BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF042L07

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011102309.1|  PREDICTED: cyclin-A1-1                             114   1e-25   Sesamum indicum [beniseed]
ref|NP_001233762.1|  cyclin A1                                          105   4e-25   Solanum lycopersicum
ref|XP_010312445.1|  PREDICTED: cyclin A1 isoform X1                    105   4e-25   
dbj|BAE06271.1|  cyclin A                                               112   4e-25   Scutellaria baicalensis [Baikal skullcap]
emb|CDP10969.1|  unnamed protein product                                109   7e-24   Coffea canephora [robusta coffee]
ref|XP_009593178.1|  PREDICTED: cyclin-A1-4 isoform X2                  107   2e-23   Nicotiana tomentosiformis
emb|CAA63542.1|  cyclin A-like protein                                  107   2e-23   Nicotiana tabacum [American tobacco]
ref|XP_009593177.1|  PREDICTED: cyclin-A1-4 isoform X1                  107   2e-23   Nicotiana tomentosiformis
dbj|BAA09366.1|  A-type cyclin                                          107   2e-23   Nicotiana tabacum [American tobacco]
ref|XP_006351136.1|  PREDICTED: cyclin-A1-3-like isoform X1           99.8    1e-22   Solanum tuberosum [potatoes]
ref|XP_006351137.1|  PREDICTED: cyclin-A1-3-like isoform X2           99.8    1e-22   Solanum tuberosum [potatoes]
ref|XP_006351138.1|  PREDICTED: cyclin-A1-3-like isoform X3           99.8    1e-22   Solanum tuberosum [potatoes]
ref|XP_009796391.1|  PREDICTED: cyclin-A1-4                             102   2e-21   Nicotiana sylvestris
ref|XP_007225619.1|  hypothetical protein PRUPE_ppa004701mg           97.1    1e-19   Prunus persica
ref|XP_008219598.1|  PREDICTED: cyclin-A1-1-like                      96.7    2e-19   Prunus mume [ume]
ref|XP_002284567.1|  PREDICTED: cyclin-A1-1-like                      88.2    1e-17   Vitis vinifera
emb|CBI18982.3|  unnamed protein product                              88.2    1e-17   Vitis vinifera
ref|XP_004290902.1|  PREDICTED: cyclin-A1-1                           87.4    3e-16   Fragaria vesca subsp. vesca
gb|EYU32511.1|  hypothetical protein MIMGU_mgv1a005475mg              85.5    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_010095430.1|  hypothetical protein L484_013387                 79.3    6e-15   Morus notabilis
ref|XP_002520329.1|  cyclin A, putative                               79.0    2e-14   
ref|XP_007019157.1|  Cyclin A1,1 isoform 1                            77.4    6e-13   
ref|XP_006355258.1|  PREDICTED: cyclin-A1-1-like                      73.9    7e-13   
gb|KHG05847.1|  Cyclin-A1-1 -like protein                             74.7    2e-12   Gossypium arboreum [tree cotton]
ref|XP_008352624.1|  PREDICTED: cyclin-A1-1-like                      75.9    2e-12   
ref|XP_006472826.1|  PREDICTED: cyclin-A1-1-like                      75.5    3e-12   Citrus sinensis [apfelsine]
ref|XP_006386358.1|  hypothetical protein POPTR_0002s08020g           73.9    9e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011003420.1|  PREDICTED: cyclin-A1-1-like                      73.9    1e-11   Populus euphratica
gb|KJB59298.1|  hypothetical protein B456_009G248300                  72.0    1e-11   Gossypium raimondii
ref|XP_009343979.1|  PREDICTED: cyclin-A1-1-like                      73.2    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_011027470.1|  PREDICTED: cyclin-A1-1-like                      72.8    2e-11   Populus euphratica
ref|XP_011027473.1|  PREDICTED: cyclin-A1-1-like                      72.8    2e-11   Populus euphratica
gb|KHG23907.1|  Cyclin-A1-1 -like protein                             72.4    3e-11   Gossypium arboreum [tree cotton]
gb|KDP32823.1|  hypothetical protein JCGZ_12115                       67.8    6e-11   Jatropha curcas
ref|XP_010260855.1|  PREDICTED: cyclin-A1-4                           70.5    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_004149427.1|  PREDICTED: cyclin-A1-1-like                      70.1    2e-10   Cucumis sativus [cucumbers]
gb|KJB64519.1|  hypothetical protein B456_010G052900                  66.2    7e-10   Gossypium raimondii
gb|KJB64518.1|  hypothetical protein B456_010G052900                  66.2    8e-10   Gossypium raimondii
ref|XP_007019158.1|  Cyclin A1,1 isoform 2                            67.4    1e-09   
ref|XP_002306649.1|  cyclin family protein                            67.4    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006434257.1|  hypothetical protein CICLE_v10003984mg           67.0    2e-09   
ref|XP_006472825.1|  PREDICTED: cyclin-A1-1-like isoform X2           67.0    2e-09   Citrus sinensis [apfelsine]
ref|XP_006472824.1|  PREDICTED: cyclin-A1-1-like isoform X1           67.0    2e-09   
ref|XP_010532200.1|  PREDICTED: cyclin-A1-1-like isoform X1           66.6    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_010532201.1|  PREDICTED: cyclin-A1-1-like isoform X2           66.6    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_004160710.1|  PREDICTED: cyclin-A1-1-like                      66.6    2e-09   
ref|XP_006434258.1|  hypothetical protein CICLE_v10000927mg           66.6    3e-09   Citrus clementina [clementine]
ref|XP_010664179.1|  PREDICTED: cyclin-A1-1-like                      66.2    3e-09   
ref|XP_003526649.1|  PREDICTED: cyclin-A1-1-like                      66.2    3e-09   Glycine max [soybeans]
ref|XP_008466750.1|  PREDICTED: cyclin-A1-1                           64.7    9e-09   Cucumis melo [Oriental melon]
ref|XP_009341345.1|  PREDICTED: cyclin-A1-4-like                      64.7    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_008338670.1|  PREDICTED: cyclin-A1-4                           64.3    1e-08   
ref|XP_006393746.1|  hypothetical protein EUTSA_v10011442mg           64.3    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_004292715.1|  PREDICTED: cyclin-A1-4-like                      63.9    2e-08   Fragaria vesca subsp. vesca
ref|XP_008219599.1|  PREDICTED: cyclin-A1-4-like                      63.5    3e-08   Prunus mume [ume]
dbj|BAC56853.1|  cyclin A1                                            63.2    4e-08   Silene latifolia
ref|NP_001241939.1|  uncharacterized protein LOC100776207             62.8    4e-08   Glycine max [soybeans]
gb|KHN05188.1|  Cyclin-A1-1                                           62.8    4e-08   Glycine soja [wild soybean]
gb|KJB80669.1|  hypothetical protein B456_013G109600                  61.6    1e-07   Gossypium raimondii
gb|KJB80671.1|  hypothetical protein B456_013G109600                  61.2    1e-07   Gossypium raimondii
ref|XP_009343978.1|  PREDICTED: cyclin-A1-1-like                      61.2    1e-07   Pyrus x bretschneideri [bai li]
gb|KEH35325.1|  carboxy-terminal domain cyclin                        59.7    4e-07   Medicago truncatula
gb|AFK46051.1|  unknown                                               59.7    5e-07   Lotus japonicus
gb|KEH35324.1|  carboxy-terminal domain cyclin                        59.7    5e-07   Medicago truncatula
ref|XP_003630475.1|  Cyclin A-like protein                            59.7    6e-07   
gb|KEH35323.1|  carboxy-terminal domain cyclin                        59.3    6e-07   Medicago truncatula
ref|XP_003630468.1|  Cyclin A                                         59.3    7e-07   
gb|KEH35322.1|  carboxy-terminal domain cyclin                        58.9    8e-07   Medicago truncatula
ref|XP_010063417.1|  PREDICTED: cyclin-A1-1                           58.9    8e-07   
ref|XP_007019153.1|  Cyclin A1,1, putative                            58.9    9e-07   
gb|KDO80523.1|  hypothetical protein CISIN_1g017988mg                 55.1    1e-06   Citrus sinensis [apfelsine]
gb|KJB80670.1|  hypothetical protein B456_013G109600                  57.0    4e-06   Gossypium raimondii
ref|NP_001237800.1|  mitotic cyclin a2-type                           56.6    5e-06   Glycine max [soybeans]
ref|XP_010684698.1|  PREDICTED: cyclin-A1-4-like                      56.6    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008352630.1|  PREDICTED: cyclin-A1-1-like                      55.5    5e-06   
gb|KFK38207.1|  hypothetical protein AALP_AA3G082800                  55.8    1e-05   Arabis alpina [alpine rockcress]
ref|XP_010925928.1|  PREDICTED: cyclin-A1-4                           55.8    1e-05   Elaeis guineensis
gb|KFK24211.1|  hypothetical protein AALP_AAs42301U000600             55.1    2e-05   Arabis alpina [alpine rockcress]
ref|XP_003545652.1|  PREDICTED: cyclin-A1-1-like                      55.1    2e-05   Glycine max [soybeans]
ref|XP_002893979.1|  CYCA1_1                                          53.9    4e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_007137455.1|  hypothetical protein PHAVU_009G128200g           53.9    5e-05   Phaseolus vulgaris [French bean]
gb|KHN38997.1|  Cyclin-A1-1                                           53.9    5e-05   Glycine soja [wild soybean]
ref|XP_006859067.1|  hypothetical protein AMTR_s00068p00198800        53.5    6e-05   Amborella trichopoda
gb|ADA70359.1|  mitotic cyclin A1-like protein                        53.1    7e-05   Persea americana
ref|XP_010521285.1|  PREDICTED: cyclin-A1-2 isoform X1                52.4    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010521286.1|  PREDICTED: cyclin-A1-2 isoform X2                52.4    2e-04   Tarenaya hassleriana [spider flower]
emb|CDY36335.1|  BnaC08g05160D                                        51.6    3e-04   Brassica napus [oilseed rape]
ref|XP_006643958.1|  PREDICTED: cyclin-A1-1-like                      51.2    3e-04   
gb|EEC70248.1|  hypothetical protein OsI_01039                        50.4    6e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008806186.1|  PREDICTED: cyclin-A1-4 isoform X1                50.4    6e-04   Phoenix dactylifera
ref|XP_010095429.1|  hypothetical protein L484_013386                 50.4    7e-04   Morus notabilis
gb|EEE54185.1|  hypothetical protein OsJ_01008                        50.4    7e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004502519.1|  PREDICTED: cyclin-A1-1-like                      49.7    0.001   



>ref|XP_011102309.1| PREDICTED: cyclin-A1-1 [Sesamum indicum]
Length=495

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 100/156 (64%), Gaps = 5/156 (3%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQR--TGsllssrstfsesssIAPCTSKNVGIKKSSSS  388
            GKVA++A      KRPAL NITNQR  +G L S R++  ESS I PC++K V IKK SS+
Sbjct  27   GKVASSAPA--GKKRPALANITNQRHGSGPLNSGRASVPESSKIVPCSAKIVSIKKGSST  84

Query  389  STGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM  568
            S  NA F G ++ PTS+  + + VPS+  S   SD +  K +  P + SMD SP KSD  
Sbjct  85   SM-NASFSGATLPPTSSAKQSMVVPSRATSHTKSDVVYSKTSAAPDSFSMDKSPDKSDSF  143

Query  569  TASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            + SMDESMS CDSL+SPEVEY++  ++     + R+
Sbjct  144  SVSMDESMSTCDSLKSPEVEYMDTNEIAAVDSIERK  179



>ref|NP_001233762.1| cyclin A1 [Solanum lycopersicum]
 emb|CAB46641.1| cyclin A1 [Solanum lycopersicum]
Length=490

 Score =   105 bits (263),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 8/136 (6%)
 Frame = +2

Query  248  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  427
            A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK++S+   NA   GT+++
Sbjct  35   AKKRPALSNISNNTT---VSARNSVSHSSKLAPCTSKIVNIKKNTSACNSNAVSSGTAVL  91

Query  428  PTSTLVKPITVPSKGPSAIGSDAILQKATLPPV--TCSMDNSPAKSDGMTASMDESMSPC  601
            P S+ V+P    SK  S   SDA++ K T+ PV  TCSMD SP+ SDG   SMDESMS  
Sbjct  92   PASSSVRP---SSKPVSIQRSDAVVPKITVIPVPATCSMDISPSHSDGSLVSMDESMSNS  148

Query  602  DSLRSPEVEYINNMKL  649
            D++RSPEVEYI++ +L
Sbjct  149  DTVRSPEVEYIDDHEL  164


 Score = 36.2 bits (82),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  640  HETAGVHSIEKKASSALYISEH  705
            HE A V SIEKKA S LYISEH
Sbjct  162  HELAAVDSIEKKACSTLYISEH  183



>ref|XP_010312445.1| PREDICTED: cyclin A1 isoform X1 [Solanum lycopersicum]
Length=489

 Score =   105 bits (263),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 8/136 (6%)
 Frame = +2

Query  248  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  427
            A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK++S+   NA   GT+++
Sbjct  35   AKKRPALSNISNNTT---VSARNSVSHSSKLAPCTSKIVNIKKNTSACNSNAVSSGTAVL  91

Query  428  PTSTLVKPITVPSKGPSAIGSDAILQKATLPPV--TCSMDNSPAKSDGMTASMDESMSPC  601
            P S+ V+P    SK  S   SDA++ K T+ PV  TCSMD SP+ SDG   SMDESMS  
Sbjct  92   PASSSVRP---SSKPVSIQRSDAVVPKITVIPVPATCSMDISPSHSDGSLVSMDESMSNS  148

Query  602  DSLRSPEVEYINNMKL  649
            D++RSPEVEYI++ +L
Sbjct  149  DTVRSPEVEYIDDHEL  164


 Score = 36.2 bits (82),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  640  HETAGVHSIEKKASSALYISEH  705
            HE A V SIEKKA S LYISEH
Sbjct  162  HELAAVDSIEKKACSTLYISEH  183



>dbj|BAE06271.1| cyclin A [Scutellaria baicalensis]
Length=496

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 104/157 (66%), Gaps = 7/157 (4%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQR--TGsllssrstfsesssIAPCTSKNVGIKKSSSS  388
            GKVA++A    + KRPAL N+TNQR  TGS  + R+   ESS IAPCT+K V IKK  S+
Sbjct  28   GKVASSASA--SKKRPALANVTNQRHGTGSANAGRAPLPESSKIAPCTTKIVSIKKGPSA  85

Query  389  STGNAGFLGTSIVPTSTLVKPITVPSKGPSAI-GSDAILQKATLPPVTCSMDNSPAKSDG  565
            ST N+GF G +I+PTS+ VK   V     + I  SD +L K    PV+CSMD SP KSD 
Sbjct  86   ST-NSGFPG-AILPTSSSVKQNIVAVGRSTFIPKSDVVLPKTLAAPVSCSMDVSPDKSDS  143

Query  566  MTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            ++ SMDESMS CDSL+SP+VE+++ + +     + R+
Sbjct  144  LSVSMDESMSTCDSLKSPDVEHVDYIDVAAVDSIERK  180



>emb|CDP10969.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 11/148 (7%)
 Frame = +2

Query  215  GKVAAA---ADQRLAHKRPALTNITNQRT-GsllssrstfsesssIAPCTSKNVGIKKSS  382
            GK+ A+   + Q LA KRPAL N+TNQR  G+  ++RST SE S IAPCT+K V IKK +
Sbjct  32   GKMVASGLPSQQHLAKKRPALANVTNQRAQGNFSNNRSTLSEPSKIAPCTAKIVSIKKGA  91

Query  383  -SSSTGNAGFLGTSIVPTSTLVKP-ITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAK  556
             +S+  NAG +  + +P S+ +KP I   SK  SA+ +DAIL  A   PV CSMD SP +
Sbjct  92   PTSNISNAG-ISAATLPASSFMKPNIVACSK--SAL-TDAIL-PAIAGPVPCSMDVSPTQ  146

Query  557  SDGMTASMDESMSPCDSLRSPEVEYINN  640
            S+G++ SMDESMS CDSL SPEVEY++N
Sbjct  147  SEGLSVSMDESMSTCDSLNSPEVEYLDN  174



>ref|XP_009593178.1| PREDICTED: cyclin-A1-4 isoform X2 [Nicotiana tomentosiformis]
Length=483

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 22/159 (14%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  559
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            DG   SMDE+MS  DSLRSP+VEYI++ +   F  + ++
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKK  168



>emb|CAA63542.1| cyclin A-like protein [Nicotiana tabacum]
Length=483

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 22/159 (14%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  559
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            DG   SMDE+MS  DSLRSP+VEYI++ +   F  + ++
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKK  168



>ref|XP_009593177.1| PREDICTED: cyclin-A1-4 isoform X1 [Nicotiana tomentosiformis]
Length=484

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 22/159 (14%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  559
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            DG   SMDE+MS  DSLRSP+VEYI++ +   F  + ++
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKK  168



>dbj|BAA09366.1| A-type cyclin [Nicotiana tabacum]
Length=483

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 22/159 (14%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  559
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            DG   SMDE+MS  DSLRSP+VEYI++ +   F  + ++
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKK  168



>ref|XP_006351136.1| PREDICTED: cyclin-A1-3-like isoform X1 [Solanum tuberosum]
Length=488

 Score = 99.8 bits (247),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 99/149 (66%), Gaps = 20/149 (13%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N+ GK+ A A    A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK+ S
Sbjct  31   NQTGKLNAGA----AKKRPALSNISNHTT---VSARNSISHSSKLAPCTSKIVSIKKNIS  83

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  559
            S        GT+++P S+ V+P    SK  S   SDA++ K T +P P TCSMD SP+ S
Sbjct  84   S--------GTAVLPASSSVRP---SSKPVSIQRSDAVVPKITAIPLPATCSMDISPSHS  132

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMK  646
            DG   SMDESMS  D++RSPEVEYI++++
Sbjct  133  DGSLVSMDESMSTSDTVRSPEVEYIDDLE  161


 Score = 34.3 bits (77),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  643  ETAGVHSIEKKASSALYISEH  705
            E+A V SIEKKA S LYISEH
Sbjct  161  ESAAVDSIEKKACSTLYISEH  181



>ref|XP_006351137.1| PREDICTED: cyclin-A1-3-like isoform X2 [Solanum tuberosum]
Length=487

 Score = 99.8 bits (247),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 99/149 (66%), Gaps = 20/149 (13%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N+ GK+ A A    A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK+ S
Sbjct  31   NQTGKLNAGA----AKKRPALSNISNHTT---VSARNSISHSSKLAPCTSKIVSIKKNIS  83

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  559
            S        GT+++P S+ V+P    SK  S   SDA++ K T +P P TCSMD SP+ S
Sbjct  84   S--------GTAVLPASSSVRP---SSKPVSIQRSDAVVPKITAIPLPATCSMDISPSHS  132

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMK  646
            DG   SMDESMS  D++RSPEVEYI++++
Sbjct  133  DGSLVSMDESMSTSDTVRSPEVEYIDDLE  161


 Score = 34.3 bits (77),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  643  ETAGVHSIEKKASSALYISEH  705
            E+A V SIEKKA S LYISEH
Sbjct  161  ESAAVDSIEKKACSTLYISEH  181



>ref|XP_006351138.1| PREDICTED: cyclin-A1-3-like isoform X3 [Solanum tuberosum]
Length=483

 Score = 99.8 bits (247),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 99/149 (66%), Gaps = 20/149 (13%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N+ GK+ A A    A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK+ S
Sbjct  31   NQTGKLNAGA----AKKRPALSNISNHTT---VSARNSISHSSKLAPCTSKIVSIKKNIS  83

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  559
            S        GT+++P S+ V+P    SK  S   SDA++ K T +P P TCSMD SP+ S
Sbjct  84   S--------GTAVLPASSSVRP---SSKPVSIQRSDAVVPKITAIPLPATCSMDISPSHS  132

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMK  646
            DG   SMDESMS  D++RSPEVEYI++++
Sbjct  133  DGSLVSMDESMSTSDTVRSPEVEYIDDLE  161


 Score = 34.3 bits (77),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  643  ETAGVHSIEKKASSALYISEH  705
            E+A V SIEKKA S LYISEH
Sbjct  161  ESAAVDSIEKKACSTLYISEH  181



>ref|XP_009796391.1| PREDICTED: cyclin-A1-4 [Nicotiana sylvestris]
 emb|CAA63543.1| cyclin A-like protein [Nicotiana tabacum]
Length=482

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 21/162 (13%)
 Frame = +2

Query  203  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS  382
            EN HGK+ A      A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKK++
Sbjct  23   ENNHGKLPAGG----AKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKVVSIKKNN  75

Query  383  SSSTGNAGFLGTSIVPTST-LVKPITVPSKGPSAIGSDAILQKAT-LPPV--TCSMDNSP  550
            S++        +S++PTS+  VKPI   SK  S   SDA + K T +PP+  TCSMD SP
Sbjct  76   SNA-------ASSVLPTSSSFVKPI---SKTVSLPRSDAAVPKITAIPPLPSTCSMDISP  125

Query  551  AKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            + SDG   SMDE+MS  +SLRSP+VEYI++ +   F  + ++
Sbjct  126  SHSDGSLVSMDETMSTSNSLRSPDVEYIDDNQTAAFDSIEKK  167



>ref|XP_007225619.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
 gb|EMJ26818.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
Length=495

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 88/144 (61%), Gaps = 5/144 (3%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV AA +  LA KR  L+N+TN+ + S    RS+   S ++ PCT+K   +KK   + T
Sbjct  31   GKVVAA-EPHLARKRAPLSNLTNRNSVSNNGLRSSGGSSCTLVPCTNKIAKVKKGPPACT  89

Query  395  GNAGFLGTSIVPTSTLVKP--ITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM  568
            GN G   +S+ P S  VKP  + +P   P+    +A+     LP   CSMD SP+KSDG 
Sbjct  90   GNKGVSASSL-PASFNVKPSAVVLPKVTPAPRSDEAVPNSFALPG-PCSMDVSPSKSDGN  147

Query  569  TASMDESMSPCDSLRSPEVEYINN  640
            + SMDE+MS CDS +SPEVEYI+N
Sbjct  148  SVSMDETMSSCDSFKSPEVEYIDN  171



>ref|XP_008219598.1| PREDICTED: cyclin-A1-1-like [Prunus mume]
Length=496

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 88/144 (61%), Gaps = 5/144 (3%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV AA +  LA KR  L+N+TN+ + S    RS+   S ++ PCT+K   +KK   + T
Sbjct  32   GKVVAA-EPHLAKKRAPLSNLTNRNSVSNNGLRSSGGSSCTLVPCTNKIAKVKKGPPACT  90

Query  395  GNAGFLGTSIVPTSTLVKP--ITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM  568
            GN G   +S+ P S  VKP  + +P   P+    +A+     LP   CSMD SP+KSDG 
Sbjct  91   GNKGISASSL-PASFNVKPSAVLLPKVTPAPRSDEAVPSSFALPG-PCSMDVSPSKSDGN  148

Query  569  TASMDESMSPCDSLRSPEVEYINN  640
            + SMDE+MS CDS +SPEVEYI+N
Sbjct  149  SVSMDETMSSCDSFKSPEVEYIDN  172



>ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=495

 Score = 88.2 bits (217),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 82/145 (57%), Gaps = 4/145 (3%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            + HGKV       LA KRP L+NITNQ+  SL   +S+ +  + + PC  K    K+ SS
Sbjct  26   DNHGKVTTVPSH-LAKKRPPLSNITNQKNASLSGLKSSAAVGTMV-PCAEKISKAKRGSS  83

Query  386  SSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  562
              + + G  G +    S  VKP  V P K  S   SD      T  P  CS+D SP +SD
Sbjct  84   KISRSVGITGNT-SSASLNVKPTAVIPCKDTSLPKSDGTASTVTALPDPCSLDVSPNRSD  142

Query  563  GMTASMDESMSPCDSLRSPEVEYIN  637
            G++ASMDE+MS CDS +SPEVEY++
Sbjct  143  GISASMDETMSTCDSFKSPEVEYMD  167


 Score = 28.9 bits (63),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  652  GVHSIEKKASSALYISEHQE  711
             V+SIE+K  S LYISEH E
Sbjct  172  AVNSIERKTCSKLYISEHVE  191



>emb|CBI18982.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 88.2 bits (217),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 82/145 (57%), Gaps = 4/145 (3%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            + HGKV       LA KRP L+NITNQ+  SL   +S+ +  + + PC  K    K+ SS
Sbjct  81   DNHGKVTTVPSH-LAKKRPPLSNITNQKNASLSGLKSSAAVGTMV-PCAEKISKAKRGSS  138

Query  386  SSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  562
              + + G  G +    S  VKP  V P K  S   SD      T  P  CS+D SP +SD
Sbjct  139  KISRSVGITGNT-SSASLNVKPTAVIPCKDTSLPKSDGTASTVTALPDPCSLDVSPNRSD  197

Query  563  GMTASMDESMSPCDSLRSPEVEYIN  637
            G++ASMDE+MS CDS +SPEVEY++
Sbjct  198  GISASMDETMSTCDSFKSPEVEYMD  222


 Score = 28.9 bits (63),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  652  GVHSIEKKASSALYISEHQE  711
             V+SIE+K  S LYISEH E
Sbjct  227  AVNSIERKTCSKLYISEHVE  246



>ref|XP_004290902.1| PREDICTED: cyclin-A1-1 [Fragaria vesca subsp. vesca]
Length=500

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 85/150 (57%), Gaps = 21/150 (14%)
 Frame = +2

Query  233  ADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFL  412
            A+ RLA KR  L+N+TN+         +  +  S++ PC  K   +KK S +ST N G  
Sbjct  34   AEPRLAKKRAPLSNLTNRSN-----VGAGSASKSALVPC--KIAKVKKGSPASTSNRGIS  86

Query  413  GTSIVPTSTLVKPITVPSKGPSAIG-SDAILQKAT-------------LPPVTCSMDNSP  550
            G+++   S  VKP T+     +A+  SD +  K+T             + PV C+MD SP
Sbjct  87   GSNVPAASCSVKPSTIVLPKVTAVQRSDEVFPKSTSVQRSGEAAPISVVIPVPCNMDESP  146

Query  551  AKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            +KSDG + SMDE+MS CDS +SP+VEYI+N
Sbjct  147  SKSDGDSVSMDETMSTCDSFKSPQVEYIDN  176



>gb|EYU32511.1| hypothetical protein MIMGU_mgv1a005475mg [Erythranthe guttata]
Length=482

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 85/143 (59%), Gaps = 19/143 (13%)
 Frame = +2

Query  254  KRPALTNITNQR--TGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  427
            KRPAL+NITNQR  +GSL   R+   ESS I PC++K V IKK SS+ST NA F G ++ 
Sbjct  41   KRPALSNITNQRHASGSLNPGRAHLPESSKIVPCSTKIVSIKKGSSTST-NASFSGPTLP  99

Query  428  PTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCDS  607
            P  +  +    PS+  +             PPV  S    P KSD  + SMDESMS CDS
Sbjct  100  PIVSSKQSTVAPSRAIAP------------PPVNVS----PDKSDSYSVSMDESMSTCDS  143

Query  608  LRSPEVEYINNMKLLEFIPLRRR  676
            L+SP++EY++N +++    + R+
Sbjct  144  LKSPDIEYMDNSEIVAVDYIERK  166



>ref|XP_010095430.1| hypothetical protein L484_013387 [Morus notabilis]
 gb|EXB60122.1| hypothetical protein L484_013387 [Morus notabilis]
Length=495

 Score = 79.3 bits (194),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 81/143 (57%), Gaps = 14/143 (10%)
 Frame = +2

Query  224  AAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPC-TSKNVGIKKS--SSSST  394
            A A    LA KR  L NITN+      ++  T    S++ PC T+K   +KK   + +ST
Sbjct  38   ATAVPPHLAKKRAPLGNITNRSNAVSQNASRTAVPPSTLVPCATTKIAKVKKGPLACTST  97

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-GSDAILQKATLPPVTCSMDNSPAKSDGMT  571
             ++  + T+I+          VPSK  S++  SD  L +    P  CSMD SP+KSD ++
Sbjct  98   NSSLNVKTNII----------VPSKVTSSLPRSDETLPRTVAVPAPCSMDMSPSKSDDVS  147

Query  572  ASMDESMSPCDSLRSPEVEYINN  640
             S+DE+MS CDS +SPEVEY++N
Sbjct  148  VSLDETMSTCDSFKSPEVEYVDN  170


 Score = 28.9 bits (63),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +1

Query  637  QHETAGVHSIEKKASSALYISEHQET  714
             ++   V SI +K  S LYIS+H ET
Sbjct  170  NNDAPAVDSINRKTFSNLYISDHSET  195



>ref|XP_002520329.1| cyclin A, putative [Ricinus communis]
 gb|EEF42115.1| cyclin A, putative [Ricinus communis]
Length=498

 Score = 79.0 bits (193),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 86/149 (58%), Gaps = 10/149 (7%)
 Frame = +2

Query  203  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS  382
            EN  GK  A      A KR  L +ITN +         T   SS++APC++K   +KK +
Sbjct  29   ENAVGKSTALT----ARKRAPLGDITNHK-NVTQKGSRTSIPSSTLAPCSNKIAKVKKGT  83

Query  383  SSSTGNAG--FLGTSIVPTSTLVKPITVPS-KGPSAIGSDAILQKATLPPVTCSMDNSPA  553
             + T N    F G+++ P S  VK   + + K PS   +D  ++  ++ PV CSMD SP+
Sbjct  84   PACTSNTATAFSGSNL-PASLNVKSSAISTCKVPSVPRNDEAVRSISVDPVPCSMDVSPS  142

Query  554  KSDGMTASMDESMSPCDSLRSPEVEYINN  640
            KSD ++ S+DE+MS CDS +SPEVEY++N
Sbjct  143  KSDAISVSLDETMS-CDSFKSPEVEYMDN  170


 Score = 27.3 bits (59),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +1

Query  637  QHETAGVHSIEKKASSALYISEHQET  714
             ++   + SI KK  S LYIS+H +T
Sbjct  170  NNDIPAIDSINKKTLSNLYISDHVQT  195



>ref|XP_007019157.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
 gb|EOY16382.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
Length=493

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 91/148 (61%), Gaps = 19/148 (13%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A+    LA KR  L+NITNQ+  S  S  ++      + PC++K +  +K+   S 
Sbjct  34   GKVTAS----LAKKRVPLSNITNQKNSSRSSVSASS-----LVPCSNKILKARKTQPVS-  83

Query  395  GNAGFLGTSIVPTSTLVKPITV-PSKGPSAI--GSDAILQKATLPPVT---CSMDNSPAK  556
             N GF G  ++P ST V+P +V P K  ++   G++ ++   ++  +    CSM+ SP+K
Sbjct  84   -NVGFSG-HVLP-STNVRPSSVLPPKVVTSFPRGNEVVVPPPSISTIPPPLCSMEFSPSK  140

Query  557  SDGMTASMDESMSPCDSLRSPEVEYINN  640
            SDG++ SMDE+MS CDS +SPEVEY++N
Sbjct  141  SDGVSVSMDETMSTCDSFKSPEVEYMDN  168



>ref|XP_006355258.1| PREDICTED: cyclin-A1-1-like [Solanum tuberosum]
Length=174

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +2

Query  488  SDAILQKATL--PPVTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFI  661
            S+AIL K T    P TCSM  SP+ SD    SMDESMS  D++R+PEVEYI++M  L+ I
Sbjct  15   SEAILPKITAIHVPATCSMVISPSHSDESLVSMDESMSTSDTVRTPEVEYIDDMNWLQLI  74

Query  662  PLRRRHLVRSIFRNTKKQ  715
            P RRR +  S  +N  KQ
Sbjct  75   PSRRRRVAPSTSQNMSKQ  92



>gb|KHG05847.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=489

 Score = 74.7 bits (182),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 84/147 (57%), Gaps = 20/147 (14%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A+    LA KR  LTNITNQ+  S   S +  S         S N   K   + S 
Sbjct  32   GKVMAS----LAKKRVPLTNITNQKQSSSSKSSALASSLV-----PSSNKIQKARKTQSV  82

Query  395  GNAGFLGTSIVPT----STLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  562
             N G  G  + PT    S+++ P  VPS  P+  G++ +L     PPV CSM+ SP+KSD
Sbjct  83   TNVGLSGHVLPPTNERRSSVLPPKVVPSL-PT--GNEVVLLP---PPVQCSMEFSPSKSD  136

Query  563  GMTA-SMDESMSPCDSLRSPEVEYINN  640
            G+++ S+DE+MS CDS +SPEVEYI+N
Sbjct  137  GLSSVSLDETMSTCDSFKSPEVEYIDN  163


 Score = 25.0 bits (53),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 10/24 (42%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +1

Query  637  QHETAGVHSIEKKASSALYISEHQ  708
             H+ + + SIE+K  S L IS+H 
Sbjct  163  NHDVSAIGSIERKTFSNLCISDHD  186



>ref|XP_008352624.1| PREDICTED: cyclin-A1-1-like [Malus domestica]
Length=479

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 80/150 (53%), Gaps = 18/150 (12%)
 Frame = +2

Query  224  AAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNA  403
            A AA+  L  KR  L+N+TN+ +      RS+   S ++ P T+K   +K+   + TGN 
Sbjct  32   AVAAEPHLGKKRAPLSNLTNRNSVPNNGLRSSGGSSCALVPSTNKIAKVKRGPPACTGNK  91

Query  404  GFLGTSIVPTSTLVKP--------ITVPSK---GPSAIGSDAILQKATLPPVTCSMDNSP  550
            G +  S  P    VKP         + P +    PS + S   +      P  CSMD SP
Sbjct  92   G-VSASNPPXPFCVKPNXPVLPKVTSCPRREEAAPSNVPSTFAI------PAPCSMDVSP  144

Query  551  AKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            +KSDG + SMDE+MS CDS +SP++EYI+N
Sbjct  145  SKSDGNSVSMDETMSTCDSFKSPDIEYIDN  174



>ref|XP_006472826.1| PREDICTED: cyclin-A1-1-like [Citrus sinensis]
Length=503

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 81/140 (58%), Gaps = 10/140 (7%)
 Frame = +2

Query  245  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSI  424
            LA KR  L+N+TNQ+  +   S+S  S S+ + PC++K    KK+  ++  N    G + 
Sbjct  39   LAKKRAPLSNVTNQKNVTQSGSKSLLSSSALV-PCSTKLAKAKKAPEANNANTSISG-NF  96

Query  425  VPTSTLVKPIT---VPSKGPSAIGSDAILQK-----ATLPPVTCSMDNSPAKSDGMTASM  580
            +P S+  K  T   VP K  S   SD  ++      A    V+CSMD SP+KSD  + SM
Sbjct  97   LPASSNGKTSTTVPVPCKVTSLPRSDENVKTSAPSIAAAVSVSCSMDVSPSKSDANSVSM  156

Query  581  DESMSPCDSLRSPEVEYINN  640
            DESMS CDS +SPEVEY++N
Sbjct  157  DESMSVCDSFKSPEVEYLDN  176



>ref|XP_006386358.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
 gb|ERP64155.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
Length=499

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 81/145 (56%), Gaps = 10/145 (7%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK  A A   LA KR  L +ITNQ+  +   SR++   S+ +AP ++K   +KK   +S 
Sbjct  32   GKATAVAPH-LAKKRAPLGDITNQKNATQKGSRNSIPSST-LAPFSNKIAKVKKGPPASN  89

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGS----DAILQKATLPPVTCSMDNSPAKSD  562
             +AGF G ++ P S   K  T    G   + S    D  +  AT   V C MD SP+KSD
Sbjct  90   SSAGFYGKTL-PASLNAKSST---GGACKVISNPRRDENVTIATAVSVPCCMDVSPSKSD  145

Query  563  GMTASMDESMSPCDSLRSPEVEYIN  637
              + S+DESMS CDS +SPE+EYI+
Sbjct  146  DFSISLDESMSTCDSFKSPEIEYID  170



>ref|XP_011003420.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=493

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 90/164 (55%), Gaps = 24/164 (15%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK  A A   LA KR  L +ITNQ+         T   SS++AP ++K   +KK + +S 
Sbjct  32   GKATAVAPH-LAKKRAPLGDITNQK-NVTQKGSRTLIPSSTLAPFSNKFAKVKKGTPAS-  88

Query  395  GNAGFLGTSIVPTSTLV---KPITVPSKGPSAIGSDAILQKATLPPVT-----CSMDNSP  550
             N+  L  S+   S+ V   K I+V ++G S            +PPV      CS+D SP
Sbjct  89   -NSSTLPASLNAKSSAVGVCKVISVSTRGES------------VPPVAAVSVPCSIDVSP  135

Query  551  AKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
            +KSD ++ S+DESMS CDS +SPEVEYI+N +++    + ++ L
Sbjct  136  SKSDDLSISLDESMSTCDSFKSPEVEYIDNNEIIAIDSINKKTL  179



>gb|KJB59298.1| hypothetical protein B456_009G248300 [Gossypium raimondii]
Length=489

 Score = 72.0 bits (175),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 83/147 (56%), Gaps = 20/147 (14%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            G+V A+    LA KR  LTNITNQ+  S   S +  S         S N   K   + S 
Sbjct  32   GRVIAS----LAKKRVPLTNITNQKQSSSSKSSALASSLVQ-----SSNKIQKARKTQSV  82

Query  395  GNAGFLGTSIVPT----STLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  562
             N G  G  + P     S+++ P  VPS  P+  G++ +L     PPV CSM+ SP+KSD
Sbjct  83   TNVGLSGHVLPPINERRSSVLPPKVVPSL-PT--GNEVVLPP---PPVQCSMEFSPSKSD  136

Query  563  GMTA-SMDESMSPCDSLRSPEVEYINN  640
            G+++ S+DE+MS CDS +SPEVEYI+N
Sbjct  137  GLSSVSLDETMSTCDSFKSPEVEYIDN  163


 Score = 25.0 bits (53),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  637  QHETAGVHSIEKKASSALYISEH  705
             H+ + + SIE+K  S L IS+H
Sbjct  163  NHDVSAIGSIERKTFSNLCISDH  185



>ref|XP_009343979.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=498

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 80/154 (52%), Gaps = 18/154 (12%)
 Frame = +2

Query  212  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  391
            +G  A AA+  L  KR  L+N+TN+ +      RS+     ++ P T+K   +K+   + 
Sbjct  29   NGGKAVAAEPHLGKKRAPLSNLTNRNSVPNNGLRSSGGSLCALVPSTNKIAKVKRGPPAC  88

Query  392  TGNAGFLGTSIVPTSTLVKP--------ITVPSK---GPSAIGSDAILQKATLPPVTCSM  538
             GN G +  S  P    VKP         + P +    PS + S   +      P  CSM
Sbjct  89   IGNKG-VSASNPPAPFCVKPNLPVLPKVTSCPRRDEAAPSNVPSTFAI------PGPCSM  141

Query  539  DNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            D SP+KSDG + SMDE+MS CDS +SP++EY++N
Sbjct  142  DVSPSKSDGNSVSMDETMSTCDSFKSPDIEYVDN  175



>ref|XP_011027470.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027471.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 81/145 (56%), Gaps = 10/145 (7%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK  A A   LA KR  L +ITNQ+  +   SR++   S+ +AP ++K   +KK   +S 
Sbjct  32   GKATAVA-THLAKKRAPLGDITNQKNATQKGSRNSIPSST-LAPFSNKIAKVKKGPPASN  89

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGS----DAILQKATLPPVTCSMDNSPAKSD  562
             +AGF G ++ P S   K  T    G   + S    D  +  AT   + C MD SP+KSD
Sbjct  90   SSAGFSGKTL-PASLNAKSST---GGACKVISNPRRDENVSIATAVSIPCCMDVSPSKSD  145

Query  563  GMTASMDESMSPCDSLRSPEVEYIN  637
              + S+DESMS CDS +SPE+EYI+
Sbjct  146  DFSISLDESMSTCDSFKSPEIEYID  170



>ref|XP_011027473.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027474.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 81/145 (56%), Gaps = 10/145 (7%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK  A A   LA KR  L +ITNQ+  +   SR++   S+ +AP ++K   +KK   +S 
Sbjct  32   GKATAYA-THLAKKRAPLGDITNQKNATQKGSRNSIPSST-LAPFSNKIAKVKKGPPASN  89

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGS----DAILQKATLPPVTCSMDNSPAKSD  562
             +AGF G ++ P S   K  T    G   + S    D  +  AT   + C MD SP+KSD
Sbjct  90   SSAGFSGKTL-PASLNAKSST---GGACKVISNPRRDENVSIATAVSIPCCMDVSPSKSD  145

Query  563  GMTASMDESMSPCDSLRSPEVEYIN  637
              + S+DESMS CDS +SPE+EYI+
Sbjct  146  DFSISLDESMSTCDSFKSPEIEYID  170



>gb|KHG23907.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=493

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 95/173 (55%), Gaps = 29/173 (17%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A+    +  KR  L+NI+NQ+      +  +   +SS+ PC++K V   + +    
Sbjct  32   GKVMAS----MPKKRVPLSNISNQKN-----TSRSSVSASSLVPCSNK-VPKTRKTMPDN  81

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAILQK-----ATLPPVTCSMDN  544
             N GF G  ++P ST V+P +VP   P  +     G++  L       +T+PP   +M+ 
Sbjct  82   NNVGFSG-HVLP-STHVQPGSVPP--PKVVTSFPRGNEVALPPPPATISTIPPPPSTMEV  137

Query  545  SPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHLVRSIFRN  703
            SP+KSDG++ SMDE+MS CDS +SPEVEY++N  +     + R+      FRN
Sbjct  138  SPSKSDGLSVSMDETMSTCDSFKSPEVEYMDNHDVTAVDSIERK-----TFRN  185



>gb|KDP32823.1| hypothetical protein JCGZ_12115 [Jatropha curcas]
Length=494

 Score = 67.8 bits (164),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 6/136 (4%)
 Frame = +2

Query  233  ADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFL  412
            A   +A KR  L +ITN +         T   SS++APC++K   +KK   + T N GF 
Sbjct  38   ATTHIARKRAPLGDITNHK-NVPQKGSRTSIPSSTLAPCSNKIAKVKKGPPACTSNTGFS  96

Query  413  GTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESM  592
             +++ P ++    I    K  S   SD  +    + P  C+MD SP+KS     S+DE+M
Sbjct  97   ASNLAPLNSKSSAIGA-CKVTSVPRSDQAVPSIVVDPAPCNMDVSPSKS----ISLDETM  151

Query  593  SPCDSLRSPEVEYINN  640
            S CDS +SPEVEY+++
Sbjct  152  STCDSFKSPEVEYLDH  167


 Score = 26.9 bits (58),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +1

Query  640  HETAGVHSIEKKASSALYISEHQET  714
            ++   + SI KK  S LYIS+H +T
Sbjct  168  NDIPAIDSINKKTLSNLYISDHVQT  192



>ref|XP_010260855.1| PREDICTED: cyclin-A1-4 [Nelumbo nucifera]
Length=497

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 86/159 (54%), Gaps = 13/159 (8%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
             KV A   Q+ A KRPAL+N+TNQ T    +         +  P  SK V +KK S+   
Sbjct  29   SKVPAILAQQ-AKKRPALSNLTNQ-THLSRNPVRNSGTVGNQVPSESKTVKLKKGSTYVR  86

Query  395  GNAGFLGTSIVPTSTLVKPIT-VPSKGPSA----IGSDAILQKATLPPVTCSMDNSPAKS  559
              +  L  S V  ST VK  T V SK  S     I + ++L  AT+ P  C+   SP++S
Sbjct  87   PTS--LPRSSVSASTAVKSATAVSSKDASVTKIDIPTSSVL--ATIAP--CNAHISPSRS  140

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            DG +AS+DE+MS CDSL+SP++EYI+N        + RR
Sbjct  141  DGDSASLDETMSTCDSLKSPDIEYIDNADASAVASIERR  179



>ref|XP_004149427.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
 gb|KGN47698.1| hypothetical protein Csa_6G382370 [Cucumis sativus]
Length=506

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 79/142 (56%), Gaps = 8/142 (6%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A     LA KR  L N+TN +     S+  +      + PC +K V  +KSS + T
Sbjct  33   GKVMAVPPH-LAKKRAPLGNLTNFK-NVSHSAAKSSGPPPVMVPCATKAVKARKSSPART  90

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTA  574
             +    GT+   T+T++   T  +  PS + +     +  +  V+  MD SP+KSDG++ 
Sbjct  91   RSTNLPGTN---TTTMLDVKTTNAVAPSNVTA---FSRTDVTAVSSCMDVSPSKSDGVSV  144

Query  575  SMDESMSPCDSLRSPEVEYINN  640
            S+DE++S CDS +SP+VEY++N
Sbjct  145  SLDETISTCDSFKSPDVEYLDN  166



>gb|KJB64519.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
 gb|KJB64521.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
Length=384

 Score = 66.2 bits (160),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 75/147 (51%), Gaps = 17/147 (12%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N+  K+ AA  Q  + KR AL++ITNQR G    SR+  + S  + PCTSK    K++S+
Sbjct  25   NQSKKMGAAKTQ-FSKKRVALSDITNQRNGFPSGSRAMVTHSKPMVPCTSKVAKKKETST  83

Query  386  SST--GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKS  559
              T      F G S + T      I      P+         K +  P+  SMD SP +S
Sbjct  84   LPTTPSLESFDGVSCINT------ICTRDDHPTT--------KVSALPLPSSMDISPCRS  129

Query  560  DGMTASMDESMSPCDSLRSPEVEYINN  640
               + S+DE+MS CDSL SP+ EY+ N
Sbjct  130  PCASVSLDETMSTCDSLESPKFEYLEN  156


 Score = 24.3 bits (51),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  643  ETAGVHSIEKKASSALYISE  702
            + + + SIE KA+  LYISE
Sbjct  158  DVSAIESIETKANDNLYISE  177



>gb|KJB64518.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
 gb|KJB64520.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
Length=482

 Score = 66.2 bits (160),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 75/147 (51%), Gaps = 17/147 (12%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N+  K+ AA  Q  + KR AL++ITNQR G    SR+  + S  + PCTSK    K++S+
Sbjct  25   NQSKKMGAAKTQ-FSKKRVALSDITNQRNGFPSGSRAMVTHSKPMVPCTSKVAKKKETST  83

Query  386  SST--GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKS  559
              T      F G S + T      I      P+         K +  P+  SMD SP +S
Sbjct  84   LPTTPSLESFDGVSCINT------ICTRDDHPTT--------KVSALPLPSSMDISPCRS  129

Query  560  DGMTASMDESMSPCDSLRSPEVEYINN  640
               + S+DE+MS CDSL SP+ EY+ N
Sbjct  130  PCASVSLDETMSTCDSLESPKFEYLEN  156


 Score = 24.3 bits (51),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  643  ETAGVHSIEKKASSALYISE  702
            + + + SIE KA+  LYISE
Sbjct  158  DVSAIESIETKANDNLYISE  177



>ref|XP_007019158.1| Cyclin A1,1 isoform 2, partial [Theobroma cacao]
 gb|EOY16383.1| Cyclin A1,1 isoform 2, partial [Theobroma cacao]
Length=389

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 10/107 (9%)
 Frame = +2

Query  338  IAPCTSKNVGIKKSSSSSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAI--GSDAILQK  508
            + PC++K +  +K+   S  N GF G  ++P ST V+P +V P K  ++   G++ ++  
Sbjct  7    LVPCSNKILKARKTQPVS--NVGFSG-HVLP-STNVRPSSVLPPKVVTSFPRGNEVVVPP  62

Query  509  ATLPPVT---CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
             ++  +    CSM+ SP+KSDG++ SMDE+MS CDS +SPEVEY++N
Sbjct  63   PSISTIPPPLCSMEFSPSKSDGVSVSMDETMSTCDSFKSPEVEYMDN  109



>ref|XP_002306649.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93645.1| cyclin family protein [Populus trichocarpa]
Length=493

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 88/165 (53%), Gaps = 26/165 (16%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK  A A   LA KR  L +ITNQ+         T   SS++AP ++K   +KK   +S 
Sbjct  32   GKATAVAPH-LAKKRAPLGDITNQK-NVTQKGSRTLIPSSTLAPFSNKFAKVKKGPPASN  89

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT----LPPVT-----CSMDNS  547
                        +STL  P  + +K  SA+G   ++  +T    +PPV      CS D S
Sbjct  90   ------------SSTL--PAFLNAKS-SAVGVCKVISISTRDESVPPVAAVSVPCSNDVS  134

Query  548  PAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
            P+KSD ++ S+DESMS CDS +SPEVEYI+N +++    + ++ L
Sbjct  135  PSKSDDLSISLDESMSTCDSFKSPEVEYIDNNEIIAIDSINKKTL  179



>ref|XP_006434257.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
 gb|ESR47497.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
Length=489

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 20/158 (13%)
 Frame = +2

Query  212  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  391
            H K  A    +LA KRPAL+++TNQR GS   SR   ++S  I PC++K +  KK SS+ 
Sbjct  27   HVKKIAIMKPQLAKKRPALSDMTNQRDGSQAVSRVVGTQSKPIVPCSAK-IAKKKESSAH  85

Query  392  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM-  568
            + + G  G ++ P S  VK I V +K   +  SD  + +A +P  + ++ + PA S  + 
Sbjct  86   SHDKGLSGNTL-PASLSVK-IGVIAKDAFSTRSDHPIIRA-IPAPSSNISSLPASSSAIM  142

Query  569  ---------------TASMDESMSPCDSLRSPEVEYIN  637
                           + S+DE+MS CDSL+SPE  YI+
Sbjct  143  VPRCKNISLSTSVSGSVSLDETMSTCDSLKSPEFVYID  180



>ref|XP_006472825.1| PREDICTED: cyclin-A1-1-like isoform X2 [Citrus sinensis]
Length=511

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 87/157 (55%), Gaps = 18/157 (11%)
 Frame = +2

Query  212  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  391
            H K  A    +LA KRPAL+++TNQR GS   SR   ++S  I PC++K +  KK SS+ 
Sbjct  27   HVKKIAIMKPQLAKKRPALSDMTNQRDGSQAVSRVVGTQSKPIVPCSAK-IAKKKESSAH  85

Query  392  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKA---------TLPPVTCSM--  538
            + + G  G ++ P S  VK I V +K   +  SD  + +A         +LP  + ++  
Sbjct  86   SHDKGLSGNTL-PASLSVK-IGVIAKDAFSTRSDHPIIRAIPAPSSNISSLPASSSAIMV  143

Query  539  ----DNSPAKSDGMTASMDESMSPCDSLRSPEVEYIN  637
                + SP+ S   + S+DE+MS CDSL+SPE  YI+
Sbjct  144  PRCKNISPSTSVSGSVSLDETMSTCDSLKSPEFVYID  180



>ref|XP_006472824.1| PREDICTED: cyclin-A1-1-like isoform X1 [Citrus sinensis]
Length=516

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 87/157 (55%), Gaps = 18/157 (11%)
 Frame = +2

Query  212  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  391
            H K  A    +LA KRPAL+++TNQR GS   SR   ++S  I PC++K +  KK SS+ 
Sbjct  27   HVKKIAIMKPQLAKKRPALSDMTNQRDGSQAVSRVVGTQSKPIVPCSAK-IAKKKESSAH  85

Query  392  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKA---------TLPPVTCSM--  538
            + + G  G ++ P S  VK I V +K   +  SD  + +A         +LP  + ++  
Sbjct  86   SHDKGLSGNTL-PASLSVK-IGVIAKDAFSTRSDHPIIRAIPAPSSNISSLPASSSAIMV  143

Query  539  ----DNSPAKSDGMTASMDESMSPCDSLRSPEVEYIN  637
                + SP+ S   + S+DE+MS CDSL+SPE  YI+
Sbjct  144  PRCKNISPSTSVSGSVSLDETMSTCDSLKSPEFVYID  180



>ref|XP_010532200.1| PREDICTED: cyclin-A1-1-like isoform X1 [Tarenaya hassleriana]
Length=503

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 88/163 (54%), Gaps = 20/163 (12%)
 Frame = +2

Query  221  VAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS---  391
            +AA A  RL  KR  L NITNQ+ GS + + S+ S     A C++K+  IK + + +   
Sbjct  36   LAAPAAPRLTKKRAPLGNITNQKNGSRIPNSSSTS-----AHCSNKSAKIKVAPTQTACL  90

Query  392  ---TGNAGFLGTSIVPTSTLV--KPITVPSKGPSAIGSDAILQKATLPPVTCSMD-NSPA  553
               + + G     IV TS++V  K  ++P +  +A  +  I       P  C  + +SP 
Sbjct  91   YTDSASTGLRAQPIVQTSSVVPGKDTSLPCRDENASATAVIF------PNQCENEASSPI  144

Query  554  KSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
            + + ++ SMDESMS CDS +SP+VEYI+N ++     + R+ L
Sbjct  145  QFEDVSVSMDESMSTCDSFKSPQVEYIDNGEVSAVESIERKAL  187



>ref|XP_010532201.1| PREDICTED: cyclin-A1-1-like isoform X2 [Tarenaya hassleriana]
Length=501

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 88/163 (54%), Gaps = 20/163 (12%)
 Frame = +2

Query  221  VAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS---  391
            +AA A  RL  KR  L NITNQ+ GS + + S+ S     A C++K+  IK + + +   
Sbjct  36   LAAPAAPRLTKKRAPLGNITNQKNGSRIPNSSSTS-----AHCSNKSAKIKVAPTQTACL  90

Query  392  ---TGNAGFLGTSIVPTSTLV--KPITVPSKGPSAIGSDAILQKATLPPVTCSMD-NSPA  553
               + + G     IV TS++V  K  ++P +  +A  +  I       P  C  + +SP 
Sbjct  91   YTDSASTGLRAQPIVQTSSVVPGKDTSLPCRDENASATAVIF------PNQCENEASSPI  144

Query  554  KSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
            + + ++ SMDESMS CDS +SP+VEYI+N ++     + R+ L
Sbjct  145  QFEDVSVSMDESMSTCDSFKSPQVEYIDNGEVSAVESIERKAL  187



>ref|XP_004160710.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
Length=506

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 78/142 (55%), Gaps = 8/142 (6%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A     LA KR  L N+TN +     S+  +      + PC +K V  +KSS + T
Sbjct  33   GKVMAVPPH-LAKKRAPLGNLTNFK-NVSHSAAKSSGPPPVMVPCATKAVKARKSSPART  90

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTA  574
             +     T+   T+T++   T  +  PS + +     +  +  V+  MD SP+KSDG++ 
Sbjct  91   RSTNLPVTN---TTTMLDVKTTNAVAPSNVTA---FSRTDVTAVSSCMDVSPSKSDGVSV  144

Query  575  SMDESMSPCDSLRSPEVEYINN  640
            S+DE++S CDS +SP+VEY++N
Sbjct  145  SLDETISTCDSFKSPDVEYLDN  166



>ref|XP_006434258.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
 gb|ESR47498.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
Length=503

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 79/144 (55%), Gaps = 18/144 (13%)
 Frame = +2

Query  245  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSK------NVGIKKSSSSSTGNAG  406
            LA KR  L+N+TNQ+     S   +   SS + PC++K            +++S +GN  
Sbjct  39   LAKKRAPLSNVTNQK-NVTQSGSKSLLSSSVLVPCSTKLAKAKKAPAANNANTSISGN--  95

Query  407  FL-GTSIVPTSTLVKPITVPSKGPSAIGSDAILQK-----ATLPPVTCSMDNSPAKSDGM  568
            FL  +S   TST V    VP K  S   SD  ++      A    V+CSMD SP+KSD  
Sbjct  96   FLPASSNGKTSTTVP---VPCKVTSLPRSDENVKTSAPSIAAAVSVSCSMDVSPSKSDAN  152

Query  569  TASMDESMSPCDSLRSPEVEYINN  640
            + SMDESMS CDS +SPEVEY++N
Sbjct  153  SVSMDESMSVCDSFKSPEVEYLDN  176



>ref|XP_010664179.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=424

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 74/159 (47%), Gaps = 37/159 (23%)
 Frame = +2

Query  212  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  391
            HGK     D   A KRP L N+TN+R G  + + +       +APCT+K   IKK S + 
Sbjct  5    HGK-----DVMAAKKRPPLRNVTNERKGPQIGASNA------MAPCTAKTFKIKKRSLTC  53

Query  392  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLP----------------P  523
                  L  +  P S  VK        P+    D    K+  P                P
Sbjct  54   IRGTT-LSQNTFPASLNVK------SSPAVSCEDTCFPKSDQPVGSLSASSSMVSVLSAP  106

Query  524  VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
             T  M  SP++SDG + S+DE+MS CDSL+SPE EYINN
Sbjct  107  RT--MGVSPSQSDG-SVSLDETMSTCDSLKSPEFEYINN  142



>ref|XP_003526649.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=480

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 24/141 (17%)
 Frame = +2

Query  245  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS-SSTGNAGFLGTS  421
            +A KRP L+N+TN               SSS+ PC +K    KK    + +GN      +
Sbjct  38   MAKKRPPLSNLTN---------TVAHRNSSSLVPCAAKFAKTKKEVVPACSGNKRPTLAN  88

Query  422  IVPTSTLVKP----ITVPSKGPSAIGSDAILQKATLP-PVTCSMDNSPAKSDGMTASMDE  586
            + PTS  + P      V  + P  + +       T+P PV   +D SP+KSD M+ SMDE
Sbjct  89   VKPTSAAIFPKANSFPVRDEAPPPVAT------VTVPAPV---VDVSPSKSDAMSVSMDE  139

Query  587  SMSPCDSLRSPEVEYINNMKL  649
            SMS CDS +SP++EY++N+ +
Sbjct  140  SMSSCDSFKSPDIEYVDNIDV  160



>ref|XP_008466750.1| PREDICTED: cyclin-A1-1 [Cucumis melo]
Length=507

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 8/142 (6%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A     LA KR  L N+TN +     S+  +      + PC +K +  +KSS + T
Sbjct  33   GKVLAVPPH-LAKKRAPLGNLTNFK-NVSHSAAKSSGPPPIMVPCATKALKARKSSPART  90

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTA  574
             +        +P +     + V +  P A  +     +     V+  MD SP+KSDG++ 
Sbjct  91   RSTN------MPVTNTTTMLDVKTTNPVAPSNVTAFSRTDATAVSSCMDVSPSKSDGVSV  144

Query  575  SMDESMSPCDSLRSPEVEYINN  640
            S+DE+MS CDS +SP+VEY++N
Sbjct  145  SLDETMSTCDSFKSPDVEYMDN  166



>ref|XP_009341345.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341346.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341352.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341353.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
Length=521

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 87/179 (49%), Gaps = 31/179 (17%)
 Frame = +2

Query  230  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGF  409
            AA  +++ KR AL ++TNQR GS +   S+ S    + PC ++   +   +SS T   G 
Sbjct  43   AAKTQVSKKRTALADVTNQRNGSQIVPPSSASSKPMV-PCQTEVAKMATKASSCTSKTGI  101

Query  410  LGTSIVPTSTLVKP-ITVPSKGPSAIGSDAILQ-----------KATLPPVTC------S  535
             G+     S   KP I VP  G S  G+D  ++              LP  +C      S
Sbjct  102  SGSD---ESLSSKPSILVPFSGTSVAGTDPTIKVIGTDPSPSSSGTFLPAPSCINHAFRS  158

Query  536  MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHLVRSIFRNTKK  712
             D SP++S   + S++ESMS CDSL+SPE EYI+   + E         V+SI + T K
Sbjct  159  RDVSPSRSVSASVSLNESMSTCDSLKSPEFEYIDTEDVSE---------VKSIGKKTTK  208



>ref|XP_008338670.1| PREDICTED: cyclin-A1-4 [Malus domestica]
Length=522

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 74/163 (45%), Gaps = 27/163 (17%)
 Frame = +2

Query  230  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSK---------NVGIKKSS  382
            AA  ++  KR AL ++TNQR     S   T + S  + PCT+K              K  
Sbjct  33   AAKTQVLKKRTALADVTNQR-NRCQSVPPTLASSKPMVPCTNKIAKTIANKTTAKTTKEV  91

Query  383  SSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKA-----------TLPPVT  529
            SS T N G  G     + +    I VP    S  G+D  ++              LP ++
Sbjct  92   SSCTSNTGLSGNVFQASLSAKSNILVPFSDTSFSGTDPAIKVXCTDPSPSSSGTVLPALS  151

Query  530  C------SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            C      S D SP++S   + S+DESMS CDSL SPE EYI+N
Sbjct  152  CINHAFRSWDASPSRSVSASVSLDESMSTCDSLNSPEFEYIDN  194



>ref|XP_006393746.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
 gb|ESQ31032.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
Length=481

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 78/157 (50%), Gaps = 31/157 (20%)
 Frame = +2

Query  221  VAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS---  391
            +   AD RL  KR  L NITNQ+ GS +             P +S ++  K   + +   
Sbjct  40   ITVMADPRLTKKRAPLGNITNQKNGSRI-------------PNSSSDLSAKLKLAPTQPV  86

Query  392  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMT  571
              N+G L ++++P    VKP    S  P+ + S     KA           SP+KSD  +
Sbjct  87   CVNSG-LSSNVLPLQQSVKP----SVAPTKVTSFPYEHKAA----------SPSKSDDES  131

Query  572  ASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
             SMDE++S CDS +SP+VEYI+N ++   + + R+ L
Sbjct  132  VSMDETVSTCDSYKSPQVEYIDNEEISAVVSIERKAL  168



>ref|XP_004292715.1| PREDICTED: cyclin-A1-4-like [Fragaria vesca subsp. vesca]
Length=506

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 87/171 (51%), Gaps = 21/171 (12%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
             K A AA  ++A KR AL ++TNQR GS     S+ S    + PCT+K V  KK +S+S 
Sbjct  23   NKKAMAAKPQVAKKRTALCDVTNQRNGSQTGPWSSASSLKPMVPCTTKVVKTKKETSTSI  82

Query  395  GNAGFLGT----SIVPTSTLVKPITVPSKGPSAIGSDAIL------QKATLPPVTCSM--  538
             N G  G     S+   S+++ P +  S   S    + I        + T+ P + S+  
Sbjct  83   SNHGLSGNVFPESLNSKSSVLVPYSDTSVSRSVESIETIATNHSPSSRGTVFPASSSIIQ  142

Query  539  -----DNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
                 D SP++S     S+DESMS  +S++SPE EYI++  + E   + ++
Sbjct  143  ALRSKDVSPSRS----VSLDESMSTSNSVKSPEFEYIDSEDISEVKSIEKK  189



>ref|XP_008219599.1| PREDICTED: cyclin-A1-4-like [Prunus mume]
Length=514

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 82/178 (46%), Gaps = 26/178 (15%)
 Frame = +2

Query  230  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGF  409
            A   ++A+KR AL ++TNQR GS     +  + S  + PC +K     K  S+ + N   
Sbjct  33   ATRAQVANKRTALADVTNQRNGSQGGPPTFIASSKPLVPCATKLAKTTKELSTCSSNTDL  92

Query  410  LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ----------KATLPPVTCSM-------  538
             G    P+ +    I VP    S  G +   +            T+ P   S+       
Sbjct  93   SGNVFPPSLSAKSSIVVPFSDTSFSGRNTTTEIVATNPSPSSSVTVLPAPSSIVHTFRSR  152

Query  539  DNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHLVRSIFRNTKK  712
            D SP +S   + S+DE+MS C+SL+SPE EYI+N ++ E         V+SI + T K
Sbjct  153  DGSPRRSVSGSVSLDENMSTCESLKSPEFEYIDNEEISE---------VKSIEKKTTK  201



>dbj|BAC56853.1| cyclin A1 [Silene latifolia]
Length=487

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 75/159 (47%), Gaps = 28/159 (18%)
 Frame = +2

Query  242  RLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTS  421
            +L  KRP L+N+TN                S +    +K+   K+ SS+   +  F   +
Sbjct  29   KLTKKRPPLSNLTNH------------PRPSLVPSAITKSTKAKRDSSTGVRSTSFPAEN  76

Query  422  IVPTSTL-VKP-ITVPSKGPSAIGSDAILQKATLP------------PVTCSMDNSPAKS  559
              P++TL  KP   VP K      +  +  KA+LP            P +C+MD +P   
Sbjct  77   --PSATLNSKPSAVVPLKTAFTRSNVLVSCKASLPNGKGEQSHITRHPASCTMDTTPTPE  134

Query  560  DGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            D  + SMDESMS CDSL+SPEVEY++   +     + R+
Sbjct  135  DAQSVSMDESMSTCDSLKSPEVEYMDENDVAALCSIERK  173



>ref|NP_001241939.1| uncharacterized protein LOC100776207 [Glycine max]
 gb|ACU22685.1| unknown [Glycine max]
Length=503

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 74/146 (51%), Gaps = 9/146 (6%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK    + Q LA KR  L N+TNQR     SS S+  + S+    T K    + S S ST
Sbjct  36   GKAKVVSTQNLAVKRAPLANLTNQRNAPYSSSSSSLVQGSNKVAKTKKEAPARTSVSKST  95

Query  395  --GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLP-PVTCSMDNSPAKSDG  565
              GN      S+  +S     + +P     +   DA    AT   PV   +D SP+KSDG
Sbjct  96   ISGNKSSQLKSVNSSS-----VVIPKANSLSQKKDAAPTVATFAVPVRSGIDVSPSKSDG  150

Query  566  MTASMDESMSPCDSLRSP-EVEYINN  640
               SMDE+ S CDS++SP EVEY++N
Sbjct  151  RFVSMDETTSSCDSIKSPDEVEYLDN  176



>gb|KHN05188.1| Cyclin-A1-1 [Glycine soja]
Length=503

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 74/146 (51%), Gaps = 9/146 (6%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK    + Q LA KR  L N+TNQR     SS S+  + S+    T K    + S S ST
Sbjct  36   GKAKVVSTQNLAVKRAPLANLTNQRNAPYSSSSSSLVQGSNKVAKTKKEAPARTSVSKST  95

Query  395  --GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLP-PVTCSMDNSPAKSDG  565
              GN      S+  +S     + +P     +   DA    AT   PV   +D SP+KSDG
Sbjct  96   ISGNKSSQLKSVNSSS-----VVIPKANSLSQKKDAAPTVATFAVPVRSGIDVSPSKSDG  150

Query  566  MTASMDESMSPCDSLRSP-EVEYINN  640
               SMDE+ S CDS++SP EVEY++N
Sbjct  151  RFVSMDETTSSCDSIKSPDEVEYLDN  176



>gb|KJB80669.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=493

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 89/173 (51%), Gaps = 29/173 (17%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A+    +  KR  L+NI+NQ+  S  S  ++         C++K V   + +    
Sbjct  32   GKVMAS----MPKKRVPLSNISNQKNTSRSSVSASSLVL-----CSNK-VPKTRKTMPDN  81

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAIL-----QKATLPPVTCSMDN  544
             N GF G  ++P  T V+P +VP   P  +     G++  L       +T+PP    M+ 
Sbjct  82   NNVGFSG-HVLPL-THVEPGSVPP--PKVVLSFPRGNEVALPPPPATISTIPPPPSIMEV  137

Query  545  SPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHLVRSIFRN  703
            SP+KSDG++ S DE+MS CDS +SPEVEY++N  +     + R+      FRN
Sbjct  138  SPSKSDGLSVSTDETMSTCDSFKSPEVEYMDNHDVTAVDSIERK-----TFRN  185



>gb|KJB80671.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=411

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 89/173 (51%), Gaps = 29/173 (17%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GKV A+    +  KR  L+NI+NQ+  S  S  ++         C++K V   + +    
Sbjct  32   GKVMAS----MPKKRVPLSNISNQKNTSRSSVSASSLVL-----CSNK-VPKTRKTMPDN  81

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAIL-----QKATLPPVTCSMDN  544
             N GF G  ++P  T V+P +VP   P  +     G++  L       +T+PP    M+ 
Sbjct  82   NNVGFSG-HVLPL-THVEPGSVPP--PKVVLSFPRGNEVALPPPPATISTIPPPPSIMEV  137

Query  545  SPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHLVRSIFRN  703
            SP+KSDG++ S DE+MS CDS +SPEVEY++N  +     + R+      FRN
Sbjct  138  SPSKSDGLSVSTDETMSTCDSFKSPEVEYMDNHDVTAVDSIERK-----TFRN  185



>ref|XP_009343978.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=515

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 74/156 (47%), Gaps = 20/156 (13%)
 Frame = +2

Query  230  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCT---SKNVGIK------KSS  382
            AA  ++  KR AL ++TNQR     S   T + S  + PCT   +K +  K      K  
Sbjct  33   AAKTQVPKKRTALADVTNQR-NRCQSVPPTLASSKPMVPCTNTIAKTIANKTTAKMTKEV  91

Query  383  SSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ----------KATLPPVTC  532
            SS T N G  G     + +    I VP    S  G+D  ++            T+     
Sbjct  92   SSCTNNTGLSGNVFQASLSAKSNILVPFSDTSFSGTDLAIEVIRTDPSPSSSGTVNHAFR  151

Query  533  SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            S D SP++S   + S+DESMS CDSL+SPE EYI+N
Sbjct  152  SRDASPSRSVSASVSLDESMSTCDSLKSPEFEYIDN  187



>gb|KEH35325.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=397

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  521  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY++N
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDN  180



>gb|AFK46051.1| unknown [Lotus japonicus]
Length=507

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 67/136 (49%), Gaps = 13/136 (10%)
 Frame = +2

Query  248  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTG----NAGFLG  415
            A KRP L+N+TN          S  S S S+ PC SK    KK +         N     
Sbjct  54   AKKRPPLSNLTNH-------IASRNSSSQSLVPCVSKFAKTKKEAPPKVAPALPNVKSAA  106

Query  416  TSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMS  595
             ++V         +   +      + A   +A++P V+ SMD SP KSDG + SMDESMS
Sbjct  107  AAVVFPKVATATASFTERNEDDAAAAASGARASVP-VSTSMDVSPCKSDGCSVSMDESMS  165

Query  596  PCDSLRSP-EVEYINN  640
             CDS +SP E+EY++N
Sbjct  166  SCDSFKSPAEIEYVDN  181



>gb|KEH35324.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=443

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  521  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY++N
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDN  180



>ref|XP_003630475.1| Cyclin A-like protein [Medicago truncatula]
Length=531

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  521  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY++N
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDN  180



>gb|KEH35323.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=505

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  521  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY++N
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDN  180



>ref|XP_003630468.1| Cyclin A [Medicago truncatula]
Length=558

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 70/167 (42%), Gaps = 34/167 (20%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS----  382
             K  AA   RL  KRPAL ++TN R  SL+ +         + PC SK    KK S    
Sbjct  27   NKNVAAVKTRLTKKRPALADVTNNRNASLVKTSLAAPYKPMV-PCASKTAKTKKDSIASS  85

Query  383  ------------SSSTGNAGFL------GTSIVPTSTLVKPITVPSKGPSAIGSDAILQK  508
                        SS   ++GFL       T      T VK    PS    A+  D     
Sbjct  86   QKNVMSENILQPSSRIRSSGFLVSKEACSTKASQIKTGVKAFIAPS-NDGAVCPD-----  139

Query  509  ATLPPVTCS---MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
                 V CS   MD  P+ S   +AS+DESMS  DSL +PE EYI N
Sbjct  140  --FKSVVCSPRWMDIYPSNSFSGSASLDESMSTSDSLMTPEFEYIRN  184



>gb|KEH35322.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=510

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 70/167 (42%), Gaps = 34/167 (20%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS----  382
             K  AA   RL  KRPAL ++TN R  SL+ +         + PC SK    KK S    
Sbjct  27   NKNVAAVKTRLTKKRPALADVTNNRNASLVKTSLAAPYKPMV-PCASKTAKTKKDSIASS  85

Query  383  ------------SSSTGNAGFL------GTSIVPTSTLVKPITVPSKGPSAIGSDAILQK  508
                        SS   ++GFL       T      T VK    PS    A+  D     
Sbjct  86   QKNVMSENILQPSSRIRSSGFLVSKEACSTKASQIKTGVKAFIAPS-NDGAVCPD-----  139

Query  509  ATLPPVTCS---MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
                 V CS   MD  P+ S   +AS+DESMS  DSL +PE EYI N
Sbjct  140  --FKSVVCSPRWMDIYPSNSFSGSASLDESMSTSDSLMTPEFEYIRN  184



>ref|XP_010063417.1| PREDICTED: cyclin-A1-1 [Eucalyptus grandis]
 gb|KCW70645.1| hypothetical protein EUGRSUZ_F03815 [Eucalyptus grandis]
Length=498

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 74/137 (54%), Gaps = 17/137 (12%)
 Frame = +2

Query  245  LAHKRPALTNITNQRTGsllssrstfsesssIAPCT-----SKNVGIKKSSSSSTGNAGF  409
            LA KR  L N+TN + G   S  S+       AP T     +K    +K SS+S+   G 
Sbjct  45   LAKKRAPLGNLTNLKAGDGNSRSSS-------APSTLVANATKLAKTRKGSSTSSSIMGL  97

Query  410  LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDES  589
             G+++ P     KP  V    PS   S   ++ A + P+ CSM  SP++SD  + S+DES
Sbjct  98   SGSAL-PRYASTKPSGV---LPSVNLSIPRIEIA-VDPMPCSMVVSPSRSDMQSVSLDES  152

Query  590  MSPCDSLRSPEVEYINN  640
            MS C+S +SP+VEYI+N
Sbjct  153  MSTCESFKSPDVEYIDN  169



>ref|XP_007019153.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16378.1| Cyclin A1,1, putative [Theobroma cacao]
Length=499

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 72/159 (45%), Gaps = 27/159 (17%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            N+  K+ A   Q    KR AL++ITNQ  G    SR     S  + PCTSK +  KK +S
Sbjct  26   NQSKKMGAVKTQ-FIKKRAALSDITNQGNGYPNGSRVIVIRSKPMVPCTSK-LAKKKETS  83

Query  386  SSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLP----------PVTC  532
            + T + G           L +P T+ P         D I  +   P             C
Sbjct  84   TCTQDHG-----------LSRPTTLSPESCADVSCMDTIWTRDDQPTPKVLGLLSPSSMC  132

Query  533  ---SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
               SMD SP +S   + S+DE+MS CDSL+ PE EY+ N
Sbjct  133  TPGSMDISPDRSLSGSVSLDETMSTCDSLKGPEFEYVEN  171



>gb|KDO80523.1| hypothetical protein CISIN_1g017988mg [Citrus sinensis]
Length=362

 Score = 55.1 bits (131),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  536  MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            MD SP+KSD  + SMDESMS CDS +SPEVEY++N
Sbjct  1    MDVSPSKSDANSVSMDESMSVCDSFKSPEVEYLDN  35


 Score = 24.6 bits (52),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +1

Query  637  QHETAGVHSIEKKASSALYISEHQE  711
             ++   + SI++K+   LYIS+H E
Sbjct  35   NNDVPPLDSIDRKSFRNLYISDHTE  59



>gb|KJB80670.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=416

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (55%), Gaps = 19/113 (17%)
 Frame = +2

Query  395  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAIL-----QKATLPPVTCSMDN  544
             N GF G  ++P  T V+P +VP   P  +     G++  L       +T+PP    M+ 
Sbjct  5    NNVGFSG-HVLPL-THVEPGSVPP--PKVVLSFPRGNEVALPPPPATISTIPPPPSIMEV  60

Query  545  SPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHLVRSIFRN  703
            SP+KSDG++ S DE+MS CDS +SPEVEY++N  +     + R+      FRN
Sbjct  61   SPSKSDGLSVSTDETMSTCDSFKSPEVEYMDNHDVTAVDSIERK-----TFRN  108



>ref|NP_001237800.1| mitotic cyclin a2-type [Glycine max]
 dbj|BAA09466.1| mitotic cyclin a2-type [Glycine max]
Length=484

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 14/141 (10%)
 Frame = +2

Query  227  AAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS-SSTGNA  403
            AAA   +A KRP L+N+TN       SS           PC +K    KK    + +GN 
Sbjct  32   AAAPTNMAKKRPPLSNLTNTVAHRNSSSS---------VPCAAKFAKTKKDVVPACSGNK  82

Query  404  GFLGTSIVPTSTLVKPI--TVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTAS  577
                 ++ P S ++ P   + P K  +       +   T+      +D SP+KSD M+ S
Sbjct  83   RPTLANVKPASAVIFPKANSFPVKNEAPPTPPPPVATVTV--PAPVVDVSPSKSDTMSVS  140

Query  578  MDESMSPCDSLRSPEVEYINN  640
             DESMS CDS +SP++EY++N
Sbjct  141  TDESMSSCDSFKSPDIEYVDN  161



>ref|XP_010684698.1| PREDICTED: cyclin-A1-4-like [Beta vulgaris subsp. vulgaris]
Length=504

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 81/168 (48%), Gaps = 22/168 (13%)
 Frame = +2

Query  203  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPC-TSKNVGIKKS  379
            EN +  V + ++ R   KRP L+N+TNQ   S+            + PC T+KN+  KK 
Sbjct  34   ENGNSNVISISNNR---KRPPLSNLTNQSRSSVSLPT--------LVPCVTTKNIKAKKG  82

Query  380  SSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAI-LQKATLPPVTCS-------  535
              +    A   G +  P          PSK  S   SDA+ + + T   V  +       
Sbjct  83   YDTRFNTAKIPGNNQPPFLIKKHDAVAPSKI-SLPRSDAVAVCRVTSSKVATTGVSSRMD  141

Query  536  -MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
             MD SP  SD  + SM++SMS CDSL+SPE+EY++  ++     ++R+
Sbjct  142  HMDVSPTPSDADSMSMEDSMSTCDSLKSPEIEYLDESEITTLSSIQRK  189



>ref|XP_008352630.1| PREDICTED: cyclin-A1-1-like [Malus domestica]
Length=210

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 63/144 (44%), Gaps = 27/144 (19%)
 Frame = +2

Query  344  PCTSK---------NVGIKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDA  496
            PCT+K              K  SS T N G  G     + +    I VP    S  G+D 
Sbjct  13   PCTNKIAKTIANKTTAKTTKEVSSCTSNTGLSGNVFQASLSAKSNILVPFSDTSFSGTDP  72

Query  497  ILQ-----------KATLPPVTC------SMDNSPAKSDGMTASMDESMSPCDSLRSPEV  625
             ++              LP ++C      S D SP++S   + S+DESMS CDSL SPE 
Sbjct  73   AIKVFCTDPSPSSSGTVLPALSCINHAFRSWDASPSRSVSASVSLDESMSTCDSLNSPEF  132

Query  626  EYINNMKLLEFIPLRRRHLVRSIF  697
            EYI+N  + + +    +   +S+F
Sbjct  133  EYIDNEDVSD-VKWIEKKTTKSLF  155



>gb|KFK38207.1| hypothetical protein AALP_AA3G082800 [Arabis alpina]
Length=399

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 11/91 (12%)
 Frame = +2

Query  410  LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDES  589
            L  S++P    VKP  +P+K  S +  +    KA           SP+KSD  T SMDE+
Sbjct  27   LNASVLPLQQSVKPSVIPNKATS-LPYEHYQSKAP----------SPSKSDDETVSMDET  75

Query  590  MSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
             S CDS +SP+VEYI+N ++   + + ++ L
Sbjct  76   RSTCDSFKSPQVEYIDNDEVSAVVSIEKKAL  106



>ref|XP_010925928.1| PREDICTED: cyclin-A1-4 [Elaeis guineensis]
Length=491

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 80/164 (49%), Gaps = 16/164 (10%)
 Frame = +2

Query  203  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS  382
            EN     AAA++Q  A KR AL NITN+      +S    ++       TS  + +KK S
Sbjct  27   ENTANVAAAASEQ--AKKRVALGNITNKSNAGRSASWLPGTKGVDRESATSLTLNVKKGS  84

Query  383  SSSTGNAGFLGTSIVPTSTLV--KPITVP-SKGP-SAIGSDAILQKATLPPVTCSMDNSP  550
             +   +  F  +S+  ++  +  K I++P   GP S IG+          P  CS   SP
Sbjct  85   VTCVLDTNFPASSVTASAATISNKDISLPLCDGPASTIGT---------CPEPCSTVISP  135

Query  551  AKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
              S G + S DE+MS CDS++SP+ +YI+N        L RR +
Sbjct  136  NHS-GDSVSSDETMSTCDSMKSPDFDYIDNGDSSAIASLERRAI  178



>gb|KFK24211.1| hypothetical protein AALP_AAs42301U000600 [Arabis alpina]
Length=444

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  545  SPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRHL  682
            SP+KSD  T SMDE+MS CDS +SP+VEYI+N ++   + + R+ L
Sbjct  86   SPSKSDDETVSMDETMSTCDSFKSPQVEYIDNDQVSAVVSIERKAL  131



>ref|XP_003545652.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=504

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK      Q +A KR  L N+TNQR  S  SS S     S     T K    + S + ST
Sbjct  37   GKAKRVTTQNVAVKRAPLANLTNQRNASSSSSSSLVQGGSIKVSKTKKEAPARTSITKST  96

Query  395  GNAGFL-GTSIVPTSTLVKPI--TVPSKGPSA--IGSDAILQKATLPPVTCSMDNSPAKS  559
             +   L     V +S++V P   ++P +  +A  + S A+       PV  S+D SP+K 
Sbjct  97   ISWNKLPELKSVNSSSVVIPRANSLPRRKDAAPTVASFAV-------PVHSSIDVSPSKI  149

Query  560  DGMTASMDESMSPCDSLRSP-EVEYINN  640
            DG + SMDE+MS CDS+ SP EVEY++N
Sbjct  150  DGRSVSMDETMS-CDSIESPDEVEYMDN  176



>ref|XP_002893979.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70238.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 75/147 (51%), Gaps = 33/147 (22%)
 Frame = +2

Query  245  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTG-NAGFLGTS  421
            +  KR  L+NITNQ+ GS L + S  S       C++K+  +K + +     NAGF  ++
Sbjct  39   MTKKRAPLSNITNQKNGSRLPNSSFDSVH-----CSNKSAKLKLAPTPPVCVNAGF-SSN  92

Query  422  IVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPC  601
            ++P                       LQK+ +P    S   SP+KSD  + SMDE+MS  
Sbjct  93   VLP-----------------------LQKSVVPHKVAS---SPSKSDDGSVSMDETMSSS  126

Query  602  DSLRSPEVEYINNMKLLEFIPLRRRHL  682
            DS +SP+VEYI+N ++   + + R+ L
Sbjct  127  DSYKSPQVEYIDNDEVSAVVSIERKAL  153



>ref|XP_007137455.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
 gb|ESW09449.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
Length=488

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 67/132 (51%), Gaps = 14/132 (11%)
 Frame = +2

Query  254  KRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSS-STGNAGFLGTSIVP  430
            KRP L+N+TN       SS           PC +K    KK      +GN      ++ P
Sbjct  44   KRPPLSNLTNTVAHRNSSSS---------VPCAAKLAKTKKEPVPLCSGNKRPALANVKP  94

Query  431  TSTLVKPI--TVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCD  604
            T+ +V P   ++P++  +      ++   T+      +D SP+ SD M+ SMDESMS CD
Sbjct  95   TNAVVFPKANSLPARNQAPPPPPPLVLTVTV--PPPVLDASPSTSDAMSVSMDESMSSCD  152

Query  605  SLRSPEVEYINN  640
            S +SP++EY++N
Sbjct  153  SFKSPDIEYVDN  164



>gb|KHN38997.1| Cyclin-A1-1 [Glycine soja]
Length=504

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +2

Query  215  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  394
            GK      Q +A KR  L N+TNQR  S  SS S     S     T K    + S + ST
Sbjct  37   GKAKRVTTQNVAVKRAPLANLTNQRNASSSSSSSLVQGGSIKVSKTKKEAPARTSITKST  96

Query  395  GNAGFL-GTSIVPTSTLVKPI--TVPSKGPSA--IGSDAILQKATLPPVTCSMDNSPAKS  559
             +   L     V +S++V P   ++P +  +A  + + A+       PV  S+D SP+K 
Sbjct  97   ISWNKLPELKSVNSSSVVIPRANSLPRRKDAAPTVATFAV-------PVHSSIDVSPSKI  149

Query  560  DGMTASMDESMSPCDSLRSP-EVEYINN  640
            DG + SMDE+MS CDS+ SP EVEY++N
Sbjct  150  DGRSVSMDETMS-CDSIESPDEVEYMDN  176



>ref|XP_006859067.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
 gb|ERN20534.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
Length=498

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 12/148 (8%)
 Frame = +2

Query  212  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKS---S  382
            + KV      + A +R AL N+TNQ   +      T ++         ++ G K++   +
Sbjct  39   NAKVPVVQQTQQAKRRAALHNLTNQCRENQGMIELTTTKLRKAPISHVQDAGTKENRAPT  98

Query  383  SSSTGNAGFLGTSIVPTSTLVKPI--TVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAK  556
            SS   + G + T     S   +P    +P K   + G    L         C+ + SP +
Sbjct  99   SSVPKSFGVVATKDTHLSRKEEPKGPHLPRKEEPSFGFVEFL-------APCNSNVSPNR  151

Query  557  SDGMTASMDESMSPCDSLRSPEVEYINN  640
            SDG + SMDE+MS CDSL+SPE EY++N
Sbjct  152  SDGDSVSMDETMSTCDSLKSPEFEYVDN  179



>gb|ADA70359.1| mitotic cyclin A1-like protein [Persea americana]
Length=479

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 76/144 (53%), Gaps = 25/144 (17%)
 Frame = +2

Query  254  KRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIVPT  433
            KR ALTN+TNQ  G + +  S+       A  TSK+   KK     TG++G    S V  
Sbjct  17   KRAALTNLTNQSLGRMGTQVSS-------ASTTSKH---KKGPIMLTGDSGLRPNSSVSM  66

Query  434  STLVKPITVPSKGPSAIGSD------AILQK------ATLPPVT--CSMDNSPAKS-DGM  568
             T+ +  ++  K      S+      +IL+       A++ P+   C+   SP+KS D  
Sbjct  67   LTVKQATSIAHKSAFPKSSETLPNASSILRNKYEGPAASVIPLQQPCATKFSPSKSSDDG  126

Query  569  TASMDESMSPCDSLRSPEVEYINN  640
            + S+DE+MS CDSL+SP++EY++N
Sbjct  127  SVSLDETMSTCDSLKSPDIEYVDN  150



>ref|XP_010521285.1| PREDICTED: cyclin-A1-2 isoform X1 [Tarenaya hassleriana]
Length=518

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +2

Query  533  SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            +MD SPA+SD  + S+DES+S CDS +SPEVEY++N+      PL R+
Sbjct  156  AMDASPARSDLDSVSLDESISTCDSFKSPEVEYMDNID----DPLERK  199



>ref|XP_010521286.1| PREDICTED: cyclin-A1-2 isoform X2 [Tarenaya hassleriana]
Length=493

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +2

Query  533  SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRR  676
            +MD SPA+SD  + S+DES+S CDS +SPEVEY++N+      PL R+
Sbjct  156  AMDASPARSDLDSVSLDESISTCDSFKSPEVEYMDNID----DPLERK  199



>emb|CDY36335.1| BnaC08g05160D [Brassica napus]
Length=424

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  500  LQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINNMKLLEFIPLRRRH  679
            + K T  P   +  +SP+KSD  + S+D++MS CDS +SP+VEYI+N ++   + + R+ 
Sbjct  59   ISKVTSLPYEQTKLHSPSKSDAASVSIDKTMSSCDSYKSPQVEYIDNEQVSAVVSIERKA  118

Query  680  L  682
            L
Sbjct  119  L  119



>ref|XP_006643958.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=496

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 72/149 (48%), Gaps = 22/149 (15%)
 Frame = +2

Query  224  AAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNA  403
            AA A  + A KR AL NITN       +  ++ +    +AP    ++G  +S+S++  + 
Sbjct  32   AAVAAGQQAKKRVALGNITNVAAAGGRAKLNSAAS---VAPLKKGSLGSGRSASTNRAS-  87

Query  404  GFLGTSIVPTS----------TLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPA  553
               G    PT              K   +P K PS + + A+       PV CS   SP 
Sbjct  88   ---GVKSAPTKPAPAISRHEVAAQKESVLPPKVPSIVATAALAPA----PVPCSSFVSPM  140

Query  554  KSDGMTASMDESMSPCDSLRSPEVEYINN  640
             S G + S+DE+MS CDS++SP+ EYI+N
Sbjct  141  HS-GDSVSVDETMSTCDSMKSPDFEYIDN  168



>gb|EEC70248.1| hypothetical protein OsI_01039 [Oryza sativa Indica Group]
Length=506

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 55/101 (54%), Gaps = 12/101 (12%)
 Frame = +2

Query  368  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ--------KATLPP  523
            +KK S +S  N G    S V +++  KP    S+  SA   +++L          A L P
Sbjct  80   VKKGSLASVRNVGTNRASAVKSAS-TKPAPAISRHESAAQKESVLPPKVPSIVPTAALAP  138

Query  524  VT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            VT  CS   SP  S G + S+DE+MS CDS++SPE EYI+N
Sbjct  139  VTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPEFEYIDN  178



>ref|XP_008806186.1| PREDICTED: cyclin-A1-4 isoform X1 [Phoenix dactylifera]
Length=493

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 72/146 (49%), Gaps = 12/146 (8%)
 Frame = +2

Query  248  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  427
            A KR AL N+TNQ      +SR   ++       TS ++ +KK S +   +     +S+ 
Sbjct  42   AKKRVALGNVTNQSNAGRSASRLPGTKGVHRGSTTSSSLNVKKGSVTCVRDTNLPRSSVT  101

Query  428  PTSTLV--KPITVP-SKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSP  598
             ++  +  K +++P   GP++             P  CS+  SP +S G + S DE+MS 
Sbjct  102  ASAATISSKDVSLPLHHGPTSTTGTC--------PEPCSIVISPNRSGG-SVSSDETMST  152

Query  599  CDSLRSPEVEYINNMKLLEFIPLRRR  676
            C+S+RSP+ EYI+N        L RR
Sbjct  153  CESMRSPDFEYIDNGDSSAIASLERR  178



>ref|XP_010095429.1| hypothetical protein L484_013386 [Morus notabilis]
 gb|EXB60121.1| hypothetical protein L484_013386 [Morus notabilis]
Length=498

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 73/146 (50%), Gaps = 1/146 (1%)
 Frame = +2

Query  206  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  385
            ++ G+   A+  +LA KR AL +ITNQ+ GS    +++      + PC +K    K   S
Sbjct  25   DKSGEKVMASKAQLAKKRSALADITNQKNGSQTGPKTSSFPLKPMVPCMAKIAKTKSEFS  84

Query  386  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPS-AIGSDAILQKATLPPVTCSMDNSPAKSD  562
            +   +      +++ +S+    I VPS   S  I   A++ +  +      +D SP++S 
Sbjct  85   ACIPSTDISRHTLLESSSSKPTIGVPSSNASLTIRDTALIAQRRITNAPRCIDASPSRSV  144

Query  563  GMTASMDESMSPCDSLRSPEVEYINN  640
            G++  +D + S CDSL+  + +  +N
Sbjct  145  GVSVYLDGNFSICDSLKCQDFDCDDN  170



>gb|EEE54185.1| hypothetical protein OsJ_01008 [Oryza sativa Japonica Group]
Length=497

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 55/101 (54%), Gaps = 12/101 (12%)
 Frame = +2

Query  368  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ--------KATLPP  523
            +KK S +S  N G    S V +++  KP    S+  SA   +++L          A L P
Sbjct  82   VKKGSLASGRNVGTNRASAVKSAS-AKPAPAISRHESATQKESVLPPKVPSIVPTAALAP  140

Query  524  VT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
            VT  CS   SP  S G + S+DE+MS CDS++SPE EYI+N
Sbjct  141  VTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPEFEYIDN  180



>ref|XP_004502519.1| PREDICTED: cyclin-A1-1-like [Cicer arietinum]
Length=514

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 70/158 (44%), Gaps = 24/158 (15%)
 Frame = +2

Query  230  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS-SSSTGNAG  406
            A   R A KRPALT++TN R  SL           ++ PC SK    KK S +SS  N  
Sbjct  34   AVKTRSAKKRPALTDVTNSRNASLAKPAVGAPSKPTV-PCASKTAKTKKDSVASSQKNVK  92

Query  407  -----FLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP------------VTCS  535
                    +S V +S LV P    S   S   +  +   A++ P            V C+
Sbjct  93   PCRNTLQASSSVKSSRLVLPKEACSTRASKTKTGGV--HASIAPSNDGAVCPEFKSVVCA  150

Query  536  ---MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYINN  640
               MD SP+ S   +AS+DESMS  DS  S E +Y  N
Sbjct  151  PRWMDISPSNSFSGSASLDESMSTSDSFMSSEFQYTGN  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395