWNFPL M
Sbjct  150  EQAALVEIPMLVRLMRYYAGWTDKIHGLIXPADGPHHVQVLYEPIGVAGQIIPWNFPLLM  209

Query  681  FAWKVGPALACGNTVVLKTA  740
            FAWKVGPALA GNTVVLKTA
Sbjct  210  FAWKVGPALATGNTVVLKTA  229



>ref|XP_011003158.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Populus euphratica]
Length=540

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  165  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  344
            S  AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ ED+NR
Sbjct  42   SNLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVEDVNR  101

Query  345  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  524
            AV+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKP+EQAAK E+
Sbjct  102  AVSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPFEQAAKIEI  161

Query  525  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA  704
            PM VR+F YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFP+ MF+WKVGPA
Sbjct  162  PMTVRIFRYYAGWADKIHGLTVPADGQYHVQTLHEPIGVAGQIIPWNFPMLMFSWKVGPA  221

Query  705  LACGNTVVLKTA  740
            LACGNTVV+KTA
Sbjct  222  LACGNTVVIKTA  233



>gb|KDO82485.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=546

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNT  233

Query  723  VVLKTA  740
            +VLKTA
Sbjct  234  IVLKTA  239



>ref|NP_564204.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
 sp|Q8S528.2|AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B7, mitochondrial; 
Short=ALDH2b; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59643.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM44960.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE30433.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
Length=534

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 179/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            +EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   SEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            PYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M +WK+GPALACGNTVVLKTA
Sbjct  206  LMLSWKLGPALACGNTVVLKTA  227



>ref|XP_006438422.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
 ref|XP_006483828.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Citrus sinensis]
 gb|ESR51662.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
Length=546

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNT  233

Query  723  VVLKTA  740
            +VLKTA
Sbjct  234  IVLKTA  239



>gb|AAL99612.1|AF348416_1 mitochondrial aldehyde dehydrogenase [Arabidopsis thaliana]
Length=534

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 179/202 (89%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            +EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   SEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            PYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M +WK+GPALACGNTVVLKTA
Sbjct  206  LMLSWKLGPALACGNTVVLKTA  227



>ref|XP_010682577.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + ++ST AA+EE + P V+VKY+Q +INGKFVDSASGK F T DPRT +VIA V+EG+AE
Sbjct  33   VCKYSTTAAIEEPIIPPVKVKYSQLLINGKFVDSASGKKFKTCDPRTGNVIAEVSEGDAE  92

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+RAVAAARKAFDEGPWPKM+AYERS+I+LKFADL+E+H DE+A LETWDNGKPYEQAA
Sbjct  93   DIDRAVAAARKAFDEGPWPKMTAYERSQILLKFADLLEQHTDEIAALETWDNGKPYEQAA  152

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K ELPM VR+  YYAGW+DKIHGLT PADGP HVQTLHEPIGVAGQIIPWNFPL MF WK
Sbjct  153  KIELPMCVRIMRYYAGWSDKIHGLTAPADGPFHVQTLHEPIGVAGQIIPWNFPLLMFVWK  212

Query  693  VGPALACGNTVVLKTA  740
            +GPALACGN++V+KTA
Sbjct  213  IGPALACGNSIVMKTA  228



>gb|KEH19980.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=541

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = +3

Query  159  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWKV
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKV  219

Query  696  GPALACGNTVVLKTA  740
            GPALACGNTVVLKTA
Sbjct  220  GPALACGNTVVLKTA  234



>ref|XP_004139235.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=538

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  36   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  95

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  96   DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  155

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  156  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNFPLVMFAWK  215

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  216  VGPALACGNTIVLKTA  231



>ref|XP_004156463.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=540

 Score =   333 bits (855),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  38   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  97

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  98   DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  157

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  158  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNFPLVMFAWK  217

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  218  VGPALACGNTIVLKTA  233



>ref|XP_010029206.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   333 bits (854),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            +G  +G   GI   S+++ V+EL++P+V++  TQ +INGKFVD+ASGKTFPTLDPRT DV
Sbjct  20   IGRSHGWVRGIGSSSSSSVVDELITPSVKIADTQLLINGKFVDAASGKTFPTLDPRTGDV  79

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            I HVAEG+AED++RAVAAARKAFDEGPWP+M+AYERS I+L+FADL+EKH+D+LA +ETW
Sbjct  80   ITHVAEGDAEDVDRAVAAARKAFDEGPWPRMTAYERSCILLRFADLLEKHIDDLAAIETW  139

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            DNGKPYEQAA+ E+P ++RL  YYAGWADKIHGLT+PADG +HVQTLHEPIGVAGQI+PW
Sbjct  140  DNGKPYEQAAEDEVPDVIRLMRYYAGWADKIHGLTIPADGEYHVQTLHEPIGVAGQIVPW  199

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL MFAWK+GPALACGNTVVLKTA
Sbjct  200  NFPLRMFAWKIGPALACGNTVVLKTA  225



>ref|XP_002893307.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69566.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 178/202 (88%), Gaps = 1/202 (0%)
 Frame = +3

Query  138  GVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            G+  G QR+S AAA VE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V
Sbjct  26   GMNRGAQRYSNAAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQV  85

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+AED+NRAVAAARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGK
Sbjct  86   AEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGK  145

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
            PYEQ+ + E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQIIPWNFPL
Sbjct  146  PYEQSVQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPL  205

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             M +WK+GPALACGNT+VLKTA
Sbjct  206  LMLSWKLGPALACGNTIVLKTA  227



>ref|XP_009115500.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=536

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  105  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  284
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLD
Sbjct  18   PSLFALRGKHHNMNRGVYGYSNVAAGEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLD  77

Query  285  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  464
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADLV+KH DE+
Sbjct  78   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLVDKHNDEI  137

Query  465  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  644
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  138  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  197

Query  645  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GQIIPWNFPL M +WK+GPALACGNTVVLKTA
Sbjct  198  GQIIPWNFPLLMLSWKLGPALACGNTVVLKTA  229



>gb|KEH35050.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=542

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG        I + STAA V+EL++P+VE++YT+++INGKF+D+ASGKTFP  DPRT +V
Sbjct  30   LGRDTQRSRNISKLSTAAEVDELITPSVEIRYTKNLINGKFMDAASGKTFPAYDPRTGEV  89

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHVAEG+ EDINRAV+AARKAFDEGPWPKM+ YERSRI+L+ ADLVEKH DELA LETW
Sbjct  90   IAHVAEGDQEDINRAVSAARKAFDEGPWPKMTPYERSRILLRVADLVEKHNDELAALETW  149

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            +NGK YEQA   E+PM VRL  YYAGWADKIHGLTVPADG +HVQ LHEPIGVAGQIIPW
Sbjct  150  NNGKLYEQAVNIEVPMFVRLLRYYAGWADKIHGLTVPADGNYHVQVLHEPIGVAGQIIPW  209

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFP+ +FAWKVGPALACGNTVV+KTA
Sbjct  210  NFPILLFAWKVGPALACGNTVVVKTA  235



>ref|XP_009150211.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Brassica rapa]
Length=538

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            ++RF T++A E+++SP+V+V  TQ +I+G FVD+ SGKTF TLDPRT +VIA VAEG+AE
Sbjct  36   VRRFGTSSAAEKIISPSVQVSCTQLLIDGNFVDATSGKTFQTLDPRTGEVIADVAEGDAE  95

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+RAV AARKAFD+GPWP+M+AYERSRIML+FADLVEKH +ELA LETWDNGK Y+QA 
Sbjct  96   DIDRAVKAARKAFDKGPWPRMTAYERSRIMLRFADLVEKHSEELAALETWDNGKTYQQAK  155

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
             +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  156  TAEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  215

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  216  VGPALACGNTIVLKTA  231



>ref|XP_008456004.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Cucumis melo]
Length=537

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPR+ +VIA+VAEG+A 
Sbjct  35   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRSGEVIANVAEGDAR  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D++ AV+AARKAFDEGPWPKM+AYERS+I+L+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  95   DVDIAVSAARKAFDEGPWPKMTAYERSKIILRFADLVEKHAEEVAALETWDNGKTYEQSL  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K E+PM VRLF YY GWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  155  KIEVPMFVRLFRYYGGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  215  VGPALACGNTIVLKTA  230



>gb|ABK24267.1| unknown [Picea sitchensis]
Length=544

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +3

Query  150  GIQRFSTAA-AVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  326
            GI+R  TAA A+EE ++P V+VK+TQ +I+G+FV++ASGKTFPT DPRT DVIA+VAEG+
Sbjct  40   GIRRLGTAASALEEPIAPPVQVKHTQLLIDGQFVNAASGKTFPTFDPRTGDVIANVAEGD  99

Query  327  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  506
            A D+NRAV AARKAFD GPWPKM+AYERS IML+FADL+EKH DE+A LETWDNGKPYEQ
Sbjct  100  APDVNRAVKAARKAFDVGPWPKMTAYERSCIMLRFADLLEKHNDEIAALETWDNGKPYEQ  159

Query  507  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
            A+  E+PM VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  160  ASLVEVPMAVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFA  219

Query  687  WKVGPALACGNTVVLKTA  740
            WKVGPALACGN++VLK+A
Sbjct  220  WKVGPALACGNSIVLKSA  237



>gb|KFK44454.1| hypothetical protein AALP_AA1G258900 [Arabis alpina]
Length=524

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 177/201 (88%), Gaps = 4/201 (2%)
 Frame = +3

Query  150  GIQRFST----AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            G  R+S     AAA+E  ++P V+V++TQ +INGKFVD+ASGKTFPTLDPRT +VIA VA
Sbjct  17   GAYRYSNVSAAAAALENTITPPVKVEHTQLLINGKFVDAASGKTFPTLDPRTGEVIAQVA  76

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+ ED+NRAV AARKAFDEGPWP+M+AYERSRI+L+FADL+EKH DE+A LETWDNGKP
Sbjct  77   EGDKEDVNRAVLAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDEIAALETWDNGKP  136

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
            YEQ+A+ E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  137  YEQSAQLEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLL  196

Query  678  MFAWKVGPALACGNTVVLKTA  740
            M +WK+GPALACGNT+VLKTA
Sbjct  197  MLSWKLGPALACGNTIVLKTA  217



>gb|KHG06517.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 178/198 (90%), Gaps = 2/198 (1%)
 Frame = +3

Query  153  IQRFSTAAA--VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  326
            I+ FSTAAA  ++E + P++++ +TQ +ING+FVD+ASGK+FPT+DPRT DVIA VAEG+
Sbjct  27   IKSFSTAAAAAIDEPIHPSIQIDHTQLLINGQFVDAASGKSFPTVDPRTGDVIARVAEGD  86

Query  327  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  506
             ED+NRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH +E+A LETWDNGKPYEQ
Sbjct  87   LEDVNRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTEEVAKLETWDNGKPYEQ  146

Query  507  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
            AAK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNFPL +++
Sbjct  147  AAKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNFPLLLYS  206

Query  687  WKVGPALACGNTVVLKTA  740
            WKVGPALACGNTVVLKTA
Sbjct  207  WKVGPALACGNTVVLKTA  224



>gb|KJB11461.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=530

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 176/197 (89%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            I  FSTAAA ++E + P++++ +TQ +ING+F+D+ASG+TFPT+DPRT DVIA VAEG+ 
Sbjct  27   INSFSTAAAAIDEPIHPSIQIDHTQLLINGQFIDAASGRTFPTIDPRTGDVIARVAEGDL  86

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            EDINRAVAAARKAFDEGPWPKM+AYERSRIML+FADL+EKH  E+A LETWDNGKPYEQA
Sbjct  87   EDINRAVAAARKAFDEGPWPKMTAYERSRIMLRFADLLEKHTGEVAKLETWDNGKPYEQA  146

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AK E+PM+VR+F YYAGWADKIHG TVPADG HHVQTLHEP GV G IIPWNFPL +++W
Sbjct  147  AKIEIPMVVRMFRYYAGWADKIHGFTVPADGQHHVQTLHEPYGVCGLIIPWNFPLLLYSW  206

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNTVVLKTA
Sbjct  207  KVGPALACGNTVVLKTA  223



>ref|XP_011071082.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Sesamum indicum]
Length=525

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 179/203 (88%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  KYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAH  311
            +YG   GI R+ T +A +E + P V V+Y + +ING+FVD+ASGKTFPTLDPR+ +VIAH
Sbjct  19   RYG--RGIYRYGTTSA-QEPIKPPVTVEYDKLLINGQFVDAASGKTFPTLDPRSGEVIAH  75

Query  312  VAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNG  491
            VAEG+ EDINRAVAAARKAFDEGPWPKM+AYER RIML+FADLVEKH DE+A LETWDNG
Sbjct  76   VAEGDTEDINRAVAAARKAFDEGPWPKMTAYERCRIMLRFADLVEKHNDEIAALETWDNG  135

Query  492  KPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFP  671
            K YEQ+A  E+PM+VRLF YYAGWADKIHGLT+ ADGP++VQ+LHEPIGVAGQIIPWNFP
Sbjct  136  KVYEQSAHIEIPMLVRLFRYYAGWADKIHGLTIRADGPYNVQSLHEPIGVAGQIIPWNFP  195

Query  672  LAMFAWKVGPALACGNTVVLKTA  740
            L MFAWKVGPALACGNT+VLKTA
Sbjct  196  LVMFAWKVGPALACGNTIVLKTA  218



>emb|CDY47634.1| BnaC05g18900D [Brassica napus]
Length=544

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = +3

Query  105  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  284
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLD
Sbjct  18   PSLFALRGKHHNMNRGVYGYSNVAAAEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLD  77

Query  285  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  464
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M AYERS+I+L+FADLV+KH DE+
Sbjct  78   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMIAYERSKILLRFADLVDKHNDEI  137

Query  465  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  644
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  138  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  197

Query  645  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GQIIPWNFPL M +WK+GPALACGNTVVLKTA
Sbjct  198  GQIIPWNFPLLMLSWKLGPALACGNTVVLKTA  229



>ref|XP_006307216.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
 gb|EOA40114.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
Length=532

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 178/201 (89%), Gaps = 1/201 (0%)
 Frame = +3

Query  138  GVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            G+  G+QR+S  A VE  ++P V+V++TQ +I GKFVD+ASGKTFPTLDPR  +VIA VA
Sbjct  26   GMNRGVQRYSNHA-VENTITPPVKVEHTQLLIGGKFVDAASGKTFPTLDPRNGEVIAQVA  84

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+ ED+NRAVAAARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  85   EGDVEDVNRAVAAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  144

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
            +EQAAK E+PM+ R+F YYAGWADKIHG+TVP DGP+HVQTLHEPIGVAGQIIPWNFPL 
Sbjct  145  FEQAAKIEVPMLARVFRYYAGWADKIHGMTVPGDGPYHVQTLHEPIGVAGQIIPWNFPLL  204

Query  678  MFAWKVGPALACGNTVVLKTA  740
            M +WK+GPALACGNT+VLKTA
Sbjct  205  MLSWKLGPALACGNTLVLKTA  225



>gb|KGN60807.1| hypothetical protein Csa_2G010420 [Cucumis sativus]
Length=592

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            I ++STA+AVE+ ++P+V+V Y Q +ING+FVDS SGKTFPTLDPRT +VIA VAEG+A 
Sbjct  90   IAKYSTASAVEDPITPSVKVNYNQLLINGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDAR  149

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+ AV+AARKAFDEGPWPKM+AYERS+IML+FADLVEKH +E+A LETWDNGK YEQ+ 
Sbjct  150  DIDIAVSAARKAFDEGPWPKMTAYERSKIMLRFADLVEKHAEEVAALETWDNGKTYEQSL  209

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K E+PM VRLF YY GWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  210  KIEIPMFVRLFRYYGGWADKIHGLTVPADGSYHVQTLHEPIGVAGQIIPWNFPLVMFAWK  269

Query  693  VGPALACGNTVVLKTA  740
            VGPALACGNT+VLKTA
Sbjct  270  VGPALACGNTIVLKTA  285



>gb|KJB31274.1| hypothetical protein B456_005G183300 [Gossypium raimondii]
Length=509

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  138  GVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            GV   +  +ST+A +E  ++P+++V  TQ +ING FVDSASGKTFPT DPRT +VIAHVA
Sbjct  27   GVGRVVSGYSTSAGIENPINPSIKVHCTQLLINGNFVDSASGKTFPTYDPRTGNVIAHVA  86

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+AEDI+RAV AARKAFDEGPWPKM+AYERS+++ +FADL++KH++ELATLETWDNGKP
Sbjct  87   EGDAEDIDRAVCAARKAFDEGPWPKMTAYERSKVLFRFADLLDKHIEELATLETWDNGKP  146

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
            YEQ+AK ELPMI R+  YYAGWADKIHGLT+PADGPH VQT+HEPIGVAGQIIPWNFPL 
Sbjct  147  YEQSAKIELPMISRIIRYYAGWADKIHGLTIPADGPHLVQTIHEPIGVAGQIIPWNFPLL  206

Query  678  MFAWKVGPALACGNTVVLKTA  740
            MFAWKVGPALACG T+VLK+A
Sbjct  207  MFAWKVGPALACGCTIVLKSA  227



>ref|XP_009761724.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=540

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  144  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  323
            ++GI+ FS+A   EE ++P VEVKY Q +ING+FVD+ASGK FPT DPRT DVI  VAE 
Sbjct  36   KNGIRSFSSAVVHEEPITPPVEVKYKQLLINGQFVDAASGKMFPTYDPRTGDVITMVAEA  95

Query  324  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  503
            + ED+NRAV+AARKAFDEGPWPKMSAYERS IML+FAD +EKH DELA LETWDNGKPYE
Sbjct  96   DTEDVNRAVSAARKAFDEGPWPKMSAYERSCIMLRFADFLEKHGDELAALETWDNGKPYE  155

Query  504  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  683
            QAA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQ LHEPIGVAGQIIPWNFPL MF
Sbjct  156  QAANEEIPMLIRLFRYYAGWADKIHGLTAPADSLHHVQILHEPIGVAGQIIPWNFPLLMF  215

Query  684  AWKVGPALACGNTVVLKTA  740
            AWKVGPALACGNTVVLK A
Sbjct  216  AWKVGPALACGNTVVLKPA  234



>ref|XP_011044321.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   331 bits (848),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = +3

Query  150  GIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            GI RF TA A+EE ++P V++ YTQH INGKFVD+ASGK FP  DPRT +VIAHVAEG+ 
Sbjct  36   GIYRFITATALEEPITPPVQISYTQHFINGKFVDAASGKIFPAYDPRTGEVIAHVAEGDT  95

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            ED+NRAVAAA KAFDEGPWPKMSAYERS IML+FADLV+KH DELA LE+W++GKPYEQ+
Sbjct  96   EDVNRAVAAACKAFDEGPWPKMSAYERSLIMLRFADLVDKHRDELAALESWNSGKPYEQS  155

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            AKSELP   RLF YYAGW DKIHGLTVPAD  H+VQTLHEPIGVAGQIIPWNF L M AW
Sbjct  156  AKSELPSFARLFRYYAGWTDKIHGLTVPADSNHYVQTLHEPIGVAGQIIPWNFALIMLAW  215

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNT+VLK+A
Sbjct  216  KVGPALACGNTIVLKSA  232



>ref|XP_009110081.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=537

 Score =   330 bits (847),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 178/201 (89%), Gaps = 1/201 (0%)
 Frame = +3

Query  141  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            +  G +R+S  AA++E+ ++P V+V++TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   LNRGARRYSNLAASLEDTITPPVKVEHTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+ ED+NRAV AARKAFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDQGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
            YEQ+A  E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  150  YEQSANIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLL  209

Query  678  MFAWKVGPALACGNTVVLKTA  740
            M +WK+GPALACGNTVVLKTA
Sbjct  210  MLSWKLGPALACGNTVVLKTA  230



>gb|EYU22484.1| hypothetical protein MIMGU_mgv1a004342mg [Erythranthe guttata]
Length=532

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  141  VESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE  320
            +  GI  +S +A+++  + P V V+Y + +ING+FV++ASGKTFPTLDPR+ +VIAHV+E
Sbjct  26   LSRGIYHYSKSASLDNPIKPPVTVQYDKLLINGQFVEAASGKTFPTLDPRSGEVIAHVSE  85

Query  321  GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY  500
            G+ ED+NRAVA+ARKAFDEGPWPKM+AYERS+IM +FADL+EKH DE+A LETWDNGKP+
Sbjct  86   GDLEDVNRAVASARKAFDEGPWPKMTAYERSKIMFRFADLIEKHNDEIAALETWDNGKPF  145

Query  501  EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM  680
            EQ+AK E+PM+ RLF YY GWADKIHGLT+  DGPHHVQTLHEPIGVAGQIIPWNFPL M
Sbjct  146  EQSAKIEVPMLARLFRYYGGWADKIHGLTIRGDGPHHVQTLHEPIGVAGQIIPWNFPLLM  205

Query  681  FAWKVGPALACGNTVVLKTA  740
            FAWKVGPALACGNTVVLKTA
Sbjct  206  FAWKVGPALACGNTVVLKTA  225



>emb|CDY57318.1| BnaA08g20300D [Brassica napus]
Length=537

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 178/201 (89%), Gaps = 1/201 (0%)
 Frame = +3

Query  141  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            +  G +R+S  AA++E+ ++P V+V++TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   LNRGARRYSNLAASLEDTITPPVKVEHTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+ ED+NRAV AARKAFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDQGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
            YEQ+A  E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  150  YEQSANIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLL  209

Query  678  MFAWKVGPALACGNTVVLKTA  740
            M +WK+GPALACGNTVVLKTA
Sbjct  210  MLSWKLGPALACGNTVVLKTA  230



>ref|XP_007157468.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
 gb|ESW29462.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
Length=538

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            +FSTAAA EE + P V V++TQ +I+GKFVD+ SGKTFPTLDPRT DVIA VAEG+ ED+
Sbjct  38   KFSTAAATEEPIKPPVRVEHTQLLIDGKFVDATSGKTFPTLDPRTGDVIALVAEGDHEDV  97

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            ++AV+ ARKAFD GPWPKM+AYER RI+L+ ADL+EKH DELA LETWDNGKPYEQ+A+ 
Sbjct  98   DQAVSVARKAFDHGPWPKMTAYERQRILLRAADLLEKHNDELAALETWDNGKPYEQSAQI  157

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+P++VRLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL MFAWKV 
Sbjct  158  EVPIVVRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFAWKVC  217

Query  699  PALACGNTVVLKTA  740
            PALACGNTVV+KTA
Sbjct  218  PALACGNTVVIKTA  231



>emb|CDX91724.1| BnaC08g06430D [Brassica napus]
Length=537

 Score =   329 bits (844),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 177/201 (88%), Gaps = 1/201 (0%)
 Frame = +3

Query  141  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            +  G +R+S  AA++E+ ++P V+V+ TQ +INGKFVDSASGKTFPTLDPRT +VIA VA
Sbjct  30   MNRGARRYSNLAASLEDTITPPVKVEQTQLLINGKFVDSASGKTFPTLDPRTGEVIAQVA  89

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+ ED+NRAV AARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDNGKP
Sbjct  90   EGDVEDVNRAVVAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDNGKP  149

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
            YEQ+AK E+PM+ R+F YYAGWADKIHG+TV  DG HHVQTLHEPIGVAGQIIPWNFPL 
Sbjct  150  YEQSAKIEVPMLARVFRYYAGWADKIHGMTVRGDGSHHVQTLHEPIGVAGQIIPWNFPLL  209

Query  678  MFAWKVGPALACGNTVVLKTA  740
            M +WK+GPALACGNTVVLKTA
Sbjct  210  MLSWKLGPALACGNTVVLKTA  230



>ref|XP_010682578.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=550

 Score =   330 bits (845),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + R+STA A EE ++P V VKYTQ +ING+FVDSASGK   T DPRT +VI  V+EG+AE
Sbjct  48   VSRYSTATASEEPITPPVTVKYTQLLINGQFVDSASGKKMKTYDPRTGNVITEVSEGDAE  107

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV+AAR AFDEGPWPKM+AYERS+I+ KFADL+E+H DE+A LETWDNGKPYEQA+
Sbjct  108  DINRAVSAARIAFDEGPWPKMTAYERSKILFKFADLLEQHTDEIAALETWDNGKPYEQAS  167

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K ELPM VRL  YYAGWADKIHGLTVPADGP+H+QTLHEPIGVAGQIIPWNFP+ MF WK
Sbjct  168  KVELPMCVRLMRYYAGWADKIHGLTVPADGPYHMQTLHEPIGVAGQIIPWNFPILMFVWK  227

Query  693  VGPALACGNTVVLKTA  740
            V PALACGNT+VLKTA
Sbjct  228  VAPALACGNTIVLKTA  243



>emb|CDY61548.1| BnaA09g29890D, partial [Brassica napus]
Length=555

 Score =   330 bits (845),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = +3

Query  105  PSASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  284
            PS  A  G  + +  G+  +S  AA E+ ++P V+V++TQ +I GKFVD+ASGK FPTLD
Sbjct  37   PSLFALRGKHHNMYRGVYGYSNVAAAEDTITPPVKVEHTQLLIGGKFVDAASGKAFPTLD  96

Query  285  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  464
            PRT +VIA VAEG+ ED+NRAV+AARKAFDEGPWP+M+AYERS+I+L+FADLV+KH DE+
Sbjct  97   PRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERSKILLRFADLVDKHNDEI  156

Query  465  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  644
            A +ETWDNGKP+EQ++K E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVA
Sbjct  157  AAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVA  216

Query  645  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GQIIPWNFPL M +WK+GPALACGNTVVLKTA
Sbjct  217  GQIIPWNFPLLMLSWKLGPALACGNTVVLKTA  248



>ref|XP_004245256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=534

 Score =   328 bits (841),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +3

Query  159  RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI  338
            R++TAA  ++ + P+V V+YT+  ING+FVDSASGKTFPTLDPRT +VIAHVAEG+ EDI
Sbjct  36   RYTTAA--QDPIKPSVNVEYTKLFINGQFVDSASGKTFPTLDPRTGEVIAHVAEGDVEDI  93

Query  339  NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS  518
            NRAV AAR AFDEGPWPKMSAYERS+I+ + ADL+EKH DE+ATLETWD+GK Y+Q A  
Sbjct  94   NRAVVAARNAFDEGPWPKMSAYERSKILFRIADLIEKHNDEIATLETWDSGKLYQQVATI  153

Query  519  ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG  698
            E+PMIVRL  YYAGWADKIHG+TVPADGP+HVQTLHEPIGV GQIIPWNFPL MFAWK+G
Sbjct  154  EIPMIVRLLRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVVGQIIPWNFPLLMFAWKIG  213

Query  699  PALACGNTVVLKTA  740
            PALACGNTVVLKTA
Sbjct  214  PALACGNTVVLKTA  227



>emb|CDX77883.1| BnaC03g53360D [Brassica napus]
Length=572

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  135  YGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHV  314
            Y     ++RF  ++A E+++ P+V+V YTQ +I+G FVD+ASGKTFPT+DPRT +VIA V
Sbjct  30   YNASRVVRRFGISSAAEKIIRPSVQVSYTQLLIDGNFVDAASGKTFPTIDPRTGEVIADV  89

Query  315  AEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK  494
            AEG+AEDI+ AV AARKAFDEGPWPKM+AYERSRIML+FADLVEKH ++LA LETWDNGK
Sbjct  90   AEGDAEDIDWAVKAARKAFDEGPWPKMTAYERSRIMLRFADLVEKHSEDLAALETWDNGK  149

Query  495  PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL  674
             Y+QA  +E+PM+ RLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQI PWNFPL
Sbjct  150  TYQQAKTAEIPMLARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQINPWNFPL  209

Query  675  AMFAWKVGPALACGNTVVLKTA  740
             MFAWKVGPALACGNT+VLK A
Sbjct  210  LMFAWKVGPALACGNTIVLKIA  231



>ref|XP_009600000.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=544

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  144  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  323
            ++GI+ FS+A   EE ++P VEVKY Q +ING+FVD+ASGK FPT DPRT DVI  VAE 
Sbjct  40   KNGIRSFSSAVVHEEPITPPVEVKYKQLLINGQFVDAASGKMFPTYDPRTGDVITMVAEA  99

Query  324  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  503
            + ED+NRAV+AARKAFDEGPWPKMSAYERS IML+FADL+EKH DELA LET+DNGKPYE
Sbjct  100  DTEDVNRAVSAARKAFDEGPWPKMSAYERSCIMLRFADLLEKHSDELAELETYDNGKPYE  159

Query  504  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  683
            QAA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQ LHEPIGVAGQIIPWNF L MF
Sbjct  160  QAANEEIPMLLRLFRYYAGWADKIHGLTAPADSLHHVQILHEPIGVAGQIIPWNFSLLMF  219

Query  684  AWKVGPALACGNTVVLKTA  740
            AWKVGPALACGNTVVLK A
Sbjct  220  AWKVGPALACGNTVVLKPA  238



>ref|XP_010271955.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Nelumbo nucifera]
Length=534

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG K      I  F TA  +EE  +P ++V++TQ +ING+FVD+ASG+TFPTLDP  E+V
Sbjct  22   LGRKSSWGRDIYCFCTANTIEEPSTPPIQVEHTQLLINGQFVDAASGRTFPTLDPSKEEV  81

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IAHV+EG+AEDINRAV+AARKAFDEGPWP+M+AYER++IM +FADL+EK+ DE+A LE+ 
Sbjct  82   IAHVSEGDAEDINRAVSAARKAFDEGPWPRMTAYERAKIMYRFADLLEKYNDEIAALESL  141

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  662
            D+GKPYEQAAK E+P + RLF YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW
Sbjct  142  DSGKPYEQAAKVEIPTVTRLFRYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW  201

Query  663  NFPLAMFAWKVGPALACGNTVVLKTA  740
            NFPL M+AWKVGPALACGN VVLKTA
Sbjct  202  NFPLLMYAWKVGPALACGNAVVLKTA  227



>ref|XP_003563967.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Brachypodium distachyon]
Length=548

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +QRF TAA  EE +SP V+V  T+ +INGKFVD+ SGKTFPTLDPRT +VIAHVAEG+A+
Sbjct  46   LQRFGTAAVAEEPISPPVKVGETKLLINGKFVDAVSGKTFPTLDPRTGEVIAHVAEGDAK  105

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+ AVAAARKAFDEGPWP+M+AYERSRI+L+FADL+EKH D+LA LETWDNGK +EQAA
Sbjct  106  DIDLAVAAARKAFDEGPWPRMTAYERSRILLRFADLIEKHNDDLAALETWDNGKTFEQAA  165

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              ELPMI RL  YYAGW+DKIHGL VPAD PHHVQ L+EPIGVAGQIIPWNFPL MFAWK
Sbjct  166  HIELPMIARLMRYYAGWSDKIHGLVVPADSPHHVQVLYEPIGVAGQIIPWNFPLLMFAWK  225

Query  693  VGPALACGNTVVLKTA  740
            VGPALA GNTVVLKTA
Sbjct  226  VGPALASGNTVVLKTA  241



>ref|XP_006356663.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=537

 Score =   325 bits (834),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 172/195 (88%), Gaps = 1/195 (1%)
 Frame = +3

Query  159  RFSTAAAV-EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            R++TAA + ++ + P+V V+YT+  ING+FVDS SGKTFPTLDPRT +VIAHVAEG+ ED
Sbjct  36   RYTTAAPIAQDPIKPSVNVEYTKLFINGQFVDSTSGKTFPTLDPRTGEVIAHVAEGDVED  95

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            INRAV AAR AFDEGPWPKMSAYERS+++ + ADL+EKH DE+ATLETWD+GK Y+Q A 
Sbjct  96   INRAVVAARNAFDEGPWPKMSAYERSKVLFRIADLIEKHNDEIATLETWDSGKLYQQVAT  155

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
             E+PMIVR+  YYAGWADKIHG+TVPADGP+HVQTLHEPIGV GQIIPWNFPL MFAWK+
Sbjct  156  IEIPMIVRILRYYAGWADKIHGMTVPADGPYHVQTLHEPIGVVGQIIPWNFPLLMFAWKI  215

Query  696  GPALACGNTVVLKTA  740
            GPALACGNTVVLKTA
Sbjct  216  GPALACGNTVVLKTA  230



>ref|XP_010037573.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW49300.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
 gb|KCW49301.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
Length=542

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 178/204 (87%), Gaps = 3/204 (1%)
 Frame = +3

Query  138  GVESGIQRFSTAAA---VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  308
            G+   I RFSTAAA   +EELV P V+V +TQ +ING+FVDSASGKTFP  DPRT +VIA
Sbjct  32   GLRRSIPRFSTAAAAAALEELVIPPVQVCHTQLLINGQFVDSASGKTFPAYDPRTAEVIA  91

Query  309  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  488
            HVAEG+ ED++RAVAAARKAFDEGPWPKM+ YER RI+L+FADLVEKH +ELA LETW+N
Sbjct  92   HVAEGDGEDVDRAVAAARKAFDEGPWPKMTPYERCRILLRFADLVEKHSEELAALETWNN  151

Query  489  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  668
            GKPYEQA  SE+P + RLF YYAGWADKIHG+TVPADG +H+QTLHEPIGVAGQIIPWNF
Sbjct  152  GKPYEQALHSEIPSMARLFRYYAGWADKIHGMTVPADGNYHMQTLHEPIGVAGQIIPWNF  211

Query  669  PLAMFAWKVGPALACGNTVVLKTA  740
            PL +F+WKVGPALACGNTVVLK+A
Sbjct  212  PLVLFSWKVGPALACGNTVVLKSA  235



>gb|AAC98035.1| Strong similarity to gb|Y09876 aldehyde dehydrogenase (NAD+) 
from Nicotiana tabacum and a member of the aldehyde dehydrogenase 
family PF|00171. ESTs gb|F15117, gb|R83958 and gb|586262 
come from this gene [Arabidopsis thaliana]
Length=519

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 178/212 (84%), Gaps = 12/212 (6%)
 Frame = +3

Query  141  VESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            +  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V+
Sbjct  1    MNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQVS  60

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAY-----------ERSRIMLKFADLVEKHMDEL  464
            EG+AED+NRAVAAARKAFDEGPWPKM+AY           ERS+I+ +FADL+EKH DE+
Sbjct  61   EGDAEDVNRAVAAARKAFDEGPWPKMTAYVYNKVVLCLSSERSKILFRFADLIEKHNDEI  120

Query  465  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  644
            A LETWDNGKPYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVA
Sbjct  121  AALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVA  180

Query  645  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GQIIPWNFPL M +WK+GPALACGNTVVLKTA
Sbjct  181  GQIIPWNFPLLMLSWKLGPALACGNTVVLKTA  212



>ref|XP_008793866.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=538

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 176/212 (83%), Gaps = 3/212 (1%)
 Frame = +3

Query  108  SASAFLGWK-YGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  284
            S+S F G + +    G+ R  + AA  E ++P V+V +TQ +I+GKFVDSASG+TFPTLD
Sbjct  22   SSSLFRGARTHDRALGVLRMFSIAA--EPITPPVQVHHTQLLIDGKFVDSASGRTFPTLD  79

Query  285  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  464
            PRT +VIAHVAEG+ EDINRAV+AARKAFDEGPWPKMS YERS I+ +FADL+EKH DE+
Sbjct  80   PRTGEVIAHVAEGDLEDINRAVSAARKAFDEGPWPKMSGYERSHILYRFADLIEKHNDEI  139

Query  465  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  644
            A LETWD GKPYE  A+ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVA
Sbjct  140  AALETWDGGKPYEHTAQKEIPMVTRLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVA  199

Query  645  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GQIIPWNFPL MF WK+GPALACGNTVVLKTA
Sbjct  200  GQIIPWNFPLLMFGWKIGPALACGNTVVLKTA  231



>ref|XP_007044551.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
 gb|EOY00383.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
Length=538

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + R+ T  A  E  +  V+V +TQ +ING FVDSASGKTFPT DPRT DVIA+VAEG+ E
Sbjct  36   VSRYGTTCASVENPNIPVKVNHTQLLINGNFVDSASGKTFPTYDPRTGDVIAYVAEGDTE  95

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DINRAV+AARKAFDEGPWPKM+AYERS ++ +FADL++KH +ELA LETWDNGK YEQAA
Sbjct  96   DINRAVSAARKAFDEGPWPKMTAYERSMVLFRFADLIDKHTEELAILETWDNGKTYEQAA  155

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K ELPMI RL  YYAGWADKIHGLTVPAD  HHVQT+HEPIGVAGQIIPWNFPL MFAWK
Sbjct  156  KIELPMISRLIRYYAGWADKIHGLTVPADSSHHVQTIHEPIGVAGQIIPWNFPLLMFAWK  215

Query  693  VGPALACGNTVVLKTA  740
            +GPALACGNT+VLKTA
Sbjct  216  IGPALACGNTIVLKTA  231



>ref|XP_006416054.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
 gb|ESQ34407.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
Length=541

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 178/204 (87%), Gaps = 4/204 (2%)
 Frame = +3

Query  141  VESGIQRFST----AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  308
            +  G +R+S     AAA+E+ ++P V+V++TQ +I GKFVD+ASGKTFPTLDPRT +VIA
Sbjct  31   MNRGARRYSNLAAAAAALEDTITPPVKVEHTQLLIGGKFVDAASGKTFPTLDPRTGEVIA  90

Query  309  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  488
             VAEG+ ED+NRAV AARKAFDEGPWP+M+AYERS+I+ +FADL+EKH DE+A LETWDN
Sbjct  91   QVAEGDVEDVNRAVLAARKAFDEGPWPRMTAYERSKILFRFADLIEKHNDEIAALETWDN  150

Query  489  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  668
            GKPYEQ+AK E+PM+ R+F YYAGWADKIHG+TVP DG HHVQTLHEPIGVAGQIIPWNF
Sbjct  151  GKPYEQSAKIEVPMLARVFRYYAGWADKIHGMTVPGDGSHHVQTLHEPIGVAGQIIPWNF  210

Query  669  PLAMFAWKVGPALACGNTVVLKTA  740
            PL M +WK+GPALACGNT+VLKTA
Sbjct  211  PLLMLSWKLGPALACGNTIVLKTA  234



>ref|XP_010316283.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=528

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +3

Query  150  GIQRFSTAAAV-EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE  326
            GI+RF ++A V EE ++P VEVKY Q +ING+FVD+ASGKTFPT DPRT + I  VAE +
Sbjct  25   GIRRFCSSAVVHEEPITPPVEVKYNQLLINGQFVDAASGKTFPTFDPRTGEAITTVAEAD  84

Query  327  AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ  506
             ED+NRAV AARKAFDEGPWPKM+  ERS IML+FADL+E+H DELA LETWD GKPYEQ
Sbjct  85   TEDVNRAVFAARKAFDEGPWPKMTCAERSCIMLQFADLLERHSDELAALETWDKGKPYEQ  144

Query  507  AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
            AA  E+PM++RLF YYAGWADKIHGLT PAD  HHVQTLHEPIGVAGQIIPWNFPL MFA
Sbjct  145  AANEEIPMLIRLFRYYAGWADKIHGLTAPADSLHHVQTLHEPIGVAGQIIPWNFPLLMFA  204

Query  687  WKVGPALACGNTVVLKTA  740
            WKVGPALACGNTVVLK A
Sbjct  205  WKVGPALACGNTVVLKPA  222



>gb|AEV54528.1| aldehyde dehydrogenase ALDH2B4_V3 [Vitis vinifera]
Length=524

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 174/210 (83%), Gaps = 14/210 (7%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  290
            S  LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+AS          
Sbjct  21   SLSLGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAAS----------  70

Query  291  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  470
               VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA 
Sbjct  71   ---VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAA  127

Query  471  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  650
            LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQ
Sbjct  128  LETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQ  187

Query  651  IIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  188  IIPWNFPLMMFAWKVGPALACGNTIVLKTA  217



>ref|XP_002525343.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF36981.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=385

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +3

Query  240  KFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRI  419
            KFVD+ASG+TFPTLDPRT +VIAHVAEG+AEDINRAV+AARKAFDEG WPKM+AYERSRI
Sbjct  14   KFVDAASGRTFPTLDPRTGEVIAHVAEGDAEDINRAVSAARKAFDEGSWPKMTAYERSRI  73

Query  420  MLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPAD  599
            ML+FADL+EKH DELA LETWDNGKPYEQAAK E+PM+ RLF YYAGWADKIHGLTVPAD
Sbjct  74   MLRFADLIEKHNDELAALETWDNGKPYEQAAKGEIPMVARLFRYYAGWADKIHGLTVPAD  133

Query  600  GPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            G HHVQTLHEPIGVAGQIIPWNFPL M+AWKVGPALACGN++VLKTA
Sbjct  134  GQHHVQTLHEPIGVAGQIIPWNFPLLMYAWKVGPALACGNSIVLKTA  180



>gb|AAZ79358.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=524

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 174/210 (83%), Gaps = 14/210 (7%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAAA-VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR  290
            S  LG  +     I RFSTAAA VEEL++P V++ YTQ +ING+FVD+AS          
Sbjct  21   SLSLGKNFNRGKSIHRFSTAAAAVEELITPTVQINYTQLLINGQFVDAAS----------  70

Query  291  TEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELAT  470
               VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FADL EKH DELA 
Sbjct  71   ---VIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAA  127

Query  471  LETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQ  650
            LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ LHEPIGVAGQ
Sbjct  128  LETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQ  187

Query  651  IIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            IIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  188  IIPWNFPLMMFAWKVGPALACGNTIVLKTA  217



>ref|XP_010265814.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=539

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = +3

Query  153  IQRFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA  329
            I RFSTAA  EE ++ P V+V++TQ +ING+FVD+ASG+TFPT DPR+ D+I HVAEG+ 
Sbjct  36   ISRFSTAALTEEEVIIPPVQVEHTQLLINGQFVDAASGRTFPTFDPRSGDLITHVAEGDE  95

Query  330  EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA  509
            EDINRAV AAR+AFD+GPWP+M+AYERS+I+ +FADL+EKH DE+A LETWD+GKPYE  
Sbjct  96   EDINRAVFAAREAFDDGPWPRMTAYERSKIIYRFADLLEKHNDEIAALETWDSGKPYEHT  155

Query  510  AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW  689
            A  E+P + RLF Y+AGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL M+AW
Sbjct  156  ANVEIPKMTRLFRYFAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLMMYAW  215

Query  690  KVGPALACGNTVVLKTA  740
            KVGPALACGNTVVLKTA
Sbjct  216  KVGPALACGNTVVLKTA  232



>ref|XP_006594290.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Glycine max]
Length=537

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 178/204 (87%), Gaps = 3/204 (1%)
 Frame = +3

Query  129  WKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  308
            W+  + SGI   S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA
Sbjct  30   WQRSI-SGIAA-SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIA  86

Query  309  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  488
            +VAEG+AED+NRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+
Sbjct  87   NVAEGDAEDVNRAVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDS  146

Query  489  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  668
            GK YEQAA  E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  147  GKTYEQAANVEIPMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  206

Query  669  PLAMFAWKVGPALACGNTVVLKTA  740
            PL +F+WKV PALACGNTVV+KTA
Sbjct  207  PLLIFSWKVAPALACGNTVVMKTA  230



>gb|KHN47185.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=538

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 178/204 (87%), Gaps = 3/204 (1%)
 Frame = +3

Query  129  WKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  308
            W+  + SGI   S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA
Sbjct  33   WQRSI-SGIAA-SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIA  89

Query  309  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  488
            +VAEG+AED+NRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+
Sbjct  90   NVAEGDAEDVNRAVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDS  149

Query  489  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  668
            GK YEQAA  E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  150  GKTYEQAANVEIPMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  209

Query  669  PLAMFAWKVGPALACGNTVVLKTA  740
            PL +F+WKV PALACGNTVV+KTA
Sbjct  210  PLLIFSWKVAPALACGNTVVMKTA  233



>ref|XP_003542700.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Glycine max]
Length=540

 Score =   321 bits (822),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 178/204 (87%), Gaps = 3/204 (1%)
 Frame = +3

Query  129  WKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIA  308
            W+  + SGI   S  A VE  ++P V++  +Q +I+GKFVD+ASGKTFPT DPRT DVIA
Sbjct  33   WQRSI-SGIAA-SVVADVEPSIAP-VQIDQSQLLIDGKFVDAASGKTFPTFDPRTGDVIA  89

Query  309  HVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDN  488
            +VAEG+AED+NRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A +ETWD+
Sbjct  90   NVAEGDAEDVNRAVHAARKAFDEGPWPKMTAYERSRIILRFADLLEKHNDEVAAIETWDS  149

Query  489  GKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNF  668
            GK YEQAA  E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNF
Sbjct  150  GKTYEQAANVEIPMVVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNF  209

Query  669  PLAMFAWKVGPALACGNTVVLKTA  740
            PL +F+WKV PALACGNTVV+KTA
Sbjct  210  PLLIFSWKVAPALACGNTVVMKTA  233



>ref|XP_010928603.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=538

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 179/212 (84%), Gaps = 3/212 (1%)
 Frame = +3

Query  108  SASAFLGWK-YGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD  284
            S+S F G + + +  G+ R  + AA  E ++P VEV +TQ +I+GKFVDSASGKTFPTLD
Sbjct  22   SSSLFPGARTHDLAFGVLRMFSMAA--EPITPPVEVHHTQLLIDGKFVDSASGKTFPTLD  79

Query  285  PRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDEL  464
            PRT +VIAHVAE + ED+NRAV+AARKAFDEGPWPKM+ YERS I+ +FADL+EKH DE+
Sbjct  80   PRTGEVIAHVAEADLEDVNRAVSAARKAFDEGPWPKMTGYERSHILYRFADLIEKHNDEI  139

Query  465  ATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVA  644
            A LETW++GKPYE  ++ E+P++ RL  YYAGWADKIHGLTVPADGP+HVQ LHEPIGVA
Sbjct  140  AALETWNSGKPYEHTSQKEVPLVTRLMRYYAGWADKIHGLTVPADGPYHVQVLHEPIGVA  199

Query  645  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            GQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  200  GQIIPWNFPLMMFAWKVGPALACGNTIVLKTA  231



>ref|XP_004953799.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Setaria italica]
Length=548

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            EE + PAVE+K+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR
Sbjct  56   EEPIQPAVEIKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAAR  115

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYER R++L+FADL+E+H DE+A LETWDNGK   Q+A +E+PM+ R 
Sbjct  116  KAFDEGPWPRMTAYERCRVLLRFADLIERHADEIAALETWDNGKTLAQSAGAEVPMLARC  175

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
              YYAGWADKIHGL VPADG HHVQ LHEP+GVAGQIIPWNFPL MFAWKVGPALACGN 
Sbjct  176  MRYYAGWADKIHGLVVPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAWKVGPALACGNA  235

Query  723  VVLKTA  740
            VVLKTA
Sbjct  236  VVLKTA  241



>ref|XP_010100483.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB82617.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=537

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 166/196 (85%), Gaps = 0/196 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            +  + TAAA+EE + P+V +++T+ +ING+FVDS SGKTFPT DPRT +VI HVAEG  E
Sbjct  35   VANYGTAAAIEEPIKPSVSIEHTKLLINGQFVDSVSGKTFPTFDPRTGEVITHVAEGGKE  94

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            D++ AVA ARKAFDEGPWPKM+AYERS ++L+FADL+EKH +ELA LETWDNGKPYEQA 
Sbjct  95   DVDLAVAVARKAFDEGPWPKMTAYERSLVLLRFADLLEKHTEELAKLETWDNGKPYEQAL  154

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
              ELP+ VRL  YYAGWADKIHGLT  ADGPHHVQTLHEPIGV GQIIPWNFPL MF WK
Sbjct  155  NVELPICVRLIRYYAGWADKIHGLTAQADGPHHVQTLHEPIGVCGQIIPWNFPLLMFVWK  214

Query  693  VGPALACGNTVVLKTA  740
            VGPALA GNT+VLKTA
Sbjct  215  VGPALATGNTIVLKTA  230



>ref|XP_004953798.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Setaria italica]
Length=555

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            EE + PAVE+K+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR
Sbjct  63   EEPIQPAVEIKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAAR  122

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYER R++L+FADL+E+H DE+A LETWDNGK   Q+A +E+PM+ R 
Sbjct  123  KAFDEGPWPRMTAYERCRVLLRFADLIERHADEIAALETWDNGKTLAQSAGAEVPMLARC  182

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
              YYAGWADKIHGL VPADG HHVQ LHEP+GVAGQIIPWNFPL MFAWKVGPALACGN 
Sbjct  183  MRYYAGWADKIHGLVVPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAWKVGPALACGNA  242

Query  723  VVLKTA  740
            VVLKTA
Sbjct  243  VVLKTA  248



>gb|AGV54428.1| mitochondrial aldehyde dehydrogenase [Phaseolus vulgaris]
Length=535

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +3

Query  153  IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE  332
            + ++STAAA+EE + PAV+V+YTQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +E
Sbjct  33   LCKYSTAAAIEEPIKPAVQVEYTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSE  92

Query  333  DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA  512
            DI+RAVAAARKAFD GPWP+M+AYER RI+L+ ADL+EKH DE+A LETWDNGKPYEQ+A
Sbjct  93   DIDRAVAAARKAFDHGPWPRMTAYERQRILLRAADLIEKHNDEIAALETWDNGKPYEQSA  152

Query  513  KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK  692
            K E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWK
Sbjct  153  KIEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLVMFAWK  212



>gb|KHN23562.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=510

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  165  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  344
            S AA VE  ++P V++ ++Q +I+G+FVD+ASGKTFPT DPRT DVIA+VAEG+ ED+NR
Sbjct  30   SAAADVEPSIAP-VQIDHSQLLIDGQFVDAASGKTFPTFDPRTGDVIANVAEGDTEDVNR  88

Query  345  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  524
            AV AARKAFDEGPWPKM+AYERSRI+L FA L+EKH DE+A +ETWD+GK YEQAAK E+
Sbjct  89   AVRAARKAFDEGPWPKMTAYERSRIILHFAGLLEKHNDEVAAIETWDSGKTYEQAAKVEI  148

Query  525  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA  704
            PM+VRLF YYAGW DKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNFPL +F+W   PA
Sbjct  149  PMVVRLFRYYAGWVDKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNFPLLIFSWMAAPA  208

Query  705  LACGNTVVLKTA  740
            LACGNTVV+KT+
Sbjct  209  LACGNTVVIKTS  220



>emb|CDY21806.1| BnaA06g20750D [Brassica napus]
Length=496

 Score =   309 bits (792),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +3

Query  216  YTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKM  395
            YTQ +I+G FVD+ASGKTF TLDPRT +VIA VAEG+AEDI+RAV AARKAFDEG WP+M
Sbjct  15   YTQLLIDGNFVDAASGKTFQTLDPRTGEVIADVAEGDAEDIDRAVKAARKAFDEGSWPRM  74

Query  396  SAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKI  575
            +AYERSRIML+FADLVEKH +ELA LETWDNGK Y+QA  +E+PM+ RLF YYAGWADKI
Sbjct  75   TAYERSRIMLRFADLVEKHSEELAALETWDNGKTYQQAKTAEIPMLARLFRYYAGWADKI  134

Query  576  HGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            HGLTVPADG +HVQTLHEPIG AGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  135  HGLTVPADGNYHVQTLHEPIGAAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTA  189



>gb|AAW50842.1| aldehyde dehydrogenase [Aegiceras corniculatum]
Length=186

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  246  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  425
            VDSASG+TFPT DPRT +VIAH+AEG+ EDINRAV AARKAFDEGPWP+M+AYERSRI+L
Sbjct  1    VDSASGRTFPTYDPRTGEVIAHLAEGDEEDINRAVNAARKAFDEGPWPRMTAYERSRILL  60

Query  426  KFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGP  605
            + ADLVEKH +ELA LETW+NGKPYEQAA++ELP+ VRLFHYYAGWADKIHGLTV +DGP
Sbjct  61   RCADLVEKHSEELAALETWNNGKPYEQAAEAELPLFVRLFHYYAGWADKIHGLTVQSDGP  120

Query  606  HHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            +H Q LHEPIGVA QIIPWNFPL MFAWKVGPALACGNTVVLKTA
Sbjct  121  YHTQVLHEPIGVARQIIPWNFPLLMFAWKVGPALACGNTVVLKTA  165



>ref|XP_007151102.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
 gb|ESW23096.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
Length=522

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  198  PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE  377
            P V++++ Q +I+G FVD+ASGKTFPT DPRT D IA+VAE + ED+NRAV AARKAFDE
Sbjct  42   PPVQIEHNQLLIDGLFVDAASGKTFPTNDPRTGDTIANVAEADVEDVNRAVRAARKAFDE  101

Query  378  GPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYA  557
            GPWPKM+AYERSRI+L+ AD++EKH DE+A +ETWD+GKPYEQAA  E+PM+VRLF YYA
Sbjct  102  GPWPKMTAYERSRIILRCADILEKHNDEVAAIETWDSGKPYEQAANVEIPMVVRLFRYYA  161

Query  558  GWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKT  737
            GWADKIHGLTVPADGP+HVQTLHEPIGVAGQI+PWNFPL +F+WKV PALACG TVV+KT
Sbjct  162  GWADKIHGLTVPADGPYHVQTLHEPIGVAGQIVPWNFPLLIFSWKVAPALACGCTVVMKT  221

Query  738  A  740
            A
Sbjct  222  A  222



>gb|KEH19981.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=509

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = +3

Query  159  RFSTAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED  335
            ++STAAA++E  + P+V+V +TQ +I+GKFVD+ASGKTFPTLDPRT +VIAHVAEG +ED
Sbjct  40   KYSTAAAIDEQPIKPSVQVDHTQLLIDGKFVDAASGKTFPTLDPRTGEVIAHVAEGHSED  99

Query  336  INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK  515
            ++RAVAAARKAFD+GPWPK  AYER +IML+ ADL+EKH D++A LETWDNGKPYEQ+A+
Sbjct  100  VDRAVAAARKAFDQGPWPKFPAYERQKIMLRAADLIEKHNDQIAALETWDNGKPYEQSAQ  159

Query  516  SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV  695
             E+PM+VRLF YYAGWADKIHGLTVPADGP+HVQTLHEPIGVAGQIIPWNFPL MFAWK 
Sbjct  160  IEIPMLVRLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKA  219

Query  696  G  698
            G
Sbjct  220  G  220



>gb|AAZ79356.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=477

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  258  SGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFAD  437
            +GKTFPT DPRT +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FAD
Sbjct  10   TGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFAD  69

Query  438  LVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQ  617
            L EKH DELA LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ
Sbjct  70   LAEKHNDELAALETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQ  129

Query  618  TLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
             LHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  130  ILHEPIGVAGQIIPWNFPLMMFAWKVGPALACGNTIVLKTA  170



>gb|AEV54527.1| aldehyde dehydrogenase ALDH2B4_V2 [Vitis vinifera]
Length=477

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  258  SGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFAD  437
            +GKTFPT DPRT +VIA+VAEG+AEDINRAV+AARKAFDEGPWP+MS YERSRI+L+FAD
Sbjct  10   TGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFAD  69

Query  438  LVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQ  617
            L EKH DELA LETW+NGKPYEQAAK+ELP+ VRLF YYAGWADKIHGLTV ADGPHHVQ
Sbjct  70   LAEKHNDELAALETWNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQ  129

Query  618  TLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
             LHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT+VLKTA
Sbjct  130  ILHEPIGVAGQIIPWNFPLMMFAWKVGPALACGNTIVLKTA  170



>gb|KJB50198.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=492

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  246  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  425
            ++ + GKTFPT DPRT DVIAHVAEG+AEDINRAV+AARKAFDEGPWPKM+AYERSR++ 
Sbjct  21   LNQSHGKTFPTYDPRTGDVIAHVAEGDAEDINRAVSAARKAFDEGPWPKMTAYERSRVLF  80

Query  426  KFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGP  605
            +FADL+++H +ELATLETWDNGKPYEQAAK ELPMI RL  YYAGWADKIHGLTVPAD P
Sbjct  81   RFADLIDQHTEELATLETWDNGKPYEQAAKIELPMISRLIRYYAGWADKIHGLTVPADSP  140

Query  606  HHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            H VQT+HEPIGVAGQIIPWNFP+ MFAWKVGPALACGNTVV+KTA
Sbjct  141  HLVQTIHEPIGVAGQIIPWNFPVLMFAWKVGPALACGNTVVIKTA  185



>gb|AFW63787.1| hypothetical protein ZEAMMB73_379378 [Zea mays]
Length=401

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAWKVGPALACGNTVVL
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAWKVGPALACGNTVVL  240

Query  732  KTA  740
            KTA
Sbjct  241  KTA  243



>ref|XP_006647839.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=551

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 169/201 (84%), Gaps = 5/201 (2%)
 Frame = +3

Query  153  IQRFSTAAAVE-----ELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVA  317
            I RFS A A       E + P VEVKYT+ +ING FVD+ASG+TFPT+DPRT +VIA VA
Sbjct  44   IHRFSAAPAAAGGARGEPIQPPVEVKYTKLLINGNFVDAASGRTFPTVDPRTGEVIARVA  103

Query  318  EGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKP  497
            EG+AEDINRAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H +E+ATLETWD GK 
Sbjct  104  EGDAEDINRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIEQHAEEIATLETWDGGKT  163

Query  498  YEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLA  677
             EQ +  E+PM+ R   YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQ+IPWNFPL 
Sbjct  164  LEQTSGKEVPMVARSMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQVIPWNFPLL  223

Query  678  MFAWKVGPALACGNTVVLKTA  740
            MFAWKVGPALACGNTVVLKTA
Sbjct  224  MFAWKVGPALACGNTVVLKTA  244



>ref|XP_002321583.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEF05710.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=497

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  255  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  434
            + GKTFPT DPRT +VIAHVAEG+AED+NRAVAAARKAFDEGPWPKMSAYERS IML+FA
Sbjct  29   SRGKTFPTHDPRTGEVIAHVAEGDAEDVNRAVAAARKAFDEGPWPKMSAYERSLIMLRFA  88

Query  435  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  614
            DLV+KH  ELA LE+W++GKPYEQ+AKSELP   RLF YYAGWADKIHGLTVPADG HHV
Sbjct  89   DLVDKHRGELAALESWNSGKPYEQSAKSELPSFARLFRYYAGWADKIHGLTVPADGNHHV  148

Query  615  QTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            QTLHEPIGVAGQIIPWNFPL MFAWKVGPALACGNT+VLK+A
Sbjct  149  QTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTIVLKSA  190



>gb|AFW63788.1| hypothetical protein ZEAMMB73_379378 [Zea mays]
Length=468

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAWKVGPALACGNTVVL
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAWKVGPALACGNTVVL  240

Query  732  KTA  740
            KTA
Sbjct  241  KTA  243



>gb|ACG32898.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 174/214 (81%), Gaps = 8/214 (4%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            SA LG      + + RFSTA A         + PAVEVK+TQ +ING FVD+ASGKTFPT
Sbjct  33   SALLGSG---AAALHRFSTAPASAAAAAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPT  89

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIA VAEG++EDI+RAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H +
Sbjct  90   LDPRTGEVIARVAEGDSEDIDRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIERHAE  149

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+A LETWDNGK   QAA +E+PM+ R   YYAGWADKIHGL  PADG HHVQ LHEP+G
Sbjct  150  EVAALETWDNGKTLAQAAGAEVPMVARCVRYYAGWADKIHGLVAPADGAHHVQVLHEPVG  209

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL MFAWKVGPALACGNTVVLKTA
Sbjct  210  VAGQIIPWNFPLLMFAWKVGPALACGNTVVLKTA  243



>dbj|BAB92018.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=551

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  62   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  121

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  122  DEGPWPRMTAYERCRVLLRFADLIERHAEEIAALETWDNGKTLAQAAGAEVPMVARCIRY  181

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
            YAGWADKIHGL VP DG HHVQ LHEP+GVAGQIIPWNFPL MFAWKVGPALACGNTVVL
Sbjct  182  YAGWADKIHGLVVPGDGAHHVQVLHEPVGVAGQIIPWNFPLLMFAWKVGPALACGNTVVL  241

Query  732  KTA  740
            KTA
Sbjct  242  KTA  244



>gb|KHN05814.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=403

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 164/207 (79%), Gaps = 18/207 (9%)
 Frame = +3

Query  126  GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDS--ASGKTFPTLDPRTED  299
            G   G    + RFSTAAAVEEL+ P V + YT+H+ING+FVD+  ASGKTFPT DPRT +
Sbjct  19   GRNSGKWGNVNRFSTAAAVEELIIPQVPITYTKHLINGQFVDADAASGKTFPTYDPRTGE  78

Query  300  VIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLET  479
            VIA VAEG+AEDINRAV+AARKAFDEGPWPKM+AY              KH DELA L+T
Sbjct  79   VIARVAEGDAEDINRAVSAARKAFDEGPWPKMTAY--------------KHSDELAALKT  124

Query  480  WDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIP  659
            W+NGKPYEQ A SELP  VRLF YYA  ADKIHGLTVPADG +HV+TLHE IGVAGQIIP
Sbjct  125  WNNGKPYEQWATSELPTFVRLFRYYA--ADKIHGLTVPADGNYHVETLHELIGVAGQIIP  182

Query  660  WNFPLAMFAWKVGPALACGNTVVLKTA  740
            WNFPL MFAWKVGPALACGNTV+LKTA
Sbjct  183  WNFPLLMFAWKVGPALACGNTVILKTA  209



>ref|NP_001105576.1| aldehyde dehydrogenase2 [Zea mays]
 gb|AAL99613.1|AF348417_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
Length=550

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 174/214 (81%), Gaps = 8/214 (4%)
 Frame = +3

Query  114  SAFLGWKYGVESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPT  278
            SA LG      + + RFSTA A         + PAVEVK+TQ +ING FVD+ASGKTFPT
Sbjct  33   SALLGSG---AAALHRFSTAPASAAAAAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPT  89

Query  279  LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD  458
            LDPRT +VIA VAEG++EDI+RAVAAAR+AFDEGPWP+M+AY+R R++L+FADL+E+H +
Sbjct  90   LDPRTGEVIARVAEGDSEDIDRAVAAARRAFDEGPWPRMTAYDRCRVLLRFADLIERHAE  149

Query  459  ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG  638
            E+A LETWDNGK   QAA +E+PM+ R   YYAGWADKIHGL  PADG HHVQ LHEP+G
Sbjct  150  EVAALETWDNGKTLAQAAGAEVPMVARCVRYYAGWADKIHGLVAPADGAHHVQVLHEPVG  209

Query  639  VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            VAGQIIPWNFPL MFAWKVGPALACGNTVVLKTA
Sbjct  210  VAGQIIPWNFPLLMFAWKVGPALACGNTVVLKTA  243



>gb|AHM26657.1| aldehyde dehydrogenase 2-2 [Zea mays subsp. mays]
Length=550

 Score =   296 bits (758),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAWKVGPALACGNTVVL
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAWKVGPALACGNTVVL  240

Query  732  KTA  740
            KTA
Sbjct  241  KTA  243



>gb|AAL99614.2|AF348418_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
 gb|AFW63789.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   296 bits (757),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA VAEG++EDI+RAVAAAR+AF
Sbjct  61   IQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIARVAEGDSEDIDRAVAAARRAF  120

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            DEGPWP+M+AYER R++L+FADL+E+H +E+A LETWDNGK   QAA +E+PM+ R   Y
Sbjct  121  DEGPWPRMTAYERCRVLLRFADLIERHAEEVAALETWDNGKTLAQAAGAEVPMVARCVRY  180

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
            YAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFPL MFAWKVGPALACGNTVVL
Sbjct  181  YAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFPLLMFAWKVGPALACGNTVVL  240

Query  732  KTA  740
            KTA
Sbjct  241  KTA  243



>gb|EEC73936.1| hypothetical protein OsI_08800 [Oryza sativa Indica Group]
Length=553

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            + P V+VKYT+ +ING FVD+ASGKTF T+DPRT DVIA VAEG+AED+NRAVAAAR+AF
Sbjct  64   IQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAARRAF  123

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            DEGPWP+M+AYER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+PM+ R   Y
Sbjct  124  DEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRY  183

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
            Y GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWKVGPALACGN VVL
Sbjct  184  YGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNAVVL  243

Query  732  KTA  740
            KTA
Sbjct  244  KTA  246



>ref|NP_001048010.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAA96793.1| mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa Japonica 
Group]
 dbj|BAD15919.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16358.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAF09924.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAH00573.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57740.1| hypothetical protein OsJ_08254 [Oryza sativa Japonica Group]
Length=553

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            + P V+VKYT+ +ING FVD+ASGKTF T+DPRT DVIA VAEG+AED+NRAVAAAR+AF
Sbjct  64   IQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAARRAF  123

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            DEGPWP+M+AYER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+PM+ R   Y
Sbjct  124  DEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRY  183

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
            Y GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWKVGPALACGN VVL
Sbjct  184  YGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNAVVL  243

Query  732  KTA  740
            KTA
Sbjct  244  KTA  246



>gb|EMT22926.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=678

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 164/199 (82%), Gaps = 3/199 (2%)
 Frame = +3

Query  153  IQRFSTAAAV---EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG  323
            + RFSTA A    EE + P VEVKYTQ +ING FVD+ASG+TFPT+DPRT +VIA VAEG
Sbjct  40   VYRFSTAPAATADEEPIKPPVEVKYTQLLINGNFVDAASGRTFPTVDPRTGEVIARVAEG  99

Query  324  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE  503
            +AEDI+RAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H DE+A  E+WD GKP E
Sbjct  100  DAEDIDRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLMERHNDEIAARESWDGGKPLE  159

Query  504  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF  683
            Q+A  E+P   R    YAGWADKIHG+ VPADGPHHVQ L EPIGVAGQIIPWN PL MF
Sbjct  160  QSAGGEVPRAARCMRSYAGWADKIHGMVVPADGPHHVQVLREPIGVAGQIIPWNVPLLMF  219

Query  684  AWKVGPALACGNTVVLKTA  740
            AWKVGPALAC N VVLKTA
Sbjct  220  AWKVGPALACRNAVVLKTA  238



>ref|XP_006439785.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53025.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=478

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +3

Query  255  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  434
            A GKTFP  DPRT +VIA+VAEG+AEDI+RAVA ARKAFDEGPWPKM+ YERSRIML+ A
Sbjct  10   ALGKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAA  69

Query  435  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  614
            DL+EK+M+ELA LETW+NGKPY Q+ KSE+PM+VRL HYYAGWADKIHGLTVP DG +H+
Sbjct  70   DLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGNYHI  129

Query  615  QTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            QTLHEPIGVAGQI+PWNFPL +F WKV PAL CGNT+VLK+A
Sbjct  130  QTLHEPIGVAGQIVPWNFPLLLFTWKVAPALTCGNTIVLKSA  171



>gb|ACU18804.1| unknown [Glycine max]
Length=199

 Score =   271 bits (693),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  123  LGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV  302
            LG   G      RFSTAAAVE+L++P V + YT+H+ING+FVD+ASGKTFPT DPRT +V
Sbjct  28   LGRNSGKWGNFNRFSTAAAVEDLITPQVPITYTKHLINGQFVDAASGKTFPTYDPRTGEV  87

Query  303  IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW  482
            IA VAEG+AEDINRAV+AARKAFDEGPWPK++AYER +I+L+FADLVEKH DELA LETW
Sbjct  88   IAQVAEGDAEDINRAVSAARKAFDEGPWPKLTAYERCKIILRFADLVEKHGDELAALETW  147

Query  483  DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPI  635
            +NGKPYEQ+A +ELP  VRLF YYAGWADKIHGLTVPADG +HV+TLHEP+
Sbjct  148  NNGKPYEQSATAELPTFVRLFRYYAGWADKIHGLTVPADGNYHVETLHEPM  198



>ref|XP_001785650.1| predicted protein [Physcomitrella patens]
 gb|EDQ49530.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            VEVK T+ +I+G+FVD+ASGKTFPT+DPR+E VIAHVAEG+ ED+NRAV AARKAFD GP
Sbjct  45   VEVKLTKLLIDGEFVDAASGKTFPTIDPRSEQVIAHVAEGDVEDVNRAVRAARKAFDHGP  104

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            WPKM  ++R RI+LK+ADL+++H DELA LET D+GKPYEQA  +ELP++ R F Y+AGW
Sbjct  105  WPKMPPFQRQRILLKYADLLDQHADELAALETMDSGKPYEQARYAELPLMSRQFRYFAGW  164

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKI G T P+DG H VQTLHEPIGV GQIIPWNFPL M+ WKV PALA GNT+VLKTA
Sbjct  165  ADKIFGTTGPSDGIHAVQTLHEPIGVVGQIIPWNFPLVMYCWKVAPALAAGNTIVLKTA  223



>gb|KDO82484.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=493

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  183  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            E+ ++P V+V YTQ +ING+FVDSASGKTFPTLDPRT DVI HVAEGEAED+NRAV+AAR
Sbjct  54   EDPITPPVKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAAR  113

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAFDEGPWP+M+AYERS+I+L+FADL+E+H DE+A LETWDNGKP+EQ+A++E+PM  RL
Sbjct  114  KAFDEGPWPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRL  173

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  647
            F YYAGWADKI GLT PADGP+HVQTLHEPIGVAG
Sbjct  174  FRYYAGWADKIQGLTAPADGPYHVQTLHEPIGVAG  208



>gb|ABD35815.1| putative mitochondrial aldehyde dehydrogenase [Populus x canadensis]
Length=149

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  168  TAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRA  347
            T AAVE+ ++P V VKY Q +ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+ ED+NRA
Sbjct  1    TLAAVEDPITPPVSVKYNQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVEDVNRA  60

Query  348  VAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELP  527
            V+AARKAFDEGPWP+M+AYERSRI+ +FADL+EKH DE+A LETWDNGKPYEQ+AK E+P
Sbjct  61   VSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALETWDNGKPYEQSAKIEIP  120

Query  528  MIVRLFHYYAGWADKIHGLTVPADGPHHV  614
            M VR+F YYAGWADKIHGLTVPADGP+HV
Sbjct  121  MTVRIFRYYAGWADKIHGLTVPADGPYHV  149



>ref|XP_002978501.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
 gb|EFJ20487.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
Length=497

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +3

Query  246  VDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIML  425
            + +  G+TFPT+DPRTE+V+A VA+ + EDINRAV AARKAFD GPWP+M+AYERS+I+L
Sbjct  25   IGACPGETFPTVDPRTEEVLADVAKADVEDINRAVKAARKAFDHGPWPRMTAYERSKILL  84

Query  426  KFADLVEKHMDELATLETWDNGKPYEQAAKSELP-MIVRLFHYYAGWADKIHGLTVPADG  602
            K+ADL+EKH DELATL++ D+GK Y Q+   E+P  + RLF YYAGWADKIHG T+PADG
Sbjct  85   KYADLLEKHNDELATLDSLDSGKLYSQSQGVEIPHFVTRLFRYYAGWADKIHGKTLPADG  144

Query  603  PHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            PH V T HEPIGV GQIIPWNFP+ MFAWKV PALACGNT+VLKTA
Sbjct  145  PHQVLTFHEPIGVVGQIIPWNFPMVMFAWKVAPALACGNTIVLKTA  190



>ref|XP_002970420.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
 gb|EFJ28550.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
Length=488

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +3

Query  264  KTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLV  443
            +TFPT+DPRTE+V+A VA+ + EDINRAV AARKAFD GPWP+M+AYERS+I+LK+ADL+
Sbjct  22   ETFPTVDPRTEEVLADVAKADVEDINRAVKAARKAFDHGPWPRMTAYERSKILLKYADLL  81

Query  444  EKHMDELATLETWDNGKPYEQAAKSELP-MIVRLFHYYAGWADKIHGLTVPADGPHHVQT  620
            EKH DELATL++ D+GK Y Q+   E+P  + RLF YYAGWADKIHG T+PADGPH V T
Sbjct  82   EKHNDELATLDSLDSGKLYSQSQGVEIPHFVTRLFRYYAGWADKIHGKTLPADGPHQVLT  141

Query  621  LHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
             HEPIGV GQIIPWNFP+ MFAWKV PALACGNT+VLKTA
Sbjct  142  FHEPIGVVGQIIPWNFPMVMFAWKVAPALACGNTIVLKTA  181



>ref|XP_002983210.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
 gb|EFJ15552.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
Length=483

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  255  ASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFA  434
            A+GKTFPT+DPR+E++IA VAEG+ ED+NRAV AAR AF++GPWP+M+AYERS+I+ ++A
Sbjct  15   ATGKTFPTIDPRSEEIIAQVAEGDEEDVNRAVKAARNAFEKGPWPRMTAYERSKILFRYA  74

Query  435  DLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV  614
            DL+E+H DEL  L+  D+GK  +QA  +E+P ++R F YYAGWADKIHG+T+ AD PHHV
Sbjct  75   DLLEQHSDELVALDVLDSGKTIDQATFAEMPNVIRWFRYYAGWADKIHGMTLQADSPHHV  134

Query  615  QTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
             TLHEP+GV GQI+PWNFP+ MF+WKV PALACGNT+VLK+A
Sbjct  135  HTLHEPVGVVGQIVPWNFPMIMFSWKVAPALACGNTIVLKSA  176



>ref|XP_002961352.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
 gb|EFJ38891.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
Length=491

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  264  KTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLV  443
            KTFPT+DPR+E++IA VAEG+ ED+NRAV AAR AF++GPWP+M+AYERS+I+ ++ADL+
Sbjct  26   KTFPTIDPRSEEIIAQVAEGDEEDVNRAVKAARNAFEKGPWPRMTAYERSKILFRYADLL  85

Query  444  EKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTL  623
            E+H DEL  L+  DNGK  +QA  +E+P ++R F YYAGWADKIHG+T+ AD PHHV TL
Sbjct  86   EQHSDELVALDVLDNGKTIDQATFAEMPNVIRWFRYYAGWADKIHGMTLQADSPHHVHTL  145

Query  624  HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            HEPIGV GQI+PWNFP+ MF+WKV PALACGNTVVLK+A
Sbjct  146  HEPIGVVGQIVPWNFPIIMFSWKVAPALACGNTVVLKSA  184



>ref|WP_036269309.1| betaine-aldehyde dehydrogenase [Methylocaldum szegediense]
Length=492

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 145/186 (78%), Gaps = 1/186 (1%)
 Frame = +3

Query  186  ELVSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR  362
            +L++P+ +++  T+ +I+GK+VDSASGKTF T++P T +VIAHVAEG+ ED++RAV AAR
Sbjct  6    KLINPSEIKISQTKMLIDGKWVDSASGKTFETINPATGEVIAHVAEGDREDVDRAVRAAR  65

Query  363  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL  542
            KAF+EGPW KMSA ER R + + ADL+EKH DELA LET +NGKP  ++  ++LP+ +  
Sbjct  66   KAFEEGPWRKMSARERGRCLYRLADLIEKHFDELAALETLNNGKPINESRSADLPLTIEC  125

Query  543  FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT  722
            + YYAGWADKI G T+P +GP    T HEP+GV GQIIPWNFPL M AWK GPALA G T
Sbjct  126  YRYYAGWADKIEGKTIPINGPFFTYTRHEPVGVVGQIIPWNFPLLMQAWKWGPALAAGCT  185

Query  723  VVLKTA  740
            +VLK A
Sbjct  186  IVLKPA  191



>ref|XP_002983288.1| hypothetical protein SELMODRAFT_180171 [Selaginella moellendorffii]
 gb|EFJ15630.1| hypothetical protein SELMODRAFT_180171 [Selaginella moellendorffii]
Length=500

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = +3

Query  192  VSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA  368
            + PA V VKYT+  I+G+FVD+ SG+TF TLDPR  +VI+ VAE + +D++ AV AARKA
Sbjct  11   IGPAPVSVKYTKLFIDGQFVDAVSGRTFETLDPRNGEVISKVAEADKQDVDVAVKAARKA  70

Query  369  FDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFH  548
            FD GPWP++S Y R RI+LKFADL+E H DELA LET DNGKP +     +LPM +RL  
Sbjct  71   FDHGPWPRLSGYARGRILLKFADLLEHHFDELAALETLDNGKPLDLVKYVDLPMALRLLR  130

Query  549  YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVV  728
             +AG+ADKI G TV  DGP+H  TL EPIGV GQIIPWNFPL MF  K+ PALA GNT+V
Sbjct  131  SFAGFADKICGKTVKIDGPYHAYTLLEPIGVVGQIIPWNFPLIMFFLKISPALAAGNTIV  190

Query  729  LKTA  740
            LKTA
Sbjct  191  LKTA  194



>ref|XP_002961274.1| hypothetical protein SELMODRAFT_164447 [Selaginella moellendorffii]
 gb|EFJ38813.1| hypothetical protein SELMODRAFT_164447 [Selaginella moellendorffii]
Length=500

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = +3

Query  192  VSPA-VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA  368
            + PA V VKYT+  I+G+FVD+ SG+TF TLDPR  +VI+ VAE + +D++ AV AARKA
Sbjct  11   IGPAPVSVKYTKLFIDGQFVDAVSGRTFETLDPRNGEVISKVAEADKQDVDVAVKAARKA  70

Query  369  FDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFH  548
            FD GPWP++S Y R RI+LKFADL+E H DELA LET DNGKP +     +LPM +RL  
Sbjct  71   FDHGPWPRLSGYARGRILLKFADLLEHHFDELAALETLDNGKPLDLVKYVDLPMALRLLR  130

Query  549  YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVV  728
             +AG+ADKI G TV  DGP+H  TL EPIGV GQIIPWNFPL MF  K+ PALA GNT+V
Sbjct  131  SFAGFADKICGKTVKIDGPYHAYTLLEPIGVVGQIIPWNFPLIMFFLKISPALAAGNTIV  190

Query  729  LKTA  740
            LKTA
Sbjct  191  LKTA  194



>gb|AAK57987.1| T cytoplasm male sterility restorer factor 2, partial [Zea mays]
Length=129

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  288  RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA  467
            RT +VIAHVAEG+AEDINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA
Sbjct  1    RTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELA  60

Query  468  TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG  647
             LETWDNGKPYEQAA+ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAG
Sbjct  61   ALETWDNGKPYEQAAQIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAG  120

Query  648  QIIPWNF  668
            QIIP  F
Sbjct  121  QIIPGTF  127



>gb|ABR16485.1| unknown [Picea sitchensis]
Length=500

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  192  VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAF  371
            V P V VKYT+  ING+FVDS SGKTF TLDPRT + I  V+E + ED++ AV AAR AF
Sbjct  11   VLPPVTVKYTKLFINGEFVDSVSGKTFETLDPRTGEAITRVSEAQKEDVDLAVKAARAAF  70

Query  372  DEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY  551
            D GPWP+MS +ER RI+ K+ADLV +H DELA LET+DNGKP + A   ++P  V +  Y
Sbjct  71   DHGPWPRMSGFERGRILYKYADLVSQHGDELAALETFDNGKPLDMARILDIPYSVEVIRY  130

Query  552  YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL  731
             AG+ADKIHGLT+   G +   TLHEPIGV GQ+IPWNFP+  F  KV PALACG TVV+
Sbjct  131  NAGFADKIHGLTLKMSGQYQGYTLHEPIGVVGQMIPWNFPILTFFSKVSPALACGCTVVI  190

Query  732  KTA  740
            K+A
Sbjct  191  KSA  193



>gb|EWM25899.1| aldehyde dehydrogenase [Nannochloropsis gaditana]
Length=601

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 144/205 (70%), Gaps = 5/205 (2%)
 Frame = +3

Query  141  VESGIQRFSTAAAVEEL-----VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI  305
            + +  +RF++  AV  L     + P+   + TQ +I+GKF D+ SGKTF T+DPRTE+ I
Sbjct  38   LSTACKRFASFKAVRGLHNAAPIKPSHHPRITQLLIDGKFTDAVSGKTFQTIDPRTEETI  97

Query  306  AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD  485
              VA  + ED+N AV AARKAF+ GPW KMS  ER +I+ + ADL+E H +ELA LET D
Sbjct  98   VEVAAADKEDVNLAVNAARKAFETGPWRKMSGRERGKILFRLADLMEAHKEELAVLETLD  157

Query  486  NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN  665
            NGKP   +  S++P+ +  + Y+AGWADKIHG T+P DGP    TL EP+GV GQIIPWN
Sbjct  158  NGKPLSLSRNSDVPLAIDHYRYFAGWADKIHGQTIPVDGPFFAYTLREPVGVVGQIIPWN  217

Query  666  FPLAMFAWKVGPALACGNTVVLKTA  740
            FPL M AWK+GPALA GNTVV+K A
Sbjct  218  FPLLMQAWKLGPALAAGNTVVMKLA  242



>emb|CDW77748.1| betaine-aldehyde dehydrogenase [Stylonychia lemnae]
Length=502

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 133/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V+ + TQ +I+GKFV+S SGKTF T +P TE+ I  V E +  D+++AV AARKAFDEGP
Sbjct  17   VQPRLTQLLIDGKFVNSVSGKTFDTFNPSTEEKIISVQEADKHDVDKAVNAARKAFDEGP  76

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            W +M+A ER +IM +FADLVEKH DELA LE  DNGKP   A  +++P++V    YYAGW
Sbjct  77   WRRMAASERGKIMYRFADLVEKHTDELANLEALDNGKPAAIAKIADIPLVVNTLRYYAGW  136

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
             DKIHG T+P +GP+   T  EP+GV GQIIPWNFP AM AWK+GPALA G T V+KTA
Sbjct  137  TDKIHGKTIPVNGPYFAYTKEEPVGVCGQIIPWNFPAAMLAWKLGPALATGCTTVVKTA  195



>ref|WP_036502729.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
 gb|KFI21710.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
Length=494

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            VEV+ T+ +I+GKF DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGKFCDSLSGKTFATIDPATEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WHRMDARERGRRMLKWADLIEAHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AWK+GPALA G T +LK A
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNFPLAMAAWKLGPALATGCTAILKPA  193



>ref|WP_002814365.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani]
 gb|ABA59058.1| aldehyde dehydrogenase (acceptor) [Nitrosococcus oceani ATCC 
19707]
 gb|EDZ65209.1| aldehyde dehydrogenase (NAD) family protein [Nitrosococcus oceani 
AFC27]
 gb|KFI18483.1| betaine-aldehyde dehydrogenase [Nitrosococcus oceani C-27]
Length=494

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            VEV+ T+ +I+GKF DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGKFCDSLSGKTFATIDPATEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WHRMDARERGRRMLKWADLIEAHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AWK+GPALA G T +LK A
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNFPLAMAAWKLGPALATGCTAILKPA  193



>ref|WP_013034365.1| betaine-aldehyde dehydrogenase [Nitrosococcus halophilus]
 gb|ADE16516.1| Retinal dehydrogenase [Nitrosococcus halophilus Nc 4]
Length=494

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            VEV+ T+ +I+G+F DS SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VEVRQTRLLIDGEFRDSLSGKTFATIDPVTEEVIAQVAEGDAEDIDLAVKAARKAFDTGP  74

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WQQMDARERGRRMLKWADLIETHMEELAKLEVLDNGKPINEALGYDIPSAAATIRYFAGW  134

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AWK+GPALA G T +LK A
Sbjct  135  ADKIHGKTIPVSGPFFTYTRREPVGVCGLIIPWNFPLAMAAWKLGPALAAGCTTILKPA  193



>emb|CDY49384.1| BnaA03g50730D [Brassica napus]
Length=257

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +3

Query  192  VSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARK  365
            VSP   ++  YTQ   NG FV +ASGKTFP LD RT++VIA+VAEG+AEDINRA+ AARK
Sbjct  91   VSPTFFIQFSYTQFPNNGNFVGAASGKTFPALDTRTKEVIANVAEGDAEDINRAMKAARK  150

Query  366  AFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLF  545
            + DEG WPKM AYE S+I+L+F  LVEKH +ELA L+T  NG  Y+QA  +E+ MI  LF
Sbjct  151  SIDEGAWPKMIAYENSKIVLRFTYLVEKHSEELAALDTCGNGNTYDQAKTAEIAMIAGLF  210

Query  546  HYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA  686
               AG ADKIHGLT+PA+G +HVQTLHEPI VAGQIIPWNFPL MFA
Sbjct  211  CNDAGGADKIHGLTIPANGNYHVQTLHEPICVAGQIIPWNFPLLMFA  257



>ref|WP_021832205.1| Aldehyde dehydrogenase [Crocosphaera watsonii]
 emb|CCQ53790.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0005]
Length=356

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  37   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  96

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  97   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  156

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AWK+ PALA GNTVV+KTA
Sbjct  157  ADKIQGKTIPINGPYFCYTSHEPVGVVGQIIPWNFPLLMQAWKLAPALAAGNTVVMKTA  215



>ref|WP_008272605.1| betaine-aldehyde dehydrogenase [Cyanothece sp. CCY0110]
 gb|EAZ94265.1| aldehyde dehydrogenase [Cyanothece sp. CCY0110]
Length=490

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  219  TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS  398
            TQ +IN ++++SASGK F T++P T +VI  VAE +AED+++AV AAR AF++G WP +S
Sbjct  16   TQLLINNEWIESASGKRFETINPTTGEVICDVAEADAEDVDKAVKAARNAFNQGDWPNLS  75

Query  399  AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH  578
            A +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGWADKI 
Sbjct  76   ASQRGKLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGWADKIQ  135

Query  579  GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            G T+P +GP+   T HEP+GV GQIIPWNFPL M AWK+GPALA GNTVV+KTA
Sbjct  136  GKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLGPALATGNTVVMKTA  189



>ref|WP_013219586.1| betaine-aldehyde dehydrogenase [Nitrosococcus watsonii]
 gb|ADJ27478.1| Retinal dehydrogenase [Nitrosococcus watsonii C-113]
Length=494

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V V+ T+ +I+G+F +S SGKTF T+DP TE+VIA VAEG+AEDI+ AV AARKAFD GP
Sbjct  15   VAVRQTRLLIDGEFRNSLSGKTFATVDPSTEEVIAQVAEGDAEDIDLAVQAARKAFDSGP  74

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            W +M A ER R MLK+ADL+E HM+ELA LE  DNGKP  +A   ++P       Y+AGW
Sbjct  75   WRQMDARERGRRMLKWADLIEDHMEELAKLEVLDNGKPINEALGYDIPSAAATLRYFAGW  134

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKIHG T+P  GP    T  EP+GV G IIPWNFPLAM AWK+GPALA G T +LK A
Sbjct  135  ADKIHGKTIPISGPFFTYTRREPVGVCGLIIPWNFPLAMAAWKLGPALAAGCTAILKPA  193



>ref|WP_007307870.1| betaine-aldehyde dehydrogenase [Crocosphaera watsonii]
 gb|EAM48335.1| Aldehyde dehydrogenase (NAD+) [Crocosphaera watsonii WH 8501]
 emb|CCQ51857.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 8502]
Length=490

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AWK+ PALA GNTVV+KTA
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLAPALAAGNTVVMKTA  189



>emb|CCQ61589.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0401]
Length=490

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AWK+ PALA GNTVV+KTA
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLAPALAAGNTVVMKTA  189



>ref|WP_015249427.1| betaine-aldehyde dehydrogenase [Singulisphaera acidiphila]
 gb|AGA30341.1| NAD-dependent aldehyde dehydrogenase [Singulisphaera acidiphila 
DSM 18658]
Length=491

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +3

Query  219  TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS  398
            T+ +I+GK+ DS SGKTF T++P TE+VIA VAEG+A DI+ AV AARKAFD GPW KM 
Sbjct  17   TKLLIDGKWRDSLSGKTFDTVNPATEEVIAQVAEGDAADIDLAVKAARKAFDSGPWRKMD  76

Query  399  AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH  578
            A +R R+M +FADL+E+++DELA LET DNGKP  ++  ++LP+++  F YYAGWADKI 
Sbjct  77   ARDRGRLMNRFADLIEENVDELAELETLDNGKPIGESRHADLPLVIDCFRYYAGWADKIS  136

Query  579  GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            G TVP  G     T  EPIGVAGQIIPWNFP+ M AWK GPALA G TVVLK A
Sbjct  137  GQTVPIRGNFFCYTKREPIGVAGQIIPWNFPMLMVAWKWGPALAAGCTVVLKPA  190



>emb|CCQ69085.1| Aldehyde dehydrogenase [Crocosphaera watsonii WH 0402]
Length=490

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AWK+ PALA GNTVV+KTA
Sbjct  131  ADKIQGKTIPINGPYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLAPALAAGNTVVMKTA  189



>ref|WP_007312907.1| betaine-aldehyde dehydrogenase [Crocosphaera watsonii]
 gb|EHJ10116.1| aldehyde dehydrogenase [Crocosphaera watsonii WH 0003]
Length=490

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V++  TQ +IN K+V+SASGK F T++P T +VI  VAE +A D+++AV AAR AF++G 
Sbjct  11   VKIGPTQLLINNKWVESASGKRFETINPSTGEVICDVAEADAADVDKAVIAARNAFNQGD  70

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            WPK+SA +R +++ K ADL+E +++ELA LET DNGKPY+ +  ++L +++  + YYAGW
Sbjct  71   WPKLSATQRGQLLYKLADLIEANIEELARLETLDNGKPYQDSLNADLQLVIACYRYYAGW  130

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKI G T+P +GP+   T HEP+GV GQIIPWNFPL M AWK+ PALA GNTVV+KTA
Sbjct  131  ADKIQGKTIPINGPYFCYTSHEPVGVVGQIIPWNFPLLMQAWKLAPALAAGNTVVMKTA  189



>gb|EJY82344.1| hypothetical protein OXYTRI_20134 [Oxytricha trifallax]
Length=505

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = +3

Query  165  STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR  344
            S A A    V+P    K TQ +INGKFV+S SGKTF T +P TE+ IA V E +  D++ 
Sbjct  11   SFATATPAKVTP----KQTQLLINGKFVNSVSGKTFDTFNPATEEKIASVQEADRADVDI  66

Query  345  AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL  524
            AV AARKAFD G W +M A ER  IML+FADL++KH DELA LE  DNGKPY+ A  +++
Sbjct  67   AVKAARKAFDTGHWRRMDARERGNIMLRFADLIDKHADELAALEALDNGKPYKIAQIADI  126

Query  525  PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA  704
            P++     YY GWADKIHG T+P  GP+      EP+GV GQIIPWNFP AM AWK+GPA
Sbjct  127  PLVSNTIRYYGGWADKIHGKTLPISGPYFAYQREEPVGVVGQIIPWNFPAAMLAWKIGPA  186

Query  705  LACGNTVVLKTA  740
            LA G T V+KTA
Sbjct  187  LATGCTTVVKTA  198



>ref|XP_005642981.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE18437.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=486

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 129/173 (75%), Gaps = 0/173 (0%)
 Frame = +3

Query  222  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA  401
            Q +INGKF D++ GKTF T+DPRT + +  VAE +AED++RAV AAR+AFD GPWP+MS 
Sbjct  6    QLLINGKFEDASGGKTFETMDPRTGEPLMTVAEAQAEDVDRAVKAARQAFDHGPWPRMSG  65

Query  402  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG  581
             +R  IM K A L+EK+ +ELATLE+ DNGK Y  A   ++PM V    YYAGWADKI+G
Sbjct  66   RQRGNIMHKLATLMEKNTEELATLESLDNGKAYSAAFSIDVPMAVEHLRYYAGWADKIYG  125

Query  582  LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
             T+P DG     TL EP+GV GQIIPWNFP+ M AWK+GPALA GNT+V+K A
Sbjct  126  QTIPTDGKMQAYTLKEPLGVVGQIIPWNFPILMQAWKLGPALAAGNTIVMKVA  178



>ref|XP_005642984.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE18440.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=565

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +3

Query  228  IINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYE  407
            +I+G+FVD+A G+TFPT DPRT DV+  VAE +  D++RAV AARKAFD GPWP+MS  E
Sbjct  87   LIDGEFVDAAGGETFPTEDPRTGDVLLDVAEAQERDVDRAVQAARKAFDHGPWPRMSGRE  146

Query  408  RSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLT  587
            R  ++ K ADL+E+H+ ELATLE+ DNGKP   A  S+LP  +    Y+AGWADKIHGLT
Sbjct  147  RGLLIYKLADLMEEHLLELATLESLDNGKPLSVAKSSDLPEAIEHLRYFAGWADKIHGLT  206

Query  588  VPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            +P  G     T  EP+GV GQIIPWNFP+ M AWK+GPALA GNT+V+K A
Sbjct  207  IPTAGKMQAHTYREPLGVVGQIIPWNFPILMQAWKLGPALAAGNTIVMKVA  257



>ref|XP_002948098.1| hypothetical protein VOLCADRAFT_73567 [Volvox carteri f. nagariensis]
 gb|EFJ51086.1| hypothetical protein VOLCADRAFT_73567 [Volvox carteri f. nagariensis]
Length=528

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = +3

Query  231  INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER  410
            I+GK+ D+ SG+T   +DPRTE+ +  VAEG+A D+++AV AARKAFD GPWP+M+A ER
Sbjct  62   IDGKWQDAVSGRTISVVDPRTEETVIEVAEGDAADVDKAVKAARKAFDFGPWPRMTAKER  121

Query  411  SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV  590
             R++ K AD +E   +ELA LET DNGKP   +  +++P+ +  F YYAGWADKIHG T+
Sbjct  122  GRLLYKLADAMEAASEELAMLETLDNGKPIFYSRAADVPLSIDHFRYYAGWADKIHGKTI  181

Query  591  PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            P DGP+   TLHEPIGV GQIIPWNFPL M AWK+GPALA GNTVVLK A
Sbjct  182  PVDGPYLAYTLHEPIGVVGQIIPWNFPLLMAAWKLGPALAAGNTVVLKPA  231



>ref|WP_009782331.1| betaine-aldehyde dehydrogenase [Lyngbya sp. PCC 8106]
 gb|EAW38876.1| aldehyde dehydrogenase [Lyngbya sp. PCC 8106]
Length=490

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP  383
            V++  T+ +IN ++VDS SGK F T++P T +VI  VAE +A D+ +AV AARKAF+ G 
Sbjct  11   VKISQTKLLINNEWVDSVSGKRFETINPATGEVICDVAEADAADVEKAVTAARKAFNSGD  70

Query  384  WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW  563
            WP +SA +R  ++ K ADL+E++ +ELA LET DNGKP  ++   +LP  +  + YYAGW
Sbjct  71   WPNISARKRGELLYKLADLIEQNKEELALLETLDNGKPIGESMTIDLPFAIACYRYYAGW  130

Query  564  ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA  740
            ADKI G T+P DGPH   T HEP+GV GQIIPWNFPL M AWK+GPALA GNTV+LKTA
Sbjct  131  ADKIQGKTIPVDGPHLCYTRHEPVGVVGQIIPWNFPLVMQAWKLGPALAAGNTVILKTA  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515