BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF042G19

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084586.1|  PREDICTED: 40S ribosomal protein S4                419   4e-145   Sesamum indicum [beniseed]
ref|XP_011097305.1|  PREDICTED: 40S ribosomal protein S4-like           419   4e-145   Sesamum indicum [beniseed]
ref|XP_010553233.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    416   4e-144   Tarenaya hassleriana [spider flower]
gb|KDP45131.1|  hypothetical protein JCGZ_17463                         415   2e-143   Jatropha curcas
gb|KDP30648.1|  hypothetical protein JCGZ_16213                         415   2e-143   Jatropha curcas
ref|XP_010553232.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    414   3e-143   Tarenaya hassleriana [spider flower]
ref|XP_009368564.1|  PREDICTED: 40S ribosomal protein S4-3-like         414   3e-143   Pyrus x bretschneideri [bai li]
ref|XP_008233807.1|  PREDICTED: 40S ribosomal protein S4-1              414   3e-143   Prunus mume [ume]
ref|XP_010529053.1|  PREDICTED: 40S ribosomal protein S4-3-like         414   3e-143   Tarenaya hassleriana [spider flower]
ref|XP_004150395.1|  PREDICTED: 40S ribosomal protein S4-like           413   7e-143   
ref|XP_009369212.1|  PREDICTED: 40S ribosomal protein S4-3              413   7e-143   Pyrus x bretschneideri [bai li]
ref|XP_007218753.1|  hypothetical protein PRUPE_ppa009337mg             414   7e-143   
ref|XP_010529903.1|  PREDICTED: 40S ribosomal protein S4-3-like         413   8e-143   Tarenaya hassleriana [spider flower]
ref|XP_009393217.1|  PREDICTED: 40S ribosomal protein S4-1-like         413   9e-143   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004163526.1|  PREDICTED: 40S ribosomal protein S4-like           413   1e-142   
ref|XP_003544057.1|  PREDICTED: 40S ribosomal protein S4-1              413   1e-142   Glycine max [soybeans]
ref|XP_008454823.1|  PREDICTED: 40S ribosomal protein S4-3              413   1e-142   Cucumis melo [Oriental melon]
ref|XP_007211867.1|  hypothetical protein PRUPE_ppa010094mg             413   1e-142   Prunus persica
ref|XP_008383247.1|  PREDICTED: 40S ribosomal protein S4                412   2e-142   Malus domestica [apple tree]
ref|XP_010243078.1|  PREDICTED: 40S ribosomal protein S4-3-like         412   2e-142   Nelumbo nucifera [Indian lotus]
ref|XP_009766580.1|  PREDICTED: 40S ribosomal protein S4                412   2e-142   Nicotiana sylvestris
dbj|BAE20168.1|  ribosomal protein S4                                   412   2e-142   Panax ginseng [Asiatic ginseng]
ref|XP_003547932.1|  PREDICTED: 40S ribosomal protein S4-1              412   2e-142   Glycine max [soybeans]
ref|XP_008234249.1|  PREDICTED: 40S ribosomal protein S4                412   2e-142   Prunus mume [ume]
ref|XP_002515668.1|  40S ribosomal protein S4, putative                 412   2e-142   Ricinus communis
ref|XP_002308235.1|  hypothetical protein POPTR_0006s10460g             412   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_007205728.1|  hypothetical protein PRUPE_ppa010072mg             412   3e-142   Prunus persica
ref|XP_011046821.1|  PREDICTED: 40S ribosomal protein S4-3              412   3e-142   Populus euphratica
ref|XP_008461463.1|  PREDICTED: 40S ribosomal protein S4-3-like         412   3e-142   Cucumis melo [Oriental melon]
gb|EYU19705.1|  hypothetical protein MIMGU_mgv1a012053mg                412   3e-142   Erythranthe guttata [common monkey flower]
ref|XP_009391002.1|  PREDICTED: 40S ribosomal protein S4-3              412   3e-142   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN44410.1|  hypothetical protein Csa_7G281390                       412   4e-142   
gb|KHN48586.1|  40S ribosomal protein S4-2                              411   4e-142   Glycine soja [wild soybean]
ref|XP_003516980.1|  PREDICTED: 40S ribosomal protein S4                411   4e-142   Glycine max [soybeans]
ref|XP_002268192.1|  PREDICTED: 40S ribosomal protein S4-3-like         411   5e-142   Vitis vinifera
ref|XP_002323021.2|  hypothetical protein POPTR_0016s13210g             411   5e-142   Populus trichocarpa [western balsam poplar]
ref|XP_006576176.1|  PREDICTED: uncharacterized protein LOC100500...    411   5e-142   
ref|XP_004150397.1|  PREDICTED: 40S ribosomal protein S4-like           411   5e-142   Cucumis sativus [cucumbers]
gb|ACU24295.1|  unknown                                                 411   5e-142   Glycine max [soybeans]
ref|XP_006488578.1|  PREDICTED: 40S ribosomal protein S4-like           411   5e-142   Citrus sinensis [apfelsine]
ref|XP_004294780.1|  PREDICTED: 40S ribosomal protein S4-3              411   7e-142   Fragaria vesca subsp. vesca
ref|NP_001235826.1|  40S ribosomal S4 protein                           411   7e-142   Glycine max [soybeans]
ref|XP_002275063.1|  PREDICTED: 40S ribosomal protein S4                410   9e-142   Vitis vinifera
ref|XP_010934423.1|  PREDICTED: 40S ribosomal protein S4-3-like         410   1e-141   Elaeis guineensis
ref|XP_006409322.1|  hypothetical protein EUTSA_v10022813mg             410   1e-141   Eutrema salsugineum [saltwater cress]
ref|XP_010276734.1|  PREDICTED: 40S ribosomal protein S4-3              410   1e-141   Nelumbo nucifera [Indian lotus]
ref|XP_009597091.1|  PREDICTED: 40S ribosomal protein S4-like           410   1e-141   Nicotiana tomentosiformis
gb|EYU41945.1|  hypothetical protein MIMGU_mgv1a012043mg                410   1e-141   Erythranthe guttata [common monkey flower]
ref|XP_008461503.1|  PREDICTED: 40S ribosomal protein S4-3-like         410   1e-141   Cucumis melo [Oriental melon]
ref|XP_006429477.1|  hypothetical protein CICLE_v10012499mg             410   1e-141   Citrus clementina [clementine]
ref|XP_003604568.1|  40S ribosomal protein S4                           410   2e-141   Medicago truncatula
ref|XP_006374217.1|  40S ribosomal protein S4                           410   2e-141   Populus trichocarpa [western balsam poplar]
ref|XP_002884052.1|  40S ribosomal protein S4                           410   2e-141   Arabidopsis lyrata subsp. lyrata
ref|XP_009784493.1|  PREDICTED: 40S ribosomal protein S4-like           410   2e-141   Nicotiana sylvestris
ref|XP_009385022.1|  PREDICTED: 40S ribosomal protein S4-1-like         410   2e-141   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512717.1|  40S ribosomal protein S4, putative                 409   2e-141   Ricinus communis
ref|XP_002864574.1|  40S ribosomal protein S4                           409   2e-141   Arabidopsis lyrata subsp. lyrata
ref|XP_002871248.1|  40S ribosomal protein S4                           409   2e-141   Arabidopsis lyrata subsp. lyrata
ref|XP_010453688.1|  PREDICTED: 40S ribosomal protein S4-3-like         409   3e-141   Camelina sativa [gold-of-pleasure]
ref|XP_006399188.1|  hypothetical protein EUTSA_v10014417mg             409   3e-141   Eutrema salsugineum [saltwater cress]
ref|XP_009600336.1|  PREDICTED: 40S ribosomal protein S4                409   3e-141   Nicotiana tomentosiformis
ref|XP_002276986.1|  PREDICTED: 40S ribosomal protein S4-1              409   3e-141   Vitis vinifera
ref|XP_009402521.1|  PREDICTED: 40S ribosomal protein S4-3-like         409   3e-141   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010243101.1|  PREDICTED: 40S ribosomal protein S4-3-like         409   3e-141   Nelumbo nucifera [Indian lotus]
gb|ABK92450.1|  unknown                                                 409   4e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010907826.1|  PREDICTED: 40S ribosomal protein S4-3-like         409   4e-141   Elaeis guineensis
ref|XP_004240421.1|  PREDICTED: 40S ribosomal protein S4                409   5e-141   Solanum lycopersicum
ref|XP_004293830.1|  PREDICTED: 40S ribosomal protein S4-3              409   5e-141   Fragaria vesca subsp. vesca
ref|XP_011035547.1|  PREDICTED: 40S ribosomal protein S4-1              409   6e-141   Populus euphratica
ref|XP_006288484.1|  hypothetical protein CARUB_v10001743mg             408   6e-141   Capsella rubella
ref|NP_001275093.1|  40S ribosomal protein S4-like                      409   6e-141   Solanum tuberosum [potatoes]
ref|XP_006344073.1|  PREDICTED: 40S ribosomal protein S4-like           409   6e-141   
ref|NP_200650.1|  40S ribosomal protein S4-3                            408   6e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280972.1|  hypothetical protein CARUB_v10026972mg             408   6e-141   Capsella rubella
ref|XP_004511996.1|  PREDICTED: 40S ribosomal protein S4-1-like         408   7e-141   Cicer arietinum [garbanzo]
ref|XP_009794044.1|  PREDICTED: 40S ribosomal protein S4-like           408   7e-141   Nicotiana sylvestris
gb|ACU24626.1|  unknown                                                 408   7e-141   Glycine max [soybeans]
ref|XP_011019071.1|  PREDICTED: 40S ribosomal protein S4-3-like         408   7e-141   Populus euphratica
ref|NP_001275148.1|  40S ribosomal protein S4                           408   8e-141   Solanum tuberosum [potatoes]
ref|XP_010423256.1|  PREDICTED: 40S ribosomal protein S4-3-like         408   8e-141   Camelina sativa [gold-of-pleasure]
ref|XP_004491013.1|  PREDICTED: 40S ribosomal protein S4-2-like         408   8e-141   Cicer arietinum [garbanzo]
ref|XP_006298349.1|  hypothetical protein CARUB_v10014418mg             408   8e-141   Capsella rubella
ref|XP_010515129.1|  PREDICTED: 40S ribosomal protein S4-1              408   8e-141   Camelina sativa [gold-of-pleasure]
ref|XP_010443578.1|  PREDICTED: 40S ribosomal protein S4-3-like i...    408   9e-141   
ref|XP_010938423.1|  PREDICTED: 40S ribosomal protein S4-3              408   9e-141   Elaeis guineensis
ref|NP_568179.1|  40S ribosomal protein S4-2                            408   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156130.1|  hypothetical protein PHAVU_003G261200g             408   1e-140   Phaseolus vulgaris [French bean]
ref|NP_565414.1|  40S ribosomal protein S4-1                            408   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483440.1|  PREDICTED: 40S ribosomal protein S4-3-like         407   1e-140   Camelina sativa [gold-of-pleasure]
ref|XP_009381027.1|  PREDICTED: 40S ribosomal protein S4-like           407   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN38535.1|  40S ribosomal protein S4-1                              407   2e-140   Glycine soja [wild soybean]
gb|AAL49933.1|  AT5g58420/mqj2_10                                       407   2e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517120.1|  PREDICTED: 40S ribosomal protein S4-3-like         407   2e-140   Camelina sativa [gold-of-pleasure]
ref|XP_009595443.1|  PREDICTED: 40S ribosomal protein S4-like           407   2e-140   Nicotiana tomentosiformis
ref|XP_004307685.1|  PREDICTED: 40S ribosomal protein S4-like           407   3e-140   Fragaria vesca subsp. vesca
ref|XP_009609731.1|  PREDICTED: 40S ribosomal protein S4-like           407   3e-140   Nicotiana tomentosiformis
emb|CDY60025.1|  BnaAnng16450D                                          407   4e-140   Brassica napus [oilseed rape]
ref|XP_010491309.1|  PREDICTED: 40S ribosomal protein S4-3-like         406   4e-140   Camelina sativa [gold-of-pleasure]
ref|XP_009354210.1|  PREDICTED: 40S ribosomal protein S4-3-like         406   5e-140   Pyrus x bretschneideri [bai li]
dbj|BAB11167.1|  40S ribosomal protein S4                               406   6e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233133.1|  PREDICTED: 40S ribosomal protein S4-like           405   8e-140   Solanum lycopersicum
ref|XP_004233134.1|  PREDICTED: 40S ribosomal protein S4-like           405   8e-140   Solanum lycopersicum
ref|XP_006352980.1|  PREDICTED: 40S ribosomal protein S4-like           405   8e-140   Solanum tuberosum [potatoes]
ref|XP_006401084.1|  hypothetical protein EUTSA_v10014163mg             407   8e-140   
ref|XP_009369565.1|  PREDICTED: 40S ribosomal protein S4-3-like         405   1e-139   Pyrus x bretschneideri [bai li]
ref|XP_010676809.1|  PREDICTED: 40S ribosomal protein S4-1-like         405   1e-139   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010316939.1|  PREDICTED: 40S ribosomal protein S4-like           405   1e-139   Solanum lycopersicum
ref|NP_001242281.1|  uncharacterized protein LOC100812132               405   1e-139   Glycine max [soybeans]
ref|XP_002318967.2|  hypothetical protein POPTR_0013s01230g             405   1e-139   Populus trichocarpa [western balsam poplar]
ref|XP_006411034.1|  hypothetical protein EUTSA_v10017036mg             406   1e-139   
ref|XP_010037684.1|  PREDICTED: 40S ribosomal protein S4-3-like         405   2e-139   Eucalyptus grandis [rose gum]
gb|ACV70143.1|  putative 40S ribosomal protein S4                       405   2e-139   Jatropha curcas
ref|XP_009120350.1|  PREDICTED: 40S ribosomal protein S4-1              404   2e-139   Brassica rapa
ref|XP_007050962.1|  Ribosomal protein S4 (RPS4A) family protein        404   2e-139   Theobroma cacao [chocolate]
emb|CDY57385.1|  BnaCnng31910D                                          406   2e-139   Brassica napus [oilseed rape]
gb|KHN00473.1|  40S ribosomal protein S4-1                              405   2e-139   Glycine soja [wild soybean]
ref|XP_007026596.1|  Ribosomal protein S4 (RPS4A) family protein        404   3e-139   
emb|CDY32986.1|  BnaA10g11920D                                          405   3e-139   Brassica napus [oilseed rape]
emb|CDY14056.1|  BnaC02g01730D                                          405   3e-139   Brassica napus [oilseed rape]
ref|XP_010023674.1|  PREDICTED: 40S ribosomal protein S4-3              404   3e-139   Eucalyptus grandis [rose gum]
gb|KFK36724.1|  hypothetical protein AALP_AA4G161500                    404   4e-139   Arabis alpina [alpine rockcress]
ref|XP_004492491.1|  PREDICTED: 40S ribosomal protein S4-2-like         404   4e-139   Cicer arietinum [garbanzo]
ref|XP_009132054.1|  PREDICTED: 40S ribosomal protein S4-2-like         404   4e-139   Brassica rapa
emb|CDY05015.1|  BnaAnng01970D                                          405   4e-139   
ref|XP_008789926.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    404   4e-139   
gb|KHG30713.1|  40S ribosomal S4                                        404   4e-139   Gossypium arboreum [tree cotton]
ref|XP_006352979.1|  PREDICTED: 40S ribosomal protein S4-like           404   4e-139   Solanum tuberosum [potatoes]
gb|KDO67004.1|  hypothetical protein CISIN_1g024108mg                   404   5e-139   Citrus sinensis [apfelsine]
ref|XP_008356229.1|  PREDICTED: 40S ribosomal protein S4-3-like         404   5e-139   
ref|XP_011046165.1|  PREDICTED: 40S ribosomal protein S4-2-like         403   6e-139   Populus euphratica
ref|XP_010036744.1|  PREDICTED: 40S ribosomal protein S4-3-like         403   6e-139   Eucalyptus grandis [rose gum]
ref|XP_002463552.1|  hypothetical protein SORBIDRAFT_01g001850          403   6e-139   Sorghum bicolor [broomcorn]
ref|NP_001266498.1|  40S ribosomal protein S4                           403   6e-139   
ref|XP_011023749.1|  PREDICTED: 40S ribosomal protein S4-2-like         403   7e-139   Populus euphratica
ref|XP_003611879.1|  40S ribosomal protein S4                           403   7e-139   Medicago truncatula
ref|XP_003623356.1|  40S ribosomal protein S4                           403   8e-139   Medicago truncatula
gb|KJB71672.1|  hypothetical protein B456_011G136800                    403   8e-139   Gossypium raimondii
ref|XP_009125675.1|  PREDICTED: 40S ribosomal protein S4-1              403   9e-139   Brassica rapa
ref|XP_002322175.1|  hypothetical protein POPTR_0015s09110g             403   9e-139   Populus trichocarpa [western balsam poplar]
gb|EPS63485.1|  hypothetical protein M569_11297                         403   1e-138   Genlisea aurea
gb|KHG02126.1|  40S ribosomal S4                                        403   1e-138   Gossypium arboreum [tree cotton]
ref|XP_010666843.1|  PREDICTED: 40S ribosomal protein S4-1              402   1e-138   
gb|EPS70681.1|  hypothetical protein M569_04077                         402   1e-138   Genlisea aurea
ref|XP_002455614.1|  hypothetical protein SORBIDRAFT_03g014380          402   2e-138   Sorghum bicolor [broomcorn]
gb|KJB37999.1|  hypothetical protein B456_006G231800                    402   2e-138   Gossypium raimondii
ref|XP_010685909.1|  PREDICTED: 40S ribosomal protein S4-1              402   2e-138   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK27370.1|  hypothetical protein AALP_AA8G374100                    402   2e-138   Arabis alpina [alpine rockcress]
ref|XP_008789925.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    404   2e-138   Phoenix dactylifera
ref|XP_006646768.1|  PREDICTED: 40S ribosomal protein S4-like           402   3e-138   Oryza brachyantha
emb|CDY69841.1|  BnaAnng31720D                                          404   3e-138   Brassica napus [oilseed rape]
gb|KFK25102.1|  hypothetical protein AALP_AA8G066400                    401   4e-138   Arabis alpina [alpine rockcress]
gb|KHG26321.1|  40S ribosomal S4                                        401   4e-138   Gossypium arboreum [tree cotton]
ref|NP_001045624.1|  Os02g0105900                                       401   5e-138   
gb|KHG02041.1|  40S ribosomal S4                                        401   5e-138   Gossypium arboreum [tree cotton]
ref|XP_004960263.1|  PREDICTED: 40S ribosomal protein S4-like           401   5e-138   Setaria italica
emb|CDX81032.1|  BnaC03g02860D                                          401   6e-138   
ref|NP_001043015.1|  Os01g0358400                                       400   7e-138   
ref|XP_010087529.1|  40S ribosomal protein S4                           403   7e-138   
ref|XP_009130977.1|  PREDICTED: 40S ribosomal protein S4-1-like         400   1e-137   
ref|XP_006645886.1|  PREDICTED: 40S ribosomal protein S4-like           401   1e-137   
ref|XP_006851828.1|  hypothetical protein AMTR_s00041p00058440          400   1e-137   
ref|XP_009122377.1|  PREDICTED: 40S ribosomal protein S4-1              399   2e-137   Brassica rapa
emb|CDX99006.1|  BnaC09g48290D                                          400   2e-137   
emb|CDY58877.1|  BnaA03g55550D                                          400   2e-137   Brassica napus [oilseed rape]
sp|P46299.1|RS4_GOSHI  RecName: Full=40S ribosomal protein S4           399   2e-137   Gossypium hirsutum [American cotton]
gb|AAS48726.1|  ribosomal protein S4                                    399   5e-137   Zea mays [maize]
ref|XP_006644163.1|  PREDICTED: 40S ribosomal protein S4-like           398   6e-137   Oryza brachyantha
ref|XP_004962295.1|  PREDICTED: 40S ribosomal protein S4-like           397   1e-136   Setaria italica
ref|XP_002439678.1|  hypothetical protein SORBIDRAFT_09g018320          397   1e-136   Sorghum bicolor [broomcorn]
ref|XP_007141735.1|  hypothetical protein PHAVU_008G221000g             397   1e-136   Phaseolus vulgaris [French bean]
emb|CDX70008.1|  BnaA10g23570D                                          397   1e-136   
gb|AGZ15374.1|  40S ribosomal S4 protein                                397   1e-136   Phaseolus vulgaris [French bean]
dbj|BAJ94984.1|  predicted protein                                      397   1e-136   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY02821.1|  BnaC02g10680D                                          397   3e-136   
ref|NP_001055342.1|  Os05g0368300                                       395   7e-136   
gb|KJB29915.1|  hypothetical protein B456_005G123400                    394   2e-135   Gossypium raimondii
ref|NP_001288485.1|  40S ribosomal protein S4-like                      394   2e-135   Zea mays [maize]
emb|CDY32700.1|  BnaA02g07620D                                          395   3e-135   Brassica napus [oilseed rape]
ref|XP_003568916.1|  PREDICTED: 40S ribosomal protein S4                394   3e-135   Brachypodium distachyon [annual false brome]
dbj|BAD22763.1|  ribosomal protein                                      393   6e-135   Bromus inermis [awnless brome grass]
gb|KHG30303.1|  40S ribosomal S4                                        393   9e-135   Gossypium arboreum [tree cotton]
ref|XP_009781828.1|  PREDICTED: 40S ribosomal protein S4-like           392   2e-134   Nicotiana sylvestris
gb|EAY97774.1|  hypothetical protein OsI_19685                          392   4e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_009126753.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    391   2e-133   
gb|EEE63465.1|  hypothetical protein OsJ_18278                          394   2e-133   Oryza sativa Japonica Group [Japonica rice]
sp|O81363.1|RS4_PRUAR  RecName: Full=40S ribosomal protein S4           381   3e-130   Prunus armeniaca
gb|EMT14698.1|  40S ribosomal protein S4                                378   6e-129   
ref|XP_008778562.1|  PREDICTED: 40S ribosomal protein S4-3-like         376   2e-128   Phoenix dactylifera
emb|CDP06439.1|  unnamed protein product                                375   5e-128   Coffea canephora [robusta coffee]
gb|KHN03095.1|  40S ribosomal protein S4                                374   2e-127   Glycine soja [wild soybean]
gb|KDO67006.1|  hypothetical protein CISIN_1g024108mg                   372   5e-127   Citrus sinensis [apfelsine]
emb|CBI15899.3|  unnamed protein product                                372   7e-127   Vitis vinifera
gb|KDO63242.1|  hypothetical protein CISIN_1g023289mg                   372   7e-127   Citrus sinensis [apfelsine]
ref|XP_009126752.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    375   1e-126   
emb|CBI25428.3|  unnamed protein product                                371   2e-126   Vitis vinifera
gb|ABK21170.1|  unknown                                                 371   2e-126   Picea sitchensis
dbj|BAB10257.1|  ribosomal protein S4                                   370   3e-126   Arabidopsis thaliana [mouse-ear cress]
gb|ABK22322.1|  unknown                                                 371   3e-126   Picea sitchensis
ref|NP_001031846.1|  40S ribosomal protein S4-2                         370   5e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509192.1|  PREDICTED: 40S ribosomal protein S4-3-like         370   5e-126   Camelina sativa [gold-of-pleasure]
gb|KHG11751.1|  40S ribosomal S4                                        367   8e-125   Gossypium arboreum [tree cotton]
gb|KFK40122.1|  hypothetical protein AALP_AA3G333200                    366   8e-125   Arabis alpina [alpine rockcress]
gb|KJB77064.1|  hypothetical protein B456_012G118500                    365   3e-124   Gossypium raimondii
gb|KJB38000.1|  hypothetical protein B456_006G231800                    365   4e-124   Gossypium raimondii
ref|NP_001235428.1|  uncharacterized protein LOC100500000               362   2e-123   
gb|KJB29916.1|  hypothetical protein B456_005G123400                    359   9e-122   Gossypium raimondii
gb|AAT38019.1|  putative 40S ribosomal protein S4                       359   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006576177.1|  PREDICTED: uncharacterized protein LOC100500...    356   1e-120   Glycine max [soybeans]
ref|XP_001780588.1|  predicted protein                                  356   2e-120   
ref|XP_001759850.1|  predicted protein                                  356   3e-120   
ref|XP_001751877.1|  predicted protein                                  355   4e-120   
gb|KDO63240.1|  hypothetical protein CISIN_1g023289mg                   356   7e-120   Citrus sinensis [apfelsine]
ref|XP_001759591.1|  predicted protein                                  354   1e-119   
gb|KDO63241.1|  hypothetical protein CISIN_1g023289mg                   353   2e-119   Citrus sinensis [apfelsine]
gb|KCW60004.1|  hypothetical protein EUGRSUZ_H02737                     352   3e-119   Eucalyptus grandis [rose gum]
ref|XP_001766039.1|  predicted protein                                  353   1e-118   
ref|XP_001785339.1|  predicted protein                                  351   3e-118   
ref|NP_001189539.1|  40S ribosomal protein S4-1                         346   2e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KJB77063.1|  hypothetical protein B456_012G118500                    348   2e-117   Gossypium raimondii
gb|KJB36905.1|  hypothetical protein B456_006G184600                    347   3e-117   Gossypium raimondii
gb|KJB17112.1|  hypothetical protein B456_002G266000                    344   6e-116   Gossypium raimondii
ref|XP_002984314.1|  hypothetical protein SELMODRAFT_271698             341   2e-114   Selaginella moellendorffii
ref|XP_002972484.1|  hypothetical protein SELMODRAFT_148442             341   2e-114   Selaginella moellendorffii
ref|XP_005850141.1|  hypothetical protein CHLNCDRAFT_59606              326   1e-108   Chlorella variabilis
emb|CBI18118.3|  unnamed protein product                                318   2e-106   Vitis vinifera
gb|EIE83303.1|  40S ribosomal protein S4                                317   8e-105   Rhizopus delemar RA 99-880
emb|CEG70586.1|  Putative 40S ribosomal protein S4-A                    315   5e-104   Rhizopus microsporus
gb|EIE90129.1|  40S ribosomal protein S4-A                              314   6e-104   Rhizopus delemar RA 99-880
ref|XP_001421876.1|  Ribosomal protein S4, component of cytosolic...    314   6e-104   Ostreococcus lucimarinus CCE9901
gb|EIE79548.1|  40S ribosomal protein S4-A                              314   7e-104   Rhizopus delemar RA 99-880
gb|KDD75424.1|  hypothetical protein H632_c691p0                        314   9e-104   Helicosporidium sp. ATCC 50920
dbj|BAK03384.1|  predicted protein                                      314   1e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|GAN07411.1|  40S ribosomal protein S4                               313   1e-103   Mucor ambiguus
emb|CAA75242.1|  ribosomal protein S4                                   313   2e-103   Oryza sativa Japonica Group [Japonica rice]
emb|CEI87363.1|  Putative 40S ribosomal protein S4-A                    313   3e-103   Rhizopus microsporus
emb|CEG72922.1|  Putative 40S ribosomal protein S4-A                    313   3e-103   Rhizopus microsporus
ref|XP_011402198.1|  40S ribosomal protein S4-3                         312   6e-103   Auxenochlorella protothecoides
ref|XP_002502247.1|  predicted protein                                  311   6e-103   Micromonas commoda
gb|KFH71854.1|  40S ribosomal protein S4                                311   8e-103   Mortierella verticillata NRRL 6337
ref|XP_002954897.1|  component of cytosolic 80S ribosome and 40S ...    311   1e-102   Volvox carteri f. nagariensis
ref|XP_001691218.1|  ribosomal protein S4, component of cytosolic...    311   2e-102   Chlamydomonas reinhardtii
gb|EFX62690.1|  hypothetical protein DAPPUDRAFT_300650                  310   2e-102   Daphnia pulex
ref|XP_006679983.1|  hypothetical protein BATDEDRAFT_35382              311   3e-102   Batrachochytrium dendrobatidis JAM81
emb|CEP14949.1|  hypothetical protein                                   310   4e-102   Parasitella parasitica
gb|ELU11454.1|  hypothetical protein CAPTEDRAFT_152725                  310   4e-102   Capitella teleta
ref|XP_008157005.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    310   4e-102   Eptesicus fuscus
ref|XP_010989591.1|  PREDICTED: 40S ribosomal protein S4, X isoform     310   5e-102   
gb|ABQ18253.1|  ribosomal protein S4e                                   309   7e-102   Lygus lineolaris
ref|XP_004679117.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    309   7e-102   
ref|XP_005880123.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    310   7e-102   Myotis brandtii
ref|XP_003064004.1|  predicted protein                                  309   8e-102   Micromonas pusilla CCMP1545
ref|XP_002175438.1|  40S ribosomal protein S4                           309   9e-102   Schizosaccharomyces japonicus yFS275
ref|NP_001187069.1|  40S ribosomal protein S4                           309   9e-102   Ictalurus punctatus
dbj|BAB29207.1|  unnamed protein product                                309   9e-102   Mus musculus [mouse]
ref|XP_004887478.1|  PREDICTED: 40S ribosomal protein S4-like iso...    309   9e-102   
sp|Q95V34.1|RS4_SPOFR  RecName: Full=40S ribosomal protein S4           308   1e-101   Spodoptera frugiperda
gb|EAW71816.1|  ribosomal protein S4, X-linked, isoform CRA_b           307   1e-101   Homo sapiens [man]
ref|XP_004887477.1|  PREDICTED: 40S ribosomal protein S4-like iso...    309   1e-101   
dbj|BAM17680.1|  ribosomal protein S4                                   308   1e-101   Papilio xuthus [Chinese swallowtail]
ref|XP_011380547.1|  PREDICTED: 40S ribosomal protein S4-like           308   2e-101   Pteropus vampyrus
ref|NP_001233602.1|  40S ribosomal protein S4                           308   2e-101   Cricetulus griseus [Chinese hamsters]
dbj|BAE22507.1|  unnamed protein product                                308   2e-101   Mus musculus [mouse]
emb|CEG00570.1|  Ribosomal protein S4e                                  308   2e-101   Ostreococcus tauri
ref|XP_004327034.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    308   2e-101   
ref|XP_005189699.1|  PREDICTED: 40S ribosomal protein S4                308   2e-101   Musca domestica
ref|XP_006908610.1|  PREDICTED: 40S ribosomal protein S4-like           308   2e-101   Pteropus alecto
ref|XP_005650091.1|  ribosomal protein S4 component of cytosolic ...    308   2e-101   Coccomyxa subellipsoidea C-169
ref|XP_001365342.1|  PREDICTED: 40S ribosomal protein S4-like           308   2e-101   Monodelphis domestica
ref|XP_004484344.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    307   3e-101   Dasypus novemcinctus
ref|XP_006910196.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    308   3e-101   Pteropus alecto
gb|AFM89946.1|  40S ribosomal protein S4                                308   3e-101   Callorhinchus milii [Australian ghost shark]
gb|EPZ32691.1|  40S ribosomal protein S4                                307   3e-101   Rozella allomycis CSF55
ref|XP_006923115.1|  PREDICTED: 40S ribosomal protein S4-like iso...    307   3e-101   Pteropus alecto
ref|XP_008069053.1|  PREDICTED: 40S ribosomal protein S4, X isoform     307   3e-101   Carlito syrichta
ref|NP_000998.1|  40S ribosomal protein S4, X isoform X isoform         307   3e-101   Homo sapiens [man]
ref|XP_006199437.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    307   4e-101   Vicugna pacos
ref|XP_006082927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    307   4e-101   Myotis lucifugus
ref|XP_003803397.1|  PREDICTED: 40S ribosomal protein S4, X isoform     307   4e-101   Otolemur garnettii
gb|ADT80676.1|  ribosomal protein S4                                    307   4e-101   Euphydryas aurinia [marsh fritillary]
ref|XP_007242077.1|  PREDICTED: 40S ribosomal protein S4-like           307   4e-101   
emb|CCE33652.1|  probable ribosomal protein S4.e, cytosolic             307   4e-101   
emb|CDH52779.1|  40s ribosomal protein s4                               307   4e-101   
ref|XP_005750964.1|  PREDICTED: 40S ribosomal protein S4-like           307   5e-101   
ref|XP_003766510.1|  PREDICTED: 40S ribosomal protein S4-like iso...    307   5e-101   
ref|XP_005536157.1|  40S ribosomal protein S4                           306   5e-101   
ref|XP_003457778.1|  PREDICTED: 40S ribosomal protein S4-like           307   5e-101   
emb|CDS09843.1|  Putative 40S ribosomal protein S4-A                    307   5e-101   
gb|AFM87151.1|  40S ribosomal protein S4                                307   5e-101   
ref|XP_007169373.1|  PREDICTED: 40S ribosomal protein S4-like           307   5e-101   
gb|AFM86034.1|  40S ribosomal protein S4                                307   5e-101   
ref|XP_002752965.2|  PREDICTED: 40S ribosomal protein S4, X isofo...    307   6e-101   
gb|AFM90857.1|  40S ribosomal protein S4                                307   6e-101   
ref|XP_006926381.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    307   6e-101   
ref|NP_001037257.1|  40S ribosomal protein S4                           306   6e-101   
ref|XP_005706608.1|  40S ribosomal protein S4e                          306   6e-101   
ref|XP_007889271.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    306   6e-101   
gb|AFM86071.1|  40S ribosomal protein S4                                306   7e-101   
gb|EPX72118.1|  40S ribosomal protein S4                                306   7e-101   
gb|AFM90738.1|  40S ribosomal protein S4                                306   7e-101   
ref|XP_004605913.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    306   7e-101   
ref|XP_005147776.1|  PREDICTED: 40S ribosomal protein S4-like iso...    306   7e-101   
ref|XP_006124705.1|  PREDICTED: 40S ribosomal protein S4-like           306   8e-101   
gb|AFM90173.1|  40S ribosomal protein S4                                306   8e-101   
ref|XP_003898985.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    306   8e-101   
ref|XP_004080003.1|  PREDICTED: 40S ribosomal protein S4, X isoform     306   8e-101   
ref|XP_009002753.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    306   8e-101   
ref|XP_009204777.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    306   8e-101   
gb|AFM86794.1|  40S ribosomal protein S4                                306   8e-101   
ref|XP_007528658.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    306   9e-101   
ref|XP_005885533.1|  PREDICTED: 40S ribosomal protein S4, X isoform     306   9e-101   
ref|XP_008433376.1|  PREDICTED: 40S ribosomal protein S4, X isoform     306   9e-101   
ref|XP_010606265.1|  PREDICTED: 40S ribosomal protein S4, X isoform     306   9e-101   
dbj|BAD96199.1|  ribosomal protein S4, X-linked X isoform variant       306   1e-100   
ref|XP_010565368.1|  PREDICTED: 40S ribosomal protein S4, X isoform     306   1e-100   
gb|ACY95325.1|  ribosomal protein S4                                    306   1e-100   
gb|AFM89445.1|  40S ribosomal protein S4                                306   1e-100   
ref|XP_008600052.1|  ribosomal family S4e                               306   1e-100   
ref|XP_003471039.1|  PREDICTED: 40S ribosomal protein S4, X isoform     306   1e-100   
ref|XP_004758473.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    306   1e-100   
ref|NP_001090472.1|  40S ribosomal protein S4                           306   1e-100   
ref|XP_004887479.1|  PREDICTED: 40S ribosomal protein S4-like iso...    306   1e-100   
ref|NP_001232240.1|  putative ribosomal protein S4                      306   1e-100   
ref|XP_005313894.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     306   2e-100   
gb|EPY52214.1|  40S ribosomal protein S4                                306   2e-100   
gb|AFM90740.1|  40S ribosomal protein S4                                306   2e-100   
gb|KID72648.1|  Ribosomal protein S4e                                   305   2e-100   
ref|NP_001075891.1|  40S ribosomal protein S4                           305   2e-100   
ref|XP_005701142.1|  PREDICTED: 40S ribosomal protein S4-like           305   2e-100   
ref|NP_988912.1|  40S ribosomal protein S4                              305   2e-100   
ref|XP_003204899.1|  PREDICTED: 40S ribosomal protein S4-like           305   2e-100   
gb|EPY50701.1|  40S ribosomal protein S4                                305   2e-100   
ref|XP_008318659.1|  PREDICTED: 40S ribosomal protein S4, X isoform     305   2e-100   
ref|XP_005898249.1|  PREDICTED: 40S ribosomal protein S4-like           305   2e-100   
ref|NP_990439.1|  40S ribosomal protein S4                              305   2e-100   
ref|NP_001084941.1|  40S ribosomal protein S4                           305   2e-100   
gb|ELR52713.1|  40S ribosomal protein S4                                306   2e-100   
gb|EQL02576.1|  Ribosomal protein S4e                                   305   2e-100   
gb|AFM88094.1|  40S ribosomal protein S4                                305   2e-100   
gb|EPY52081.1|  40S ribosomal protein S4                                305   2e-100   
gb|EFB14527.1|  hypothetical protein PANDA_015068                       305   2e-100   
gb|AAB01670.1|  ribosomal protein S4                                    305   2e-100   
ref|XP_002112468.1|  conserved hypothetical protein                     305   2e-100   
gb|AFM85695.1|  40S ribosomal protein S4                                305   2e-100   
ref|XP_004798077.1|  PREDICTED: 40S ribosomal protein S4-like           305   2e-100   
ref|XP_003228681.1|  PREDICTED: 40S ribosomal protein S4                305   2e-100   
ref|XP_001625647.1|  predicted protein                                  305   2e-100   
gb|AFM88708.1|  40S ribosomal protein S4                                305   2e-100   
gb|KDR20779.1|  40S ribosomal protein S4                                305   3e-100   
gb|AFM90836.1|  40S ribosomal protein S4                                305   3e-100   
gb|KFO69844.1|  40S ribosomal protein S4                                304   3e-100   
ref|XP_003472052.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    305   3e-100   
ref|XP_005806467.1|  PREDICTED: 40S ribosomal protein S4-like           305   3e-100   
ref|XP_005700707.1|  PREDICTED: 40S ribosomal protein S4-like           305   3e-100   
ref|XP_003764080.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...    305   3e-100   
ref|XP_011212693.1|  PREDICTED: 40S ribosomal protein S4                305   3e-100   
ref|XP_004526806.1|  PREDICTED: 40S ribosomal protein S4-like           305   3e-100   
prf||1617101C  ribosomal protein S4                                     305   3e-100   
gb|AFM87833.1|  40S ribosomal protein S4                                305   3e-100   
ref|XP_005403497.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    305   3e-100   
ref|XP_005992934.1|  PREDICTED: 40S ribosomal protein S4-like           305   4e-100   
ref|XP_969262.1|  PREDICTED: 40S ribosomal protein S4                   305   4e-100   
ref|XP_010747631.1|  PREDICTED: 40S ribosomal protein S4, X isoform     305   4e-100   
ref|XP_007807221.1|  ribosomal protein S4                               305   4e-100   
gb|AFM87393.1|  40S ribosomal protein S4                                305   4e-100   
ref|XP_007823560.1|  hypothetical protein MAA_07371                     305   4e-100   
ref|XP_010372927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    305   4e-100   
gb|ELR61790.1|  hypothetical protein M91_18687                          305   4e-100   
gb|AFM89018.1|  40S ribosomal protein S4                                305   4e-100   
ref|XP_006888343.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    305   5e-100   
gb|KFP36414.1|  40S ribosomal protein S4                                303   5e-100   
ref|NP_595677.1|  40S ribosomal protein S4                              304   5e-100   
gb|KFQ66872.1|  40S ribosomal protein S4                                303   5e-100   
ref|XP_004777312.1|  PREDICTED: 40S ribosomal protein S4-like           304   6e-100   
gb|ETE69702.1|  40S ribosomal protein S4                                304   6e-100   
ref|XP_005965959.1|  PREDICTED: 40S ribosomal protein S4-like           304   6e-100   
gb|KID89485.1|  Ribosomal protein S4e                                   304   6e-100   
gb|KIE00269.1|  Ribosomal protein S4e                                   304   6e-100   
ref|XP_005435883.1|  PREDICTED: 40S ribosomal protein S4-like           306   6e-100   
ref|NP_001005589.1|  40S ribosomal protein S4, X isoform                304   6e-100   
ref|XP_004715961.1|  PREDICTED: 40S ribosomal protein S4, X isoform     306   6e-100   
ref|XP_001985577.1|  GH17143                                            304   7e-100   
gb|AGH70188.1|  40S ribosomal protein S4                                304   8e-100   
ref|NP_596350.1|  40S ribosomal protein S4                              304   8e-100   
ref|XP_004893287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    304   8e-100   
ref|XP_003785255.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    304   9e-100   
ref|XP_005313893.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     304   9e-100   
ref|XP_008498268.1|  PREDICTED: 40S ribosomal protein S4, X isoform     304   9e-100   
ref|XP_005900947.1|  PREDICTED: 40S ribosomal protein S4-like           304   9e-100   
ref|NP_001279537.1|  ribosomal protein S4, X-linked                     304   9e-100   
ref|XP_008292480.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    303   9e-100   
ref|XP_010854947.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    303   1e-99    
ref|XP_008054194.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    303   1e-99    
gb|KFM79678.1|  40S ribosomal protein S4                                303   1e-99    
ref|XP_008300594.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     303   1e-99    
ref|XP_006025231.1|  PREDICTED: 40S ribosomal protein S4-like           305   1e-99    
ref|NP_001028160.1|  40S ribosomal protein S4, Y isoform 1              303   1e-99    
ref|NP_594174.1|  40S ribosomal protein S4                              303   1e-99    
ref|XP_005894604.1|  PREDICTED: 40S ribosomal protein S4-like           303   1e-99    
gb|EHH60989.1|  Single copy abundant mRNA protein                       303   1e-99    
emb|CEG70587.1|  Putative 40S ribosomal protein S4-A                    303   1e-99    
ref|XP_005964326.1|  PREDICTED: 40S ribosomal protein S4-like iso...    303   2e-99    
gb|AER42698.1|  40S ribosomal protein S4                                303   2e-99    
ref|XP_006691808.1|  40S ribosomal protein S4-like protein              303   2e-99    
ref|XP_002749534.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    303   2e-99    
gb|AEL28856.1|  ribosomal protein S4                                    303   2e-99    
gb|EAW71815.1|  ribosomal protein S4, X-linked, isoform CRA_a           307   2e-99    
ref|XP_009259092.1|  hypothetical protein FPSE_07699                    303   2e-99    
ref|XP_003052651.1|  40S ribosomal protein S4                           303   2e-99    
ref|XP_010840576.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    304   2e-99    
ref|XP_004573481.1|  PREDICTED: 40S ribosomal protein S4-like           305   2e-99    
gb|KFV70222.1|  40S ribosomal protein S4                                301   2e-99    
gb|KFV12435.1|  40S ribosomal protein S4                                301   2e-99    
emb|CCE33007.1|  probable ribosomal protein S4.e, cytosolic             303   2e-99    
gb|KGG52703.1|  hypothetical protein DI09_141p50                        302   3e-99    
emb|CAJ17164.1|  ribosomal protein S4e                                  302   3e-99    
ref|XP_005888436.1|  PREDICTED: 40S ribosomal protein S4-like           302   3e-99    
ref|XP_006865002.1|  PREDICTED: 40S ribosomal protein S4-like           302   3e-99    
emb|CEI97230.1|  Putative 40S ribosomal protein S4-A                    302   3e-99    
ref|XP_003966899.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    302   3e-99    
ref|XP_006685622.1|  ribosomal protein S4e                              302   3e-99    
gb|ESW97160.1|  40S ribosomal protein S4-A                              302   3e-99    
gb|EGU80487.1|  hypothetical protein FOXB_08947                         302   3e-99    
gb|KFP05648.1|  40S ribosomal protein S4                                301   3e-99    
gb|AFM90735.1|  40S ribosomal protein S4                                302   3e-99    
ref|XP_004396498.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    302   3e-99    
ref|XP_006668474.1|  ribosomal protein S4                               302   4e-99    
gb|ABD98758.1|  putative ribosomal protein S4e                          302   4e-99    
emb|CAJ17167.1|  ribosomal protein S4e                                  302   4e-99    
ref|NP_001028159.1|  40S ribosomal protein S4, X isoform                302   4e-99    
emb|CCX29556.1|  Similar to 40S ribosomal protein S4; acc. no. O5...    302   4e-99    
tpg|DAA26280.1|  TPA: ribosomal protein S4, X-linked X-like             302   4e-99    
ref|XP_003651472.1|  40S ribosomal protein S4                           302   4e-99    
gb|AFM86700.1|  40S ribosomal protein S4                                302   4e-99    
ref|XP_008527087.1|  PREDICTED: 40S ribosomal protein S4, X isoform     302   5e-99    
ref|XP_011153375.1|  PREDICTED: 40S ribosomal protein S4                302   5e-99    
ref|XP_008954190.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    302   5e-99    
ref|XP_002708125.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    302   5e-99    
gb|EXX69253.1|  ribosomal 40S subunit protein S4A                       301   5e-99    
ref|XP_009902618.1|  PREDICTED: 40S ribosomal protein S4, X isoform     302   6e-99    
ref|XP_002008552.1|  GI11752                                            301   6e-99    
ref|XP_006877763.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    301   6e-99    
gb|ABW90414.1|  putative ribosomal protein S4                           301   7e-99    
ref|XP_002744145.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    301   9e-99    
gb|KIL89636.1|  hypothetical protein FAVG1_07216                        301   9e-99    
dbj|BAN20754.1|  ribosomal protein S4                                   301   1e-98    
ref|XP_002047468.1|  GJ13462                                            301   1e-98    
gb|EHK42992.1|  hypothetical protein TRIATDRAFT_300975                  301   1e-98    
sp|P79183.3|RS4Y1_MACFU  RecName: Full=40S ribosomal protein S4, ...    301   1e-98    
ref|XP_964251.2|  40S ribosomal protein S4                              301   1e-98    
emb|CAJ17168.1|  ribosomal protein S4e                                  301   1e-98    
ref|XP_006275921.1|  PREDICTED: 40S ribosomal protein S4-like           305   1e-98    
ref|XP_006102622.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    302   1e-98    
dbj|BAA33778.1|  ribosomal protein S4                                   300   1e-98    
ref|XP_001353585.1|  GA10883                                            300   2e-98    
ref|XP_002493655.1|  40S ribosomal protein S4                           301   2e-98    
ref|XP_001482877.1|  40S ribosomal protein S4                           300   2e-98    
ref|XP_004272428.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    300   2e-98    
ref|XP_011275622.1|  40S ribosomal protein                              300   2e-98    
emb|CAJ17169.1|  ribosomal protein S4e                                  300   2e-98    
emb|CDR46586.1|  CYFA0S24e00562g1_1                                     300   2e-98    
ref|XP_001094914.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    300   2e-98    
ref|XP_001599933.1|  PREDICTED: 40S ribosomal protein S4                300   2e-98    
tpg|DAA27762.1|  TPA: ribosomal protein S4, X-linked X-like             300   3e-98    
ref|NP_001008987.1|  40S ribosomal protein S4, Y isoform 1              300   3e-98    
gb|KFA60798.1|  hypothetical protein S40285_07752                       300   3e-98    
ref|XP_004365903.1|  40S ribosomal protein S4                           300   3e-98    
gb|AAP20216.1|  40S ribosomal protein S4                                298   3e-98    
ref|XP_010861885.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    300   3e-98    
ref|XP_004581137.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    300   3e-98    
gb|AAI00906.1|  Ribosomal protein S4, Y-linked 1                        300   3e-98    
ref|XP_005236846.1|  PREDICTED: 40S ribosomal protein S4-like           303   3e-98    
ref|NP_000999.1|  40S ribosomal protein S4, Y isoform 1                 300   3e-98    
ref|XP_001957453.1|  GF24027                                            300   3e-98    
gb|KIN07653.1|  hypothetical protein OIDMADRAFT_16250                   300   3e-98    
gb|KEY68677.1|  hypothetical protein S7711_00551                        300   3e-98    
gb|KDN64809.1|  putative ribosomal family S4e                           300   3e-98    
ref|XP_002599076.1|  hypothetical protein BRAFLDRAFT_81739              300   3e-98    
ref|XP_007188637.1|  PREDICTED: 40S ribosomal protein S4-like           300   4e-98    
ref|XP_001222557.1|  40S ribosomal protein S4                           300   4e-98    
ref|XP_003374555.1|  40S ribosomal protein S4                           300   4e-98    
ref|XP_001972620.1|  GG15623                                            299   4e-98    
ref|XP_007872809.1|  hypothetical protein PNEG_00898                    299   4e-98    
ref|XP_010367494.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...    299   5e-98    
gb|ACL51673.1|  ribosomal protein S4 Y-linked 1                         299   5e-98    
ref|NP_001252674.1|  ribosomal protein S4, Y-linked 1                   299   5e-98    
ref|XP_011144347.1|  PREDICTED: 40S ribosomal protein S4-like           299   5e-98    
ref|XP_002716797.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    299   5e-98    
gb|KGQ99291.1|  40S ribosomal protein S4                                299   5e-98    
ref|XP_010758820.1|  40S ribosomal protein S4                           299   6e-98    
ref|XP_011300956.1|  PREDICTED: 40S ribosomal protein S4                299   6e-98    
ref|XP_005561444.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    299   6e-98    
ref|XP_004264287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    299   6e-98    
ref|XP_006822958.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    299   7e-98    
gb|ABW23138.1|  ribosomal protein rps4                                  299   7e-98    
sp|Q861U8.2|RS4Y1_GORGO  RecName: Full=40S ribosomal protein S4, ...    299   7e-98    
ref|XP_002794223.1|  40S ribosomal protein S4                           299   7e-98    
sp|Q4GXU6.1|RS4_CARGR  RecName: Full=40S ribosomal protein S4           299   7e-98    
gb|ACY71283.1|  ribosomal protein S4                                    299   7e-98    
sp|Q56FH2.1|RS4_LYSTE  RecName: Full=40S ribosomal protein S4           299   7e-98    
ref|XP_003347065.1|  40S ribosomal protein S4                           299   8e-98    



>ref|XP_011084586.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
 ref|XP_011095064.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
Length=263

 Score =   419 bits (1077),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 218/228 (96%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_011097305.1| PREDICTED: 40S ribosomal protein S4-like [Sesamum indicum]
Length=263

 Score =   419 bits (1077),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 218/228 (96%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_010553233.1| PREDICTED: 40S ribosomal protein S4-3 isoform X2 [Tarenaya hassleriana]
Length=262

 Score =   416 bits (1070),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 216/228 (95%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTI  228



>gb|KDP45131.1| hypothetical protein JCGZ_17463 [Jatropha curcas]
Length=264

 Score =   415 bits (1066),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/228 (94%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>gb|KDP30648.1| hypothetical protein JCGZ_16213 [Jatropha curcas]
Length=263

 Score =   415 bits (1066),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/228 (94%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_010553232.1| PREDICTED: 40S ribosomal protein S4-3 isoform X1 [Tarenaya hassleriana]
Length=263

 Score =   414 bits (1065),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 215/227 (95%), Positives = 226/227 (99%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYREV
Sbjct  3    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREV  62

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            I+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKF
Sbjct  63   IAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKF  122

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVV
Sbjct  123  KLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVV  182

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRNRGRVGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTI
Sbjct  183  MVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTI  229



>ref|XP_009368564.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   414 bits (1065),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA+GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTI  228



>ref|XP_008233807.1| PREDICTED: 40S ribosomal protein S4-1 [Prunus mume]
Length=264

 Score =   414 bits (1065),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRL NVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLANVFTI  228



>ref|XP_010529053.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   414 bits (1064),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLC+VRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCRVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTI  228



>ref|XP_004150395.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160252.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=264

 Score =   413 bits (1062),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_009369212.1| PREDICTED: 40S ribosomal protein S4-3 [Pyrus x bretschneideri]
Length=264

 Score =   413 bits (1062),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_007218753.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
 gb|EMJ19952.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
Length=296

 Score =   414 bits (1065),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  33   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  92

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  93   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  152

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  153  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  212

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRL NVFTI
Sbjct  213  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLANVFTI  260



>ref|XP_010529903.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   413 bits (1062),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  LKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSF+T+HIQDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFDTIHIQDATGHEFATRMGNVFTI  228



>ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   413 bits (1062),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_004163526.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN50688.1| hypothetical protein Csa_5G212590 [Cucumis sativus]
 gb|KGN50692.1| hypothetical protein Csa_5G215120 [Cucumis sativus]
Length=264

 Score =   413 bits (1061),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_003544057.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
Length=264

 Score =   413 bits (1061),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_008454823.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
 ref|XP_008454824.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
Length=264

 Score =   413 bits (1061),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_007211867.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
 ref|XP_008225941.1| PREDICTED: 40S ribosomal protein S4-like [Prunus mume]
 gb|EMJ13066.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
Length=264

 Score =   413 bits (1061),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA+GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTI  228



>ref|XP_008383247.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_008364235.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_009363280.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=264

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA+GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDASGHEFATRLGNVFTI  228



>ref|XP_010243078.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=265

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/228 (94%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG KGIP+INTYDGRTIRYPDPLI+ANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGDKGIPYINTYDGRTIRYPDPLIRANDTIKLDLETNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_009766580.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana sylvestris]
Length=264

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTL  228



>dbj|BAE20168.1| ribosomal protein S4 [Panax ginseng]
Length=264

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VQSILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFETVHIQD+ GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETVHIQDSLGHEFATRLGNVFTI  228



>ref|XP_003547932.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
 gb|KHN01598.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_008234249.1| PREDICTED: 40S ribosomal protein S4 [Prunus mume]
Length=265

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_002515668.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF46720.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_002308235.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
 gb|EEE91758.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
Length=263

 Score =   412 bits (1058),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_007205728.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
 gb|EMJ06927.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
Length=265

 Score =   412 bits (1058),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_011046821.1| PREDICTED: 40S ribosomal protein S4-3 [Populus euphratica]
Length=263

 Score =   412 bits (1058),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_008461463.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   412 bits (1058),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>gb|EYU19705.1| hypothetical protein MIMGU_mgv1a012053mg [Erythranthe guttata]
Length=263

 Score =   412 bits (1058),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFETVHIQD+TGHEFATRLGNV+TI
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETVHIQDSTGHEFATRLGNVYTI  228



>ref|XP_009391002.1| PREDICTED: 40S ribosomal protein S4-3 [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   412 bits (1058),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  228



>gb|KGN44410.1| hypothetical protein Csa_7G281390 [Cucumis sativus]
Length=264

 Score =   412 bits (1058),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKH GSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHTGSFETIHIQDATGHEFATRLGNVFTI  228



>gb|KHN48586.1| 40S ribosomal protein S4-2 [Glycine soja]
Length=264

 Score =   411 bits (1057),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE N +VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENNIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max]
Length=264

 Score =   411 bits (1057),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVF I
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFII  228



>ref|XP_002268192.1| PREDICTED: 40S ribosomal protein S4-3-like [Vitis vinifera]
Length=264

 Score =   411 bits (1057),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKV+ VQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVKGVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIK+REKHKG+FET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKSREKHKGTFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_002323021.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
 gb|EEF04782.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
Length=263

 Score =   411 bits (1057),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_006576176.1| PREDICTED: uncharacterized protein LOC100500000 isoform X1 [Glycine 
max]
Length=264

 Score =   411 bits (1057),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVF I
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFII  228



>ref|XP_004150397.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160251.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN44413.1| hypothetical protein Csa_7G282410 [Cucumis sativus]
Length=264

 Score =   411 bits (1057),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTV  228



>gb|ACU24295.1| unknown [Glycine max]
Length=264

 Score =   411 bits (1057),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKK++KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKYLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_006488578.1| PREDICTED: 40S ribosomal protein S4-like [Citrus sinensis]
 gb|KDO67005.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=265

 Score =   411 bits (1057),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI  228



>ref|XP_004294780.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   411 bits (1056),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NKV+DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKVIDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|NP_001235826.1| 40S ribosomal S4 protein [Glycine max]
 gb|AAM93434.1| 40S ribosomal S4 protein [Glycine max]
 gb|ACU21252.1| unknown [Glycine max]
Length=264

 Score =   411 bits (1056),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QD+TGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDSTGHEFATRMGNVFTI  228



>ref|XP_002275063.1| PREDICTED: 40S ribosomal protein S4 [Vitis vinifera]
Length=264

 Score =   410 bits (1055),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREK KGSFET+H+QDATGHEFATRLGNVF I
Sbjct  181  VMVTGGRNRGRVGVIKNREKRKGSFETIHVQDATGHEFATRLGNVFII  228



>ref|XP_010934423.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   410 bits (1055),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTI  228



>ref|XP_006409322.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 ref|XP_006411040.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
 gb|ESQ50775.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 gb|ESQ52493.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
Length=262

 Score =   410 bits (1054),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  228



>ref|XP_010276734.1| PREDICTED: 40S ribosomal protein S4-3 [Nelumbo nucifera]
Length=267

 Score =   410 bits (1055),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE+NK++DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLETNKIIDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_009597091.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   410 bits (1054),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTL  228



>gb|EYU41945.1| hypothetical protein MIMGU_mgv1a012043mg [Erythranthe guttata]
Length=263

 Score =   410 bits (1054),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRH+LVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFGKKGIP+INTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGKKGIPYINTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFETVHIQD+TG+EFATRL NV+TI
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETVHIQDSTGNEFATRLSNVYTI  228



>ref|XP_008461503.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   410 bits (1054),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKT+PAGFMD++SIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDILSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_006429477.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 ref|XP_006481102.1| PREDICTED: 40S ribosomal protein S4-2-like [Citrus sinensis]
 gb|ESR42717.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 gb|KDO63239.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=262

 Score =   410 bits (1053),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI  228



>ref|XP_003604568.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES86765.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=264

 Score =   410 bits (1053),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+H+QDA+GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHVQDASGHEFATRLGNVFTI  228



>ref|XP_006374217.1| 40S ribosomal protein S4 [Populus trichocarpa]
 gb|ERP52014.1| 40S ribosomal protein S4 [Populus trichocarpa]
Length=263

 Score =   410 bits (1053),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_002884052.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60311.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   410 bits (1053),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIPF+NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  228



>ref|XP_009784493.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   410 bits (1053),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTL  228



>ref|XP_009385022.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   410 bits (1053),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSF+T+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFDTIHVQDATGHEFATRMGNVFTI  228



>ref|XP_002512717.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF50169.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   409 bits (1052),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ +FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRMGNVFTI  228



>ref|XP_002864574.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40833.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   409 bits (1052),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEA+
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAQ  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  228



>ref|XP_002871248.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47507.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   409 bits (1052),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KR+NAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRINAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIPF+NTYDGRTIRYPDPLIK NDTVKLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTVKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  228



>ref|XP_010453688.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   409 bits (1052),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_006399188.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
 gb|ESQ40641.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
Length=262

 Score =   409 bits (1051),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  228



>ref|XP_009600336.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana tomentosiformis]
Length=264

 Score =   409 bits (1052),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYGE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTL  228



>ref|XP_002276986.1| PREDICTED: 40S ribosomal protein S4-1 [Vitis vinifera]
Length=264

 Score =   409 bits (1051),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRH+ VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHIFVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+HIQDATGHEFATRLGNVF I
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHIQDATGHEFATRLGNVFII  228



>ref|XP_009402521.1| PREDICTED: 40S ribosomal protein S4-3-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   409 bits (1051),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSV+FG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVRFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEANKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_010243101.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=264

 Score =   409 bits (1051),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLI+ANDT+K+DLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKIDLEANKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG+IKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGIIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>gb|ABK92450.1| unknown [Populus trichocarpa]
Length=263

 Score =   409 bits (1051),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKF VGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFGVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_010907826.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   409 bits (1050),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHLQDATGHEFATRLGNVFTI  228



>ref|XP_004240421.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   409 bits (1050),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTL  228



>ref|XP_004293830.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   409 bits (1050),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIK+REKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKSREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_011035547.1| PREDICTED: 40S ribosomal protein S4-1 [Populus euphratica]
Length=263

 Score =   409 bits (1050),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_006288484.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
 ref|XP_010452659.1| PREDICTED: 40S ribosomal protein S4-3 [Camelina sativa]
 gb|EOA21382.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
Length=262

 Score =   408 bits (1049),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|NP_001275093.1| 40S ribosomal protein S4-like [Solanum tuberosum]
 gb|ABB72798.1| 40S ribosomal protein S4-like protein [Solanum tuberosum]
Length=264

 Score =   409 bits (1050),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTL  228



>ref|XP_006344073.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   409 bits (1050),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTL  228



>ref|NP_200650.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
 sp|Q8VYK6.2|RS43_ARATH RecName: Full=40S ribosomal protein S4-3 [Arabidopsis thaliana]
 gb|AAL16117.1|AF428285_1 AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAM64284.1| ribosomal protein S4-like [Arabidopsis thaliana]
 gb|AED97051.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
Length=262

 Score =   408 bits (1049),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI  228



>ref|XP_006280972.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
 gb|EOA13870.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
Length=262

 Score =   408 bits (1049),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_004511996.1| PREDICTED: 40S ribosomal protein S4-1-like [Cicer arietinum]
Length=264

 Score =   408 bits (1049),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIKANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_009794044.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   408 bits (1049),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGSKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTL  228



>gb|ACU24626.1| unknown [Glycine max]
Length=264

 Score =   408 bits (1049),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMD VSIPKTNENF L YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDAVSIPKTNENFHLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_011019071.1| PREDICTED: 40S ribosomal protein S4-3-like [Populus euphratica]
Length=263

 Score =   408 bits (1049),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 227/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKK+MKRL+APKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKNMKRLHAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|NP_001275148.1| 40S ribosomal protein S4 [Solanum tuberosum]
 sp|P46300.1|RS4_SOLTU RecName: Full=40S ribosomal protein S4 [Solanum tuberosum]
 emb|CAA54095.1| ribosomal protein S4 [Solanum tuberosum]
Length=264

 Score =   408 bits (1049),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTL  228



>ref|XP_010423256.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=258

 Score =   408 bits (1048),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_004491013.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=265

 Score =   408 bits (1049),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_006298349.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
 gb|EOA31247.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
Length=262

 Score =   408 bits (1049),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_010515129.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010467507.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010489362.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
Length=262

 Score =   408 bits (1048),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_010443578.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010443579.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X2 [Camelina 
sativa]
Length=262

 Score =   408 bits (1048),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_010938423.1| PREDICTED: 40S ribosomal protein S4-3 [Elaeis guineensis]
Length=265

 Score =   408 bits (1049),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTI  228



>ref|NP_568179.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 sp|P49204.4|RS42_ARATH RecName: Full=40S ribosomal protein S4-2 [Arabidopsis thaliana]
 emb|CAB87265.1| ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAK93610.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL50106.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAL85148.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAM10339.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAM61755.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AED91107.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=262

 Score =   408 bits (1048),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI  228



>ref|XP_007156130.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28124.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=264

 Score =   408 bits (1048),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIK+R+K+KGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKSRDKNKGSFETIHVQDATGHEFATRLGNVFTI  228



>ref|NP_565414.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 sp|Q93VH9.1|RS41_ARATH RecName: Full=40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AAK43846.1|AF370469_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK59636.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL34157.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL47338.1| unknown protein [Arabidopsis thaliana]
 gb|AAM60830.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AEC06616.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=261

 Score =   408 bits (1048),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI  228



>ref|XP_010483440.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   407 bits (1047),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
             KLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  LKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_009381027.1| PREDICTED: 40S ribosomal protein S4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   407 bits (1047),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGN+
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>gb|KHN38535.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   407 bits (1047),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNA KHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNARKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QD+TGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDSTGHEFATRMGNVFTI  228



>gb|AAL49933.1| AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAN28773.1| At5g58420/mqj2_10 [Arabidopsis thaliana]
Length=262

 Score =   407 bits (1046),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRL+YALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLEYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI  228



>ref|XP_010517120.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   407 bits (1046),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_009595443.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   407 bits (1046),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHAIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGTKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTL  228



>ref|XP_004307685.1| PREDICTED: 40S ribosomal protein S4-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   407 bits (1045),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIK+REKHKGSFET+H+QD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKSREKHKGSFETIHVQDSTGHEFATRLGNVFTI  228



>ref|XP_009609731.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
 ref|XP_009764136.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   407 bits (1045),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIIMRNRLKYALTYGE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDAQGHEFATRLGNVFTL  228



>emb|CDY60025.1| BnaAnng16450D [Brassica napus]
Length=285

 Score =   407 bits (1047),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 210/231 (91%), Positives = 225/231 (97%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  247
            +T MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT
Sbjct  21   ATHMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  80

Query  248  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  427
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSIRDE
Sbjct  81   YREVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDE  140

Query  428  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDv  607
            EAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDV
Sbjct  141  EAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDV  200

Query  608  gnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            GNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  201  GNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  251



>ref|XP_010491309.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   406 bits (1044),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+ K+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEAKKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_009354210.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=265

 Score =   406 bits (1044),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLVLILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRDEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTI  228



>dbj|BAB11167.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
Length=263

 Score =   406 bits (1043),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 210/227 (93%), Positives = 223/227 (98%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV
Sbjct  3    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  62

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAKF
Sbjct  63   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKF  122

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVV
Sbjct  123  KLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVV  182

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNV+TI
Sbjct  183  MVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTI  229



>ref|XP_004233133.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   405 bits (1042),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTL  228



>ref|XP_004233134.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233136.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233137.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   405 bits (1042),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTL  228



>ref|XP_006352980.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   405 bits (1042),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTL  228



>ref|XP_006401084.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
 gb|ESQ42537.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
Length=312

 Score =   407 bits (1047),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 211/241 (88%), Positives = 230/241 (95%), Gaps = 3/241 (1%)
 Frame = +2

Query  47   RRPNTQL---STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI  217
            + P ++L   +  MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI
Sbjct  38   KSPGSELRLQTPNMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI  97

Query  218  IRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKG  397
            IRNRLKYAL YREV+SILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKG
Sbjct  98   IRNRLKYALNYREVVSILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKG  157

Query  398  RFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESN  577
            RFRLHSIRDEEAK+KLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+N
Sbjct  158  RFRLHSIRDEEAKYKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEAN  217

Query  578  KVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFT  757
            K+V+FIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT
Sbjct  218  KIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFT  277

Query  758  I  760
            I
Sbjct  278  I  278



>ref|XP_009369565.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   405 bits (1041),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRDEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE++K+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETSKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTI  228



>ref|XP_010676809.1| PREDICTED: 40S ribosomal protein S4-1-like [Beta vulgaris subsp. 
vulgaris]
Length=263

 Score =   405 bits (1041),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRH+LVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHILVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  YKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFET+HI+DA GHEFATR GNVF I
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETIHIEDAAGHEFATRQGNVFII  228



>ref|XP_010316939.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   405 bits (1041),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGK+RTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKIRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTL  228



>ref|NP_001242281.1| uncharacterized protein LOC100812132 [Glycine max]
 gb|ACU23059.1| unknown [Glycine max]
Length=264

 Score =   405 bits (1041),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLK ALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKCALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  228



>ref|XP_002318967.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
 gb|ABK94293.1| unknown [Populus trichocarpa]
 gb|EEE94890.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
Length=263

 Score =   405 bits (1040),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_006411034.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
 gb|ESQ52487.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
Length=288

 Score =   406 bits (1043),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/230 (92%), Positives = 222/230 (97%), Gaps = 0/230 (0%)
 Frame = +2

Query  71   TTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY  250
              MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECL LVLIIRN LKYALTY
Sbjct  25   ANMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLTLVLIIRNSLKYALTY  84

Query  251  REVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEE  430
            REVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE
Sbjct  85   REVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEE  144

Query  431  AKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvg  610
            AKFKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVG
Sbjct  145  AKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVG  204

Query  611  nvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            NVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  205  NVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  254



>ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=264

 Score =   405 bits (1040),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDP+IKANDTVKLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPVIKANDTVKLDLEANKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+HIQDA GHEFATRLGNVF I
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHIQDAQGHEFATRLGNVFII  228



>gb|ACV70143.1| putative 40S ribosomal protein S4 [Jatropha curcas]
Length=264

 Score =   405 bits (1040),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/228 (93%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRL YALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLPYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLV GKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVVGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATG EFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGPEFATRLGNVFTI  228



>ref|XP_009120350.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   404 bits (1039),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_007050962.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOX95119.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   404 bits (1039),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDAAGHEFATRLGNVFTI  228



>emb|CDY57385.1| BnaCnng31910D [Brassica napus]
Length=298

 Score =   406 bits (1043),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  37   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  96

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  97   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  156

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  157  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  216

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  217  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  264



>gb|KHN00473.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=296

 Score =   405 bits (1042),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/227 (92%), Positives = 224/227 (99%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  34   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  93

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            I+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAKF
Sbjct  94   IAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAKF  153

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVV
Sbjct  154  KLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVV  213

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATR+GNVFTI
Sbjct  214  MVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTI  260



>ref|XP_007026596.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOY07098.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   404 bits (1039),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDAAGHEFATRLGNVFTI  228



>emb|CDY32986.1| BnaA10g11920D [Brassica napus]
Length=288

 Score =   405 bits (1041),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  27   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  86

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  87   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  146

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  147  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  206

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  207  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  254



>emb|CDY14056.1| BnaC02g01730D [Brassica napus]
Length=291

 Score =   405 bits (1041),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/234 (89%), Positives = 226/234 (97%), Gaps = 0/234 (0%)
 Frame = +2

Query  59   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  238
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  24   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  83

Query  239  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  418
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+
Sbjct  84   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSL  143

Query  419  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIK  598
            RDEEAKFKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIK
Sbjct  144  RDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIK  203

Query  599  FDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            FDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  204  FDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  257



>ref|XP_010023674.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis]
 gb|KCW60003.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=264

 Score =   404 bits (1038),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+H+QD+ GHEFATRLGNV+ I
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHVQDSQGHEFATRLGNVYMI  228



>gb|KFK36724.1| hypothetical protein AALP_AA4G161500 [Arabis alpina]
Length=262

 Score =   404 bits (1038),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTI  228



>ref|XP_004492491.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=264

 Score =   404 bits (1038),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FETVH+QDATG+EFATRL NVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETVHVQDATGNEFATRLSNVFTI  228



>ref|XP_009132054.1| PREDICTED: 40S ribosomal protein S4-2-like [Brassica rapa]
Length=262

 Score =   404 bits (1038),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>emb|CDY05015.1| BnaAnng01970D [Brassica napus]
Length=305

 Score =   405 bits (1042),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/234 (89%), Positives = 226/234 (97%), Gaps = 0/234 (0%)
 Frame = +2

Query  59   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  238
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  38   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  97

Query  239  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  418
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  98   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  157

Query  419  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIK  598
            RDEEAKFKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIK
Sbjct  158  RDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIK  217

Query  599  FDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            FDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  218  FDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  271



>ref|XP_008789926.1| PREDICTED: 40S ribosomal protein S4-1 isoform X2 [Phoenix dactylifera]
Length=263

 Score =   404 bits (1037),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIK+NDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATR+GNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTV  228



>gb|KHG30713.1| 40S ribosomal S4 [Gossypium arboreum]
Length=268

 Score =   404 bits (1038),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/233 (89%), Positives = 225/233 (97%), Gaps = 0/233 (0%)
 Frame = +2

Query  62   QLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYA  241
            QL   +ARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYA
Sbjct  2    QLLGFLARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYA  61

Query  242  LTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIR  421
            LTYREVI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I 
Sbjct  62   LTYREVIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAIS  121

Query  422  DEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKF  601
             +E KFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKF
Sbjct  122  GDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKF  181

Query  602  DvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            DVGNVVMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  182  DVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  234



>ref|XP_006352979.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   404 bits (1037),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  LKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG++KNREKHKGSFETVHIQD+ GHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGILKNREKHKGSFETVHIQDSLGHEFATRLGNVFTL  228



>gb|KDO67004.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=272

 Score =   404 bits (1038),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 224/235 (95%), Gaps = 7/235 (3%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  -------FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFI  595
                   FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FI
Sbjct  121  ALILLFQFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFI  180

Query  596  KFDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            KFDVGNVVMVTGGRNRGRVG+IKNREKHKGSFET+HIQDA GHEFATRLGNVFTI
Sbjct  181  KFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTI  235



>ref|XP_008356229.1| PREDICTED: 40S ribosomal protein S4-3-like [Malus domestica]
Length=269

 Score =   404 bits (1038),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 207/232 (89%), Positives = 226/232 (97%), Gaps = 0/232 (0%)
 Frame = +2

Query  65   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  244
            ++  +ARGLKKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPLVLI+RNRLKYAL
Sbjct  1    MTEDLARGLKKHLKRLNAPKHWMLDKLGGXFAPKPSSGPHKARECLPLVLILRNRLKYAL  60

Query  245  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  424
            TYREV+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRD
Sbjct  61   TYREVVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRD  120

Query  425  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  604
            EEAKFKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFD
Sbjct  121  EEAKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFD  180

Query  605  vgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VGNVVMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDALGHEFATRLGNVFTI  232



>ref|XP_011046165.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   403 bits (1036),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTI  228



>ref|XP_010036744.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW88215.1| hypothetical protein EUGRSUZ_A00608 [Eucalyptus grandis]
Length=264

 Score =   403 bits (1036),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG+IKNREKHKG+FET+H+QD+ GHEFATRLGNVF I
Sbjct  181  VMVTGGRNRGRVGIIKNREKHKGTFETIHVQDSLGHEFATRLGNVFII  228



>ref|XP_002463552.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
 gb|EER90550.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
Length=264

 Score =   403 bits (1036),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++D+ GH+FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTI  228



>ref|NP_001266498.1| 40S ribosomal protein S4 [Zea mays]
 sp|O22424.1|RS4_MAIZE RecName: Full=40S ribosomal protein S4 [Zea mays]
 gb|AAB66899.1| ribosomal protein S4 type I [Zea mays]
 gb|ACF83328.1| unknown [Zea mays]
 gb|ACG30922.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG34655.1| 40S ribosomal protein S4 [Zea mays]
 gb|AFW67028.1| putative ribosomal protein S4 (RPS4A) family protein [Zea mays]
Length=265

 Score =   403 bits (1036),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++D+ GH+FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTI  228



>ref|XP_011023749.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   403 bits (1036),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 226/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKG+FET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVFTI  228



>ref|XP_003611879.1| 40S ribosomal protein S4 [Medicago truncatula]
 ref|XP_003628299.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|ACJ85463.1| unknown [Medicago truncatula]
 gb|AES94837.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AET02775.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK34966.1| unknown [Medicago truncatula]
 gb|AFK42812.1| unknown [Medicago truncatula]
 gb|KEH27546.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=265

 Score =   403 bits (1036),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+I+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGG+NRGRVGVIKNREKHKG+FET+H+QDATGHEFATRL NVFTI
Sbjct  181  VMVTGGKNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLVNVFTI  228



>ref|XP_003623356.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES79574.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK36229.1| unknown [Medicago truncatula]
Length=265

 Score =   403 bits (1036),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG IKNR+KH G+FET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGFIKNRKKHMGTFETIHVQDAAGHEFATRLGNVFTI  228



>gb|KJB71672.1| hypothetical protein B456_011G136800 [Gossypium raimondii]
Length=262

 Score =   403 bits (1035),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|XP_009125675.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   403 bits (1035),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_002322175.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
 gb|EEF06302.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
Length=263

 Score =   403 bits (1035),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VD+IKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDYIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  228



>gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea]
Length=262

 Score =   403 bits (1035),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 208/227 (92%), Positives = 222/227 (98%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEEAKF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEEAKF  120

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNV+
Sbjct  121  KLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIADFIKFDVGNVI  180

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRNRGRVGVIK+REKHKG+FET+H+QDATGHEFATRLGNVF I
Sbjct  181  MVTGGRNRGRVGVIKSREKHKGTFETIHVQDATGHEFATRLGNVFII  227



>gb|KHG02126.1| 40S ribosomal S4 [Gossypium arboreum]
 gb|KJB36904.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
 gb|KJB77062.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=262

 Score =   403 bits (1035),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|XP_010666843.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   402 bits (1034),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYAL YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR+VQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+ GHEFATR+GNVF I
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSQGHEFATRMGNVFII  228



>gb|EPS70681.1| hypothetical protein M569_04077, partial [Genlisea aurea]
Length=256

 Score =   402 bits (1033),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 208/227 (92%), Positives = 222/227 (98%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEE+KF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEESKF  120

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+VDFIKFDVGNVV
Sbjct  121  KLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFIKFDVGNVV  180

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRNRGRVG+IKNREKHKG+FET+H+QDA GHEFATRLGNVF I
Sbjct  181  MVTGGRNRGRVGIIKNREKHKGTFETIHVQDAAGHEFATRLGNVFII  227



>ref|XP_002455614.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
 gb|EES00734.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
Length=265

 Score =   402 bits (1034),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++DA GH FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHAFATRMGNVFTI  228



>gb|KJB37999.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=262

 Score =   402 bits (1033),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K DLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|XP_010685909.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   402 bits (1033),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYAL YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR+VQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+ GHEFATR+GNVF I
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSQGHEFATRMGNVFII  228



>gb|KFK27370.1| hypothetical protein AALP_AA8G374100 [Arabis alpina]
Length=262

 Score =   402 bits (1032),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_008789925.1| PREDICTED: 40S ribosomal protein S4-1 isoform X1 [Phoenix dactylifera]
Length=319

 Score =   404 bits (1038),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 225/228 (99%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIK+NDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATR+GNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHLQDALGHEFATRIGNVFTV  228



>ref|XP_006646768.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   402 bits (1032),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL SI+DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSIKDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++DA GH+FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDAQGHQFATRLGNVFTI  228



>emb|CDY69841.1| BnaAnng31720D [Brassica napus]
Length=311

 Score =   404 bits (1037),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  247
            +  MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT
Sbjct  47   TPNMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  106

Query  248  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  427
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSIRDE
Sbjct  107  YREVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDE  166

Query  428  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDv  607
            EAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE NK+V+FIKFDV
Sbjct  167  EAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFIKFDV  226

Query  608  gnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            GNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  227  GNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  277



>gb|KFK25102.1| hypothetical protein AALP_AA8G066400 [Arabis alpina]
Length=262

 Score =   401 bits (1031),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>gb|KHG26321.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   401 bits (1031),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVNFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|NP_001045624.1| Os02g0105900 [Oryza sativa Japonica Group]
 sp|P49398.3|RS4_ORYSJ RecName: Full=40S ribosomal protein S4; AltName: Full=SCAR protein 
SS620 [Oryza sativa Japonica Group]
 pdb|3J60|E Chain E, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD28085.1| putative ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF07538.1| Os02g0105900 [Oryza sativa Japonica Group]
 gb|EAY84111.1| hypothetical protein OsI_05494 [Oryza sativa Indica Group]
 gb|EAZ21423.1| hypothetical protein OsJ_05027 [Oryza sativa Japonica Group]
 gb|ACA50490.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAG96339.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95549.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86872.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=265

 Score =   401 bits (1031),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++DA GH+FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTI  228



>gb|KHG02041.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   401 bits (1030),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGLKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|XP_004960263.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=265

 Score =   401 bits (1030),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  TKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++DA GH+FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTI  228



>emb|CDX81032.1| BnaC03g02860D [Brassica napus]
Length=279

 Score =   401 bits (1031),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 210/227 (93%), Positives = 221/227 (97%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKF  138

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVR++Q G+KGIPF+NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNVV
Sbjct  139  KLCKVRTIQLGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNVV  198

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  199  MVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  245



>ref|NP_001043015.1| Os01g0358400 [Oryza sativa Japonica Group]
 dbj|BAD52963.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF04929.1| Os01g0358400 [Oryza sativa Japonica Group]
 gb|EAY74000.1| hypothetical protein OsI_01884 [Oryza sativa Indica Group]
 gb|EAZ11863.1| hypothetical protein OsJ_01737 [Oryza sativa Japonica Group]
 gb|ABR25672.1| 40S ribosomal protein S4 [Oryza sativa Indica Group]
 dbj|BAG88133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   400 bits (1029),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++DA GH FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHAFATRLGNVFTI  228



>ref|XP_010087529.1| 40S ribosomal protein S4 [Morus notabilis]
 gb|EXB29260.1| 40S ribosomal protein S4 [Morus notabilis]
Length=318

 Score =   403 bits (1035),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/242 (88%), Positives = 225/242 (93%), Gaps = 15/242 (6%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  41   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  100

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFM---------------DVVSIPKTNENFRLFYDTK  394
            ISILMQRHVLVDGKVRTDKTYP+GFM               DVVSIPKTNENFRL YDTK
Sbjct  101  ISILMQRHVLVDGKVRTDKTYPSGFMVQVVVFFESNVTLVTDVVSIPKTNENFRLLYDTK  160

Query  395  GRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLES  574
            GRFRLHSIRD+EAKFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLES
Sbjct  161  GRFRLHSIRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLES  220

Query  575  NKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVF  754
            NK+ DFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKG+FET+H+QDATGHEFATRLGNVF
Sbjct  221  NKITDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHVQDATGHEFATRLGNVF  280

Query  755  TI  760
            TI
Sbjct  281  TI  282



>ref|XP_009130977.1| PREDICTED: 40S ribosomal protein S4-1-like [Brassica rapa]
Length=262

 Score =   400 bits (1028),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VIS LMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISSLMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNV
Sbjct  121  FKLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>ref|XP_006645886.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=285

 Score =   401 bits (1030),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/232 (88%), Positives = 223/232 (96%), Gaps = 0/232 (0%)
 Frame = +2

Query  65   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  244
            L T  ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL
Sbjct  17   LGTDAARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYAL  76

Query  245  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  424
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++D
Sbjct  77   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKD  136

Query  425  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  604
            E+AKFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFD
Sbjct  137  EDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFD  196

Query  605  vgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VGNVVMVTGGRN GRVGVIKNREKHKGSFET+H++D+ GH FATRLGNVFTI
Sbjct  197  VGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHAFATRLGNVFTI  248



>ref|XP_006851828.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
 gb|ERN13295.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
Length=268

 Score =   400 bits (1028),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/232 (88%), Positives = 225/232 (97%), Gaps = 0/232 (0%)
 Frame = +2

Query  65   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  244
            ++ T ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKYAL
Sbjct  1    MAKTWARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYAL  60

Query  245  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  424
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS++D
Sbjct  61   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVKD  120

Query  425  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  604
            EEAKFKLCKVRSVQFG+K IP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFD
Sbjct  121  EEAKFKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFD  180

Query  605  vgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VGNVVMVTGGRNRGRVG+IK+RE+HKGSF+ +HI+DA  HEFATRLGNVFTI
Sbjct  181  VGNVVMVTGGRNRGRVGLIKSRERHKGSFDIIHIEDAAKHEFATRLGNVFTI  232



>ref|XP_009122377.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  228



>emb|CDX99006.1| BnaC09g48290D [Brassica napus]
Length=288

 Score =   400 bits (1028),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  27   MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  86

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  87   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  146

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  147  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  206

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  207  VMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  254



>emb|CDY58877.1| BnaA03g55550D [Brassica napus]
Length=279

 Score =   400 bits (1027),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/227 (92%), Positives = 221/227 (97%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKF  138

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNVV
Sbjct  139  KLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNVV  198

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  199  MVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  245



>sp|P46299.1|RS4_GOSHI RecName: Full=40S ribosomal protein S4 [Gossypium hirsutum]
 emb|CAA55882.1| ribosomal protein, small subunit 4e (RS4e) [Gossypium hirsutum]
 gb|KJB17110.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=262

 Score =   399 bits (1026),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>gb|AAS48726.1| ribosomal protein S4 [Zea mays]
Length=265

 Score =   399 bits (1024),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP IKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPPIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGS ET+H++D+ GH+FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSLETIHVEDSLGHQFATRMGNVFTI  228



>ref|XP_006644163.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   398 bits (1023),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNKLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKGSFET+H++D+ GH FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHAFATRLGNVFTI  228



>ref|XP_004962295.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=262

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIPF+NTYDGRTIRYPDPLIKANDT+K+DL++NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLDTNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIK+REKHKGSFET+H++D+ GH+FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKSREKHKGSFETIHVEDSLGHQFATRMGNVFTI  228



>ref|XP_002439678.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
 gb|EES18108.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
Length=263

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FK+CKVRSVQFG+KGIPF+NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKMCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIK+REKHKGSFET+H++D+ GH+FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKSREKHKGSFETIHVEDSLGHQFATRMGNVFTI  228



>ref|XP_007141735.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 ref|XP_007141738.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
 gb|ESW13729.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 gb|ESW13732.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
Length=264

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 224/228 (98%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKV+SVQFG+KGIP++NT+DGRTIRYPDP+I+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVKSVQFGQKGIPYLNTFDGRTIRYPDPVIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIK+RE+ KGSF+T+H+QDATGHEFATRL NVFTI
Sbjct  181  VMVTGGRNRGRVGVIKSRERQKGSFDTIHVQDATGHEFATRLANVFTI  228



>emb|CDX70008.1| BnaA10g23570D [Brassica napus]
Length=269

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 207/234 (88%), Positives = 222/234 (95%), Gaps = 0/234 (0%)
 Frame = +2

Query  59   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  238
            ++     ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  2    SECKILQARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  61

Query  239  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  418
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  62   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  121

Query  419  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIK  598
            RDEEAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IK
Sbjct  122  RDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIK  181

Query  599  FDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            FDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  182  FDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVFTL  235



>gb|AGZ15374.1| 40S ribosomal S4 protein [Phaseolus vulgaris]
Length=264

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGV K+R K+KGSFET+H+Q+ATGHE AT LGNVFTI
Sbjct  181  VMVTGGRNRGRVGVFKSRNKNKGSFETIHVQEATGHEIATCLGNVFTI  228



>dbj|BAJ94984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49926.1| 40S ribosomal protein S4 [Triticum urartu]
 gb|EMT30796.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=265

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKG+FET+H++DA GH+FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTI  228



>emb|CDY02821.1| BnaC02g10680D [Brassica napus]
Length=275

 Score =   397 bits (1019),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 222/231 (96%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  247
            + TM RGLKKH+KRLNAPK W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALT
Sbjct  14   TPTMTRGLKKHLKRLNAPKIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALT  73

Query  248  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  427
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DE
Sbjct  74   YREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDE  133

Query  428  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDv  607
            EAKFKLCKVR++ FG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVV+FIKFDV
Sbjct  134  EAKFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFIKFDV  193

Query  608  gnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            GNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+
Sbjct  194  GNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTL  244



>ref|NP_001055342.1| Os05g0368300 [Oryza sativa Japonica Group]
 dbj|BAF17256.1| Os05g0368300 [Oryza sativa Japonica Group]
Length=263

 Score =   395 bits (1016),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AK
Sbjct  61   VISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+
Sbjct  121  FKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIK+REKHKGSFET+H++DA GH+FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTI  228



>gb|KJB29915.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=262

 Score =   394 bits (1013),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MTRGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|NP_001288485.1| 40S ribosomal protein S4-like [Zea mays]
 gb|AAB67831.1| ribsomal protein S4 [Zea mays]
 gb|ACF87994.1| unknown [Zea mays]
 gb|ACG25377.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG45984.1| 40S ribosomal protein S4 [Zea mays]
 tpg|DAA52405.1| TPA: ribosomal protein S4 [Zea mays]
Length=265

 Score =   394 bits (1013),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTMENYRLLYDTKGRFRLHPIRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK++DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIMDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKG F+T+H++D+ GH+FATR+GNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGGFDTIHVEDSMGHQFATRMGNVFTI  228



>emb|CDY32700.1| BnaA02g07620D [Brassica napus]
Length=301

 Score =   395 bits (1016),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 206/229 (90%), Positives = 220/229 (96%), Gaps = 0/229 (0%)
 Frame = +2

Query  74   TMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR  253
            TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYR
Sbjct  42   TMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYR  101

Query  254  EVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEA  433
            EVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI+DEEA
Sbjct  102  EVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDEEA  161

Query  434  KFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgn  613
            KFKLCKVR++ FG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVV+FIKFDVGN
Sbjct  162  KFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFIKFDVGN  221

Query  614  vvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VVMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+
Sbjct  222  VVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTL  270



>ref|XP_003568916.1| PREDICTED: 40S ribosomal protein S4 [Brachypodium distachyon]
Length=265

 Score =   394 bits (1012),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR +LVDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE++K
Sbjct  61   VQSILMQRQILVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDSK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKG+FET+H++DA GH+FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTI  228



>dbj|BAD22763.1| ribosomal protein [Bromus inermis]
Length=265

 Score =   393 bits (1010),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG+KGIP++NT DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTNDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVIKNREKHKG+FET+H++DA GH+FATRLGNVFTI
Sbjct  181  VMVTGGRNTGRVGVIKNREKHKGTFETIHVEDAQGHQFATRLGNVFTI  228



>gb|KHG30303.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   393 bits (1009),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHV+VDGKVRTDKTYP GFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPTGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+K IP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIK REKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKKREKHKGSFETIHVQDAAGHEFATRLGNVFTI  228



>ref|XP_009781828.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=259

 Score =   392 bits (1006),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 219/228 (96%), Gaps = 5/228 (2%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPK+WMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKYWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS     AK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS-----AK  115

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  116  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  175

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDA GHEFATRLGNVFT+
Sbjct  176  VMVTGGRNRGRVGVIKNREKHKGSFETVHIQDALGHEFATRLGNVFTL  223



>gb|EAY97774.1| hypothetical protein OsI_19685 [Oryza sativa Indica Group]
Length=279

 Score =   392 bits (1006),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREV
Sbjct  18   ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  77

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKF
Sbjct  78   ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  137

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK++DFIKFDVGNVV
Sbjct  138  KLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIMDFIKFDVGNVV  197

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRN GRVGVIK+REKHKGSFET+H++DA GH+FATR+GNVFTI
Sbjct  198  MVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTI  244



>ref|XP_009126753.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Brassica 
rapa]
Length=319

 Score =   391 bits (1005),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/231 (89%), Positives = 220/231 (95%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  247
            + TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALT
Sbjct  58   TPTMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALT  117

Query  248  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  427
            YREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI+DE
Sbjct  118  YREVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDE  177

Query  428  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDv  607
            EAKFKLCKVR++ FG+KGIP++NTYDGR IRYPDPLIK NDT+KLDLE NKVV+FIKFDV
Sbjct  178  EAKFKLCKVRTISFGQKGIPYLNTYDGRPIRYPDPLIKPNDTIKLDLEENKVVEFIKFDV  237

Query  608  gnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            GNVVMVTGGRNRGRVGVIKNREKHKGSFET+HIQDATGHEFATRLGNVFT+
Sbjct  238  GNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTL  288



>gb|EEE63465.1| hypothetical protein OsJ_18278 [Oryza sativa Japonica Group]
Length=398

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = +2

Query  80   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  259
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREV
Sbjct  137  ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  196

Query  260  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  439
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKF
Sbjct  197  ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  256

Query  440  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvv  619
            KLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+V
Sbjct  257  KLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIV  316

Query  620  mvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            MVTGGRN GRVGVIK+REKHKGSFET+H++DA GH+FATR+GNVFTI
Sbjct  317  MVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTI  363



>sp|O81363.1|RS4_PRUAR RecName: Full=40S ribosomal protein S4 [Prunus armeniaca]
 gb|AAC24585.1| 40S ribosomal protein S4 [Prunus armeniaca]
Length=261

 Score =   381 bits (979),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 216/228 (95%), Gaps = 4/228 (2%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V+SILMQRH+LVDGK+     +     DVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKIH----FCIRLSDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  116

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  117  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  176

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIKNREKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  177  VMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTI  224



>gb|EMT14698.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=259

 Score =   378 bits (970),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWM++KLGGAFAPKPSSGPHK+RECLPL+L++RNRLKYALTY E
Sbjct  1    MARGLKKHVKRLNAPKHWMVEKLGGAFAPKPSSGPHKARECLPLILMLRNRLKYALTYSE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V+SI+MQRH++VDGKVRTDKTYPAGFMDVVSIPKT ENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VVSIMMQRHIMVDGKVRTDKTYPAGFMDVVSIPKTGENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR+VQ G+KG+P +NTYDGRTIRYPDP IK NDT+K+DLE+NK+VDFIKF+VGN 
Sbjct  121  FKLCKVRTVQCGQKGVPSLNTYDGRTIRYPDPAIKPNDTIKIDLETNKIVDFIKFEVGNF  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GR+GVIK+RE+H+GSFET+H++DA GH+FATRL NVF+I
Sbjct  181  VMVTGGRNTGRIGVIKSRERHEGSFETIHVEDALGHQFATRLANVFSI  228



>ref|XP_008778562.1| PREDICTED: 40S ribosomal protein S4-3-like [Phoenix dactylifera]
Length=247

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/210 (93%), Positives = 209/210 (99%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H+QDATGHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHLQDATGHEFATRLGNVFTI  210



>emb|CDP06439.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   375 bits (963),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/210 (93%), Positives = 207/210 (99%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVISILMQRH+LVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVISILMQRHILVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H+QDATGHEFATRLGNVF I
Sbjct  181  EKHKGSFETIHVQDATGHEFATRLGNVFII  210



>gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja]
Length=246

 Score =   374 bits (959),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/210 (93%), Positives = 207/210 (99%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDTVKLDLESNK+ DFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTVKLDLESNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H+QDATGHEFATR+GNVF I
Sbjct  181  EKHKGSFETIHVQDATGHEFATRMGNVFII  210



>gb|KDO67006.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=247

 Score =   372 bits (956),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 195/210 (93%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVD KVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNVVMVTGGRNRGRVG+IKNR
Sbjct  121  INTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+HIQDA GHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHIQDALGHEFATRLGNVFTI  210



>emb|CBI15899.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   372 bits (955),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/210 (93%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EK KGSFET+H+QDATGHEFATRLGNVF I
Sbjct  181  EKRKGSFETIHVQDATGHEFATRLGNVFII  210



>gb|KDO63242.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=244

 Score =   372 bits (955),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGRVG+IKNR
Sbjct  121  INTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+HIQDA GHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHIQDALGHEFATRLGNVFTI  210



>ref|XP_009126752.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Brassica 
rapa]
Length=348

 Score =   375 bits (964),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/260 (79%), Positives = 220/260 (85%), Gaps = 29/260 (11%)
 Frame = +2

Query  68   STTMARGLKKHMKRLNAPKHWMLDKLGGAF-----------------------------A  160
            + TMARGLKKH+KRLNAP  W LDKLGGAF                             A
Sbjct  58   TPTMARGLKKHLKRLNAPTIWGLDKLGGAFVCLLVSLYTHAFHLFIVWMTMLARIGSKQA  117

Query  161  PKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMD  340
            PKPSSGPHKSRECLPLVLIIRN+LKYALTYREVI+ILMQRH+ VDGKVRTDKTYPAGFMD
Sbjct  118  PKPSSGPHKSRECLPLVLIIRNKLKYALTYREVIAILMQRHIQVDGKVRTDKTYPAGFMD  177

Query  341  VVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIR  520
            VVSIPKTNE FRL YDTKGRFRLHSI+DEEAKFKLCKVR++ FG+KGIP++NTYDGR IR
Sbjct  178  VVSIPKTNECFRLLYDTKGRFRLHSIKDEEAKFKLCKVRTISFGQKGIPYLNTYDGRPIR  237

Query  521  YPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFETV  700
            YPDPLIK NDT+KLDLE NKVV+FIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET+
Sbjct  238  YPDPLIKPNDTIKLDLEENKVVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETI  297

Query  701  HIQDATGHEFATRLGNVFTI  760
            HIQDATGHEFATRLGNVFT+
Sbjct  298  HIQDATGHEFATRLGNVFTL  317



>emb|CBI25428.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   371 bits (953),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/210 (92%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHIFVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKG+FET+HIQDATGHEFATRLGNVF I
Sbjct  181  EKHKGTFETIHIQDATGHEFATRLGNVFII  210



>gb|ABK21170.1| unknown [Picea sitchensis]
 gb|ABK22318.1| unknown [Picea sitchensis]
 gb|ABR17884.1| unknown [Picea sitchensis]
Length=263

 Score =   371 bits (953),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI+DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG KGIP++NTYDGRTIRYPDPL+KANDT+K+DLE+ K+ +FIKFDVGNV
Sbjct  121  YKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKIDLETGKIKEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVGVIK+REKHKGSFE +H+QDA G EFATR GNVFTI
Sbjct  181  VMVTGGRNRGRVGVIKHREKHKGSFEIIHVQDAAGQEFATRQGNVFTI  228



>dbj|BAB10257.1| ribosomal protein S4 [Arabidopsis thaliana]
Length=244

 Score =   370 bits (951),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 207/210 (99%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+HIQD+TGHEFATRLGNV+TI
Sbjct  181  EKHKGSFETIHIQDSTGHEFATRLGNVYTI  210



>gb|ABK22322.1| unknown [Picea sitchensis]
 gb|ABK22679.1| unknown [Picea sitchensis]
 gb|ACN39835.1| unknown [Picea sitchensis]
 gb|ACN40504.1| unknown [Picea sitchensis]
 gb|ACN40833.1| unknown [Picea sitchensis]
Length=263

 Score =   371 bits (952),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI+DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRSVQFG KGIP++NTYDGRTIRYPDPL+KANDT+K+DLE+ K+ +FIKFDVGNV
Sbjct  121  YKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKVDLETGKIKEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            +MVTGGRNRGRVGVIK+REKHKGSFE +H+QDA G EFATR GNVFTI
Sbjct  181  IMVTGGRNRGRVGVIKHREKHKGSFEIIHVQDAAGQEFATRQGNVFTI  228



>ref|NP_001031846.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 gb|AED91108.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=244

 Score =   370 bits (949),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+HIQD+TGHEFATRLGNV+TI
Sbjct  181  EKHKGSFETIHIQDSTGHEFATRLGNVYTI  210



>ref|XP_010509192.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=244

 Score =   370 bits (949),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 207/210 (99%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSIQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+HIQD+TGHEFATRLGNVFT+
Sbjct  181  EKHKGSFETIHIQDSTGHEFATRLGNVFTL  210



>gb|KHG11751.1| 40S ribosomal S4 [Gossypium arboreum]
Length=244

 Score =   367 bits (941),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHVQDAAGHEFATRLGNVFTI  210



>gb|KFK40122.1| hypothetical protein AALP_AA3G333200 [Arabis alpina]
Length=216

 Score =   366 bits (939),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 193/210 (92%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIR+RLKYALTY EVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRDRLKYALTYSEVISILMQRHIQVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSIQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+HIQD+TGHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHIQDSTGHEFATRLGNVFTI  210



>gb|KJB77064.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=244

 Score =   365 bits (938),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHVQDAAGHEFATRLGNVFTI  210



>gb|KJB38000.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=244

 Score =   365 bits (937),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFGRKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+K DLESNK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHVQDAAGHEFATRLGNVFTI  210



>ref|NP_001235428.1| uncharacterized protein LOC100500000 [Glycine max]
 gb|ACU14556.1| unknown [Glycine max]
Length=205

 Score =   362 bits (928),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSF  691
            VMVTGGRNRGRVGVIKNREKHKG  
Sbjct  181  VMVTGGRNRGRVGVIKNREKHKGKL  205



>gb|KJB29916.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=244

 Score =   359 bits (921),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETKFKLCKVRSVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H+QDA GHEFATRLGNVFTI
Sbjct  181  EKHKGSFETIHVQDAAGHEFATRLGNVFTI  210



>gb|AAT38019.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=245

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREVISILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVISILMQRHVMVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKFKLCKVRSVQFG+KGIPF
Sbjct  61   DKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKFKLCKVRSVQFGQKGIPF  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+VMVTGGRN GRVGVIK+R
Sbjct  121  LNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIVMVTGGRNTGRVGVIKSR  180

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            EKHKGSFET+H++DA GH+FATR+GNVFTI
Sbjct  181  EKHKGSFETIHVEDALGHQFATRMGNVFTI  210



>ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine 
max]
Length=248

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = +2

Query  152  AFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAG  331
            + APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPAG
Sbjct  10   SLAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAG  69

Query  332  FMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGR  511
            FMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+KFKLCKVRSVQFG+KGIP++NTYDGR
Sbjct  70   FMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGIPYLNTYDGR  129

Query  512  TIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSF  691
            TIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSF
Sbjct  130  TIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSF  189

Query  692  ETVHIQDATGHEFATRLGNVFTI  760
            ET+H+QDATGHEFATR+GNVF I
Sbjct  190  ETIHVQDATGHEFATRMGNVFII  212



>ref|XP_001780588.1| predicted protein [Physcomitrella patens]
 gb|EDQ54571.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   356 bits (914),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGR+GVI++REKHKGSF+ +H+ D+TG++FATR+GNVFTI
Sbjct  181  VMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDSTGNQFATRMGNVFTI  228



>ref|XP_001759850.1| predicted protein [Physcomitrella patens]
 gb|EDQ75354.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   356 bits (913),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGR+GVI++REKHKGSF+ +H+ D+TG +FATR+GNVFT+
Sbjct  181  VMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDSTGQQFATRMGNVFTV  228



>ref|XP_001751877.1| predicted protein [Physcomitrella patens]
 gb|EDQ83312.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   355 bits (912),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGR+GVI++REKHKGSF+ +H+ DATG +FATR+GNVFT+
Sbjct  181  VMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDATGQQFATRMGNVFTV  228



>gb|KDO63240.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=284

 Score =   356 bits (913),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = +2

Query  149  GAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPA  328
            G  APKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPA
Sbjct  47   GLQAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPA  106

Query  329  GFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDG  508
            GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+INTYDG
Sbjct  107  GFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDG  166

Query  509  RTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGS  688
            RTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGS
Sbjct  167  RTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGS  226

Query  689  FETVHIQDATGHEFATRLGNVFTI  760
            FET+HIQDA GHEFATRLGNVFTI
Sbjct  227  FETIHIQDALGHEFATRLGNVFTI  250



>ref|XP_001759591.1| predicted protein [Physcomitrella patens]
 gb|EDQ75503.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGR+GVI++REKHKGSF+ +H+ D+TG +FATR+GNVFT+
Sbjct  181  VMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDSTGQQFATRMGNVFTV  228



>gb|KDO63241.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=254

 Score =   353 bits (907),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = +2

Query  158  APKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFM  337
            APKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPAGFM
Sbjct  20   APKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFM  79

Query  338  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  517
            DVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+INTYDGRTI
Sbjct  80   DVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTI  139

Query  518  RYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFET  697
            RYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFET
Sbjct  140  RYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFET  199

Query  698  VHIQDATGHEFATRLGNVFTI  760
            +HIQDA GHEFATRLGNVFTI
Sbjct  200  IHIQDALGHEFATRLGNVFTI  220



>gb|KCW60004.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=215

 Score =   352 bits (902),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  604
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLE+NK+ DFIKFD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFIKFD  176



>ref|XP_001766039.1| predicted protein [Physcomitrella patens]
 gb|EDQ69098.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFDVGN+
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDVGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGR+GVI +REKHKGSF+ +H+ DATG++FATR+GNV+TI
Sbjct  181  VMVTGGRNRGRIGVIHHREKHKGSFDIIHVTDATGNQFATRMGNVYTI  228



>ref|XP_001785339.1| predicted protein [Physcomitrella patens]
 gb|EDQ49851.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVR+ QFG KG+P + T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRAAQFGDKGVPHVTTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGR+GVI +REKHKGSF+ +H+ DA G++FATR+GNVFTI
Sbjct  181  VMVTGGRNRGRIGVIHHREKHKGSFDIIHVTDAIGNQFATRMGNVFTI  228



>ref|NP_001189539.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AEC06617.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=184

 Score =   346 bits (887),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  604
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFD  176



>gb|KJB77063.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=251

 Score =   348 bits (893),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  155  FAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGF  334
            +APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRTDKTYPAGF
Sbjct  16   YAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGF  75

Query  335  MDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRT  514
            MDVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRT
Sbjct  76   MDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRT  135

Query  515  IRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFE  694
            IRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFE
Sbjct  136  IRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFE  195

Query  695  TVHIQDATGHEFATRLGNVFTI  760
            T+H+QDA GHEFATRLGNVFTI
Sbjct  196  TIHVQDAAGHEFATRLGNVFTI  217



>gb|KJB36905.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
Length=237

 Score =   347 bits (891),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = +2

Query  158  APKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFM  337
            APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRTDKTYPAGFM
Sbjct  3    APKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFM  62

Query  338  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  517
            DVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRTI
Sbjct  63   DVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTI  122

Query  518  RYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFET  697
            RYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET
Sbjct  123  RYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET  182

Query  698  VHIQDATGHEFATRLGNVFTI  760
            +H+QDA GHEFATRLGNVFTI
Sbjct  183  IHVQDAAGHEFATRLGNVFTI  203



>gb|KJB17112.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=237

 Score =   344 bits (882),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = +2

Query  158  APKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFM  337
            APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRTDKTYPAGFM
Sbjct  3    APKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFM  62

Query  338  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  517
            DVVSIPKTNE+FRL YDTKGRF LH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRTI
Sbjct  63   DVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTI  122

Query  518  RYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFET  697
            RYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET
Sbjct  123  RYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFET  182

Query  698  VHIQDATGHEFATRLGNVFTI  760
            +H+QDA GHEFATRLGNVFTI
Sbjct  183  IHVQDAAGHEFATRLGNVFTI  203



>ref|XP_002984314.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
 gb|EFJ14824.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
Length=258

 Score =   341 bits (874),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL YALTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINSEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR+V+FG KGIPF+ TYDGRTIRYPDPLIKANDT+K+DLE+ K+ +FIKFDVGN+
Sbjct  121  FKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFIKFDVGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG I++REKHKGSF+ +HI+D+ G +FATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGTIQHREKHKGSFDIIHIKDSVGQDFATRMGNVFTI  228



>ref|XP_002972484.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
 gb|EFJ26570.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
Length=258

 Score =   341 bits (874),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL YALTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            FKLCKVR+V+FG KGIPF+ TYDGRTIRYPDPLIKANDT+K+DLE+ K+ +FIKFDVGNV
Sbjct  121  FKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFIKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRNRGRVG I++REKHKGSF+ +HI+D+ G +FATR+GNVFTI
Sbjct  181  VMVTGGRNRGRVGTIQHREKHKGSFDIIHIKDSVGQDFATRMGNVFTI  228



>ref|XP_005850141.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
 gb|EFN58039.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
Length=261

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKH+KRLNAPKHWMLDKLGG FAPKPS GPHK+RECLPL+L++RNRLKYALT +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLGGIFAPKPSPGPHKTRECLPLILLLRNRLKYALTGKE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTDKTYP GFMDV+ IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VTSILMQRLVEVDGKVRTDKTYPVGFMDVIDIPKTDEHFRLVYDAKGRFVVHRITKEEAS  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ + FGK GIP I T+DGRT+RYPDP IK NDTV LDLES KV DFIKFDVGN+
Sbjct  121  YKLCKVKRLAFGKGGIPHIGTHDGRTVRYPDPEIKVNDTVMLDLESGKVKDFIKFDVGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             M TGG N GRVG I ++EKHKGSF+ VHI+DA GH FATR+ NVF I
Sbjct  181  AMATGGHNNGRVGTIVHKEKHKGSFDIVHIKDAAGHTFATRMTNVFVI  228



>emb|CBI18118.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 167/210 (80%), Gaps = 41/210 (20%)
 Frame = +2

Query  131  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  310
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  311  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  490
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKV+ VQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVKGVQFGQKGIPY  120

Query  491  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnvvmvtggrnrgrvgvIKNR  670
            +NTYDGRTIRYPDPLIKANDT                                       
Sbjct  121  LNTYDGRTIRYPDPLIKANDT---------------------------------------  141

Query  671  EKHKGSFETVHIQDATGHEFATRLGNVFTI  760
              HKG+FET+H+QDATGHEFATRLGNVFTI
Sbjct  142  --HKGTFETIHVQDATGHEFATRLGNVFTI  169



>gb|EIE83303.1| 40S ribosomal protein S4 [Rhizopus delemar RA 99-880]
Length=263

 Score =   317 bits (811),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 192/228 (84%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDTV+ ++E+ K+ DF+KFDVGN+
Sbjct  121  YKLCKVKKVLIGSKGVPYITTHDGRTIRYPDPLIKTNDTVRFNIETGKIEDFVKFDVGNI  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG + +RE+H G FE VHI+DA  H FATR+ NVFTI
Sbjct  181  VMVTGGRNIGRVGQLVHRERHIGGFEIVHIKDALDHVFATRISNVFTI  228



>emb|CEG70586.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI95018.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   315 bits (806),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVR V  G KG+P+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVRKVMIGAKGVPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG + +RE+H G FE VHI+DA    FATR+ NVFTI
Sbjct  181  VMVTGGRNIGRVGQLIHRERHIGGFEIVHIKDALDRVFATRISNVFTI  228



>gb|EIE90129.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   314 bits (805),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDT++ ++E+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPLIKTNDTIRFNIETGKIEDFVKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG + +RE+H G FE VHI+DA  H FATR+ NVFTI
Sbjct  181  VMVTGGRNIGRVGQLVHRERHIGGFEIVHIKDALDHVFATRISNVFTI  228



>ref|XP_001421876.1| Ribosomal protein S4, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00170.1| Ribosomal protein S4, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=253

 Score =   314 bits (804),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGG FAPKPS GPHKSRECLPL LI+RNRLKYALTY+E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGVFAPKPSPGPHKSRECLPLCLILRNRLKYALTYKE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V +ILMQR V VDGK+R DK YP G MDVVSI K++E+FRL YD KGRF +H I   EA+
Sbjct  61   VTTILMQRVVKVDGKIRMDKCYPCGIMDVVSIEKSDEHFRLIYDNKGRFVVHRIEAIEAQ  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+S + G KG+P +  +DGRTIRYPDPLIK  D+V +D+ +NK+ DF+KFDVG +
Sbjct  121  YKLCKVKSKKLGDKGVPCVGLHDGRTIRYPDPLIKEGDSVMVDIATNKITDFVKFDVGAL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             M+TGGRN GRVGVI+ REKH GSFE VH++DA G EFATR  NVF I
Sbjct  181  CMITGGRNAGRVGVIQRREKHIGSFEIVHLKDAAGQEFATRATNVFAI  228



>gb|EIE79548.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   314 bits (805),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDT++ ++E+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPLIKTNDTIRFNIETGKIEDFVKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG + +RE+H G FE VHI+DA  H FATR+ NVFTI
Sbjct  181  VMVTGGRNIGRVGQLVHRERHIGGFEIVHIKDALDHVFATRISNVFTI  228



>gb|KDD75424.1| hypothetical protein H632_c691p0 [Helicosporidium sp. ATCC 50920]
Length=262

 Score =   314 bits (804),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPL+L++RNRLKYALT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSSGPHKTRECLPLILMLRNRLKYALTGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILM R V VDGKVRTDKTYP GFMDVV+IPKT+E+FRL YD+KGRF +H I  EEA 
Sbjct  61   VTSILMNRLVEVDGKVRTDKTYPVGFMDVVTIPKTSEHFRLIYDSKGRFAVHRITPEEAT  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ +QFG+ G+P++ T+DGRT+RYPDP I+  DTV  D+E NK+ DF++F+VGN+
Sbjct  121  YKLCKVKRMQFGRGGVPYVATHDGRTMRYPDPAIREGDTVVFDIEENKIRDFVRFEVGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             MVTGG N GRVG I + E+HKGSF+ V I+DA GH FATR  NVF I
Sbjct  181  AMVTGGHNNGRVGTITHTERHKGSFDIVQIRDAAGHVFATRATNVFVI  228



>dbj|BAK03384.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKHMKR+ AP HWMLDK+ G FAP+PS+GPHK RECLPL++++RNRL+YALT  E
Sbjct  1    MARGPKKHMKRIAAPSHWMLDKMSGVFAPRPSAGPHKLRECLPLIILLRNRLRYALTRTE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V  I+MQR + +DGKVRTD TYP GF DVV+I KT ENFRL +DTKGRF +  I  EEAK
Sbjct  61   VTKIVMQRLIKIDGKVRTDGTYPCGFQDVVTIDKTGENFRLLFDTKGRFVVQPISSEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  GK+GIPFI T+DGR IRYPDPLIKAND+VKLDLES K+ DF+KFD+G V
Sbjct  121  YKLCKVKRVTVGKEGIPFITTHDGRNIRYPDPLIKANDSVKLDLESGKITDFVKFDIGQV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVGVI +RE+H GSF+ VHI+DA G+ FATRLGNVF I
Sbjct  181  VMVTGGRNMGRVGVIVHRERHLGSFDIVHIKDAVGNTFATRLGNVFVI  228



>dbj|GAN07411.1| 40S ribosomal protein S4 [Mucor ambiguus]
 dbj|GAN00618.1| 40S ribosomal protein S4 [Mucor ambiguus]
Length=262

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 192/228 (84%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKHMKRL APKHWMLDKL GA+APKPSSGPHK RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGAYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  G KG+P+I T+DGR+IRYPDPLIKANDT++ +LE+NK+ +F+KF+VGNV
Sbjct  121  YKLCKVKKVLIGSKGVPYITTHDGRSIRYPDPLIKANDTIRFNLETNKIEEFVKFEVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG + +RE+H G FE VH++D+    FATR+ NVFTI
Sbjct  181  VMVTGGRNIGRVGQLVHRERHIGGFEIVHVKDSLDRVFATRISNVFTI  228



>emb|CAA75242.1| ribosomal protein S4 [Oryza sativa Japonica Group]
Length=268

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 181/240 (75%), Gaps = 21/240 (9%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLI------------KANDTVKLDLESNK  580
            FKLCKVRSVQFG+KGIP++NTY   T  Y   +             ++ D  +L L    
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYVVPTDTYMATIATRPTSGKRHNQDRSGDQQELRLHQGL  180

Query  581  VVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            ++     D      V            + + + KGSFET+H++DA GH+FATRLGNVFTI
Sbjct  181  MLAMCHGDWRRNTAVWCD---------QQQGEAKGSFETIHVEDALGHQFATRLGNVFTI  231



>emb|CEI87363.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   313 bits (801),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  G KGIP+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVLIGAKGIPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG + +RE+H G FE VHI+DA    FATR+ NVFTI
Sbjct  181  VMVTGGRNIGRVGQLIHRERHIGGFEIVHIKDALDRVFATRISNVFTI  228



>emb|CEG72922.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI90971.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   313 bits (801),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  G KGIP+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVLVGAKGIPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG + +RE+H G FE VHI+DA    FATR+ NVFTI
Sbjct  181  VMVTGGRNIGRVGQLIHRERHIGGFEIVHIKDALDRVFATRISNVFTI  228



>ref|XP_011402198.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
 gb|KFM29145.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
Length=263

 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPS+GPHK+RECLPL+L++RNRLKYALT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSAGPHKTRECLPLILLLRNRLKYALTGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V++IL  R V VDGKVRTDKTYP GFMD ++IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VVAILKNRLVQVDGKVRTDKTYPVGFMDTITIPKTDEHFRLVYDAKGRFVVHRISKEEAT  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ +QFGK  IP+I T+DGRTIRYPDP I+ NDTV LDLE+ K+ +F+ FDVG++
Sbjct  121  YKLCKVKRMQFGKGAIPYIATHDGRTIRYPDPDIRENDTVLLDLETGKIREFVHFDVGSL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGG N GRVG I  +EKHKGSF+ V+I+DA GH FATR  NVF I
Sbjct  181  VMVTGGHNNGRVGTITRKEKHKGSFDIVYIRDAVGHSFATRATNVFVI  228



>ref|XP_002502247.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63505.1| predicted protein [Micromonas sp. RCC299]
Length=258

 Score =   311 bits (798),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPS+GPHK+RECLPL LI+RNRLKYALTY+E
Sbjct  1    MPRGPKKHLKRLNAPKHWMLDKLGGVFAPKPSAGPHKTRECLPLCLILRNRLKYALTYKE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V +ILMQR V VDGK R DK YPAGFMDVVSI KT+E+FRL YD KGRF +H I   EA+
Sbjct  61   VTTILMQRLVKVDGKTRVDKCYPAGFMDVVSIDKTDEHFRLIYDAKGRFVVHRISSTEAQ  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV++ + G KG+P +N +DGRTIRYPDP+I  +DTV +D+ +NK+ D IK+D G +
Sbjct  121  YKLCKVKTKRLGDKGVPCVNLHDGRTIRYPDPVINESDTVMVDIATNKITDHIKYDAGAL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VM+TGGRNRGRVGVI+ REKHKGS E VH++DA GHEFATR  N F I
Sbjct  181  VMITGGRNRGRVGVIQRREKHKGSVEVVHVKDAGGHEFATRSSNTFVI  228



>gb|KFH71854.1| 40S ribosomal protein S4 [Mortierella verticillata NRRL 6337]
Length=259

 Score =   311 bits (797),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKH+KRLNAPKHWMLDKL G +AP+P++GPHK RECLPLV++IRNRLKYAL  +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLTGTYAPRPTAGPHKLRECLPLVILIRNRLKYALNGKE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD TYPAGFMD ++I KT ENFRL YDTKGRF +H I  EEA+
Sbjct  61   VQSILMQRLVKVDGKVRTDSTYPAGFMDAITIEKTGENFRLVYDTKGRFTVHRITAEEAQ  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ VQ G KGIPF+ T+DGRT+RYPDPLIK NDT+KLDLES K  +FIKF+VGNV
Sbjct  121  YKLCKVKKVQLGAKGIPFVVTHDGRTLRYPDPLIKVNDTIKLDLESGKFNEFIKFEVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             MVTGGRN GRVGVI +RE+H G F+ VHI+D    +FATRL NVF I
Sbjct  181  AMVTGGRNTGRVGVITHRERHVGGFDIVHIKDVLDRQFATRLSNVFVI  228



>ref|XP_002954897.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ44096.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=261

 Score =   311 bits (796),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKH+KRLNAP HWMLDKL G FAPKPS+GPHK RECLPL+LI+RNRLKYALT +E
Sbjct  1    MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD TYP GFMDV+SI KT+E+FRL  DTKGRF +H I  EEA 
Sbjct  61   VQSILMQRLVKVDGKVRTDHTYPTGFMDVISIEKTDEHFRLVLDTKGRFVVHRISKEEAA  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLC+VR VQFGK G+P++ T+DGRT+RYPDP +KAND+V LD+E+ K+ +++K DVG +
Sbjct  121  YKLCRVRKVQFGKGGVPYVATHDGRTVRYPDPEVKANDSVMLDIETGKIKEYVKNDVGAL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGG N GRVG I ++EKHKGSFE VHI+DA G+ FATRL N+F I
Sbjct  181  VMVTGGHNAGRVGKIVHKEKHKGSFEIVHIEDAAGNRFATRLTNIFVI  228



>ref|XP_001691218.1| ribosomal protein S4, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP04951.1| ribosomal protein S4 [Chlamydomonas reinhardtii]
Length=261

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKH+KRLNAP HWMLDKL G FAPKPS+GPHK RECLPL+LI+RNRLKYALT +E
Sbjct  1    MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD TYP GFMDV+S+ KT+ENFRL  DTKGRF +H I  EEA 
Sbjct  61   VQSILMQRLVKVDGKVRTDHTYPTGFMDVISMEKTDENFRLVLDTKGRFVVHRISKEEAA  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLC+VR V+FGK G+P++ T+DGRTIRYPDP IKAND++ LD+E+ K+ +F+K DVG +
Sbjct  121  YKLCRVRKVEFGKGGVPYVITHDGRTIRYPDPEIKANDSIMLDIETGKIKEFVKNDVGAL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGG N GRVG I ++EKHKGSFE VHI+DA G+ FATRL N+F I
Sbjct  181  VMVTGGHNAGRVGKIVHKEKHKGSFEIVHIEDAAGNRFATRLTNIFVI  228



>gb|EFX62690.1| hypothetical protein DAPPUDRAFT_300650 [Daphnia pulex]
Length=244

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKH+KRL APK WMLDKLGG FAP+PS+GPHK RE LPLV+ +RNRLKYAL   E
Sbjct  1    MARGPKKHLKRLAAPKSWMLDKLGGVFAPRPSTGPHKLRESLPLVVFLRNRLKYALNNSE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V  I+MQR + VDGKVRTD  YPAGFMDV++I KT E FRL YD KGRF +H I  EEAK
Sbjct  61   VTKIVMQRLIKVDGKVRTDSNYPAGFMDVITIDKTGEYFRLVYDVKGRFAIHRITAEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVR VQ G KGIPFI T+DGRTIRYPDPL+K NDT++LD+ +NK++DFIKFD GN+
Sbjct  121  YKLCKVRRVQVGPKGIPFITTHDGRTIRYPDPLVKVNDTIQLDIATNKIMDFIKFDSGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             M+TGGRN GRVG I NRE+H GSF+ VH++DA GH FATRL NVF I
Sbjct  181  CMITGGRNLGRVGTIINRERHPGSFDIVHVKDALGHLFATRLNNVFII  228



>ref|XP_006679983.1| hypothetical protein BATDEDRAFT_35382 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79221.1| hypothetical protein BATDEDRAFT_35382 [Batrachochytrium dendrobatidis 
JAM81]
Length=293

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 193/242 (80%), Gaps = 2/242 (1%)
 Frame = +2

Query  41   HRRRPNTQ--LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVL  214
            H   P+ Q  LS+   RG KKH+KRLNAPKHWMLDKL G +APKPS+GPHK+RECLPL++
Sbjct  17   HDEIPSRQYRLSSDNGRGPKKHLKRLNAPKHWMLDKLTGTWAPKPSAGPHKTRECLPLIV  76

Query  215  IIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTK  394
             IRNRL+YALT +E  +I+ QR + VDGKVRTD TYPAGFMDV+SI KT ENFRL YD K
Sbjct  77   FIRNRLRYALTNQETKAIVNQRLIKVDGKVRTDMTYPAGFMDVISIEKTGENFRLIYDVK  136

Query  395  GRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLES  574
            GRF +H I DEEAK+KLCKVR V+ G+K IP+I T+DGRTIRYPDPL+K NDTVK+D+ +
Sbjct  137  GRFTIHRITDEEAKYKLCKVRQVKIGQKAIPYIVTHDGRTIRYPDPLVKVNDTVKVDIAT  196

Query  575  NKVVDFIKFDvgnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVF  754
             K  ++IKFD GN+  VTGGRN GR+GVI +REKH G FE VHI+DA  H FATR+ NVF
Sbjct  197  GKFTEYIKFDSGNIAYVTGGRNMGRIGVITHREKHHGGFEIVHIKDAVDHTFATRISNVF  256

Query  755  TI  760
             +
Sbjct  257  VV  258



>emb|CEP14949.1| hypothetical protein [Parasitella parasitica]
Length=264

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDTV+ +LES+K+ +F+KF+VGNV
Sbjct  121  YKLCKVKKVLVGSKGVPYITTHDGRTIRYPDPLIKVNDTVRFNLESSKIEEFVKFEVGNV  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            VMVTGGRN GRVG I +RE+H G FE VHI+DA    FATR+ NVF I
Sbjct  181  VMVTGGRNIGRVGQIVHRERHIGGFEIVHIKDALDRVFATRISNVFII  228



>gb|ELU11454.1| hypothetical protein CAPTEDRAFT_152725 [Capitella teleta]
Length=259

 Score =   310 bits (793),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            M RG + H+KRL APKHWMLDKLGG FAP+PS+GPHK RECLPLV+ +RNRLKYALTY E
Sbjct  1    MVRGPRMHLKRLAAPKHWMLDKLGGVFAPRPSTGPHKLRECLPLVIFLRNRLKYALTYTE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V+ IL QR + VD KVRTDKTYPAGFMDV+SI +TNENFRL YD KGRF +H I  EEAK
Sbjct  61   VMKILNQRLIKVDNKVRTDKTYPAGFMDVISIERTNENFRLIYDVKGRFAVHRITPEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLC+VR+++ G KG+PF+ T+D RTIRYPDPLIK NDTV++DL + K+ D+IKFD GN+
Sbjct  121  YKLCRVRALKTGPKGVPFLTTHDARTIRYPDPLIKPNDTVQVDLATGKIKDYIKFDSGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             M+TGGRN GRVG+I +REKH GSF+ +H++D TGH FATR+ NVF I
Sbjct  181  CMITGGRNLGRVGLITHREKHPGSFDIIHVKDTTGHIFATRMSNVFVI  228



>ref|XP_008157005.1| PREDICTED: 40S ribosomal protein S4, X isoform-like [Eptesicus 
fuscus]
Length=263

 Score =   310 bits (793),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKH+KR+ APKHWMLDKL G FAP+PS+GPHK RECLPL++ +RNRLKYALT  E
Sbjct  1    MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V  I MQR + +DGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I  EEAK
Sbjct  61   VKKICMQRFIKIDGKVRTDVTYPAGFMDVISIDKTGENFRLVYDTKGRFAVHRITPEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVR +  G KGIP + T+D RTIRYPDPLIK NDT+++DLES K+ DFIKFD GN+
Sbjct  121  YKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLESGKITDFIKFDTGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             M+TGG N GR+GVI NREKH GSF+ VH++D TG+ FATRL N+F I
Sbjct  181  CMITGGANLGRIGVITNREKHPGSFDVVHVKDTTGNSFATRLSNIFVI  228



>ref|XP_010989591.1| PREDICTED: 40S ribosomal protein S4, X isoform [Camelus dromedarius]
Length=281

 Score =   310 bits (794),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  247
            S  MARG KKH+KR+ APKHWMLDKL G FAP+PS+GPHK RECLPL++ +RNRLKYALT
Sbjct  16   SAAMARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALT  75

Query  248  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  427
              EV  I MQR + +DGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I  E
Sbjct  76   GDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPE  135

Query  428  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDv  607
            EAK+KLCKVR +  G KGIP + T+D RTIRYPDPLIK NDT+++DLE+ K+ DFIKFD 
Sbjct  136  EAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDT  195

Query  608  gnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            GN+ MVTGG N GR+GVI NRE+H GSF+ VH++DA G+ FATRL N+F I
Sbjct  196  GNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVI  246



>gb|ABQ18253.1| ribosomal protein S4e [Lygus lineolaris]
Length=263

 Score =   309 bits (792),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 187/228 (82%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG K+H+KRLNAPK WMLDKLGG FAP+PS+GPHK RECLPLV+ +RNRLKYALT  E
Sbjct  1    MARGPKRHLKRLNAPKSWMLDKLGGVFAPRPSTGPHKLRECLPLVIFLRNRLKYALTKDE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V  I+MQR + VDGKVRTD  YPAGFMDV++I KT E FRL YD KGR+ +H I  +EAK
Sbjct  61   VTKIVMQRLIKVDGKVRTDPNYPAGFMDVITIEKTGEFFRLIYDVKGRYAIHRITADEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVR VQ G KGIPF+ T+DGRTIRYPDPL K NDT++LD+ +NK++D I+ D GN+
Sbjct  121  YKLCKVRKVQTGPKGIPFLVTHDGRTIRYPDPLAKVNDTIQLDIATNKIIDIIRMDSGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             M+TGGRN GRVG + NRE+H GSF+ VH++DATGH FATRL NVF I
Sbjct  181  CMITGGRNLGRVGTVVNRERHPGSFDIVHVKDATGHTFATRLNNVFII  228



>ref|XP_004679117.1| PREDICTED: 40S ribosomal protein S4, X isoform-like [Condylura 
cristata]
Length=268

 Score =   309 bits (792),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = +2

Query  68   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  247
            S+ MARG KKH+KR+ APKHWMLDKL G FAP+PS+GPHK RECLPL++ +RNRLKYALT
Sbjct  3    SSAMARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALT  62

Query  248  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  427
              EV  I MQR + +DGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I  E
Sbjct  63   GDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPE  122

Query  428  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDv  607
            EAK+KLCKVR +  G KGIP + T+D RTIRYPDPLIK NDT+++DLE+ K+ +FIKFD 
Sbjct  123  EAKYKLCKVRKIIVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITEFIKFDT  182

Query  608  gnvvmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
            GN+ MVTGG N GR+GVI NRE+H GSF+ VH++DA G+ FATRL N+F I
Sbjct  183  GNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVI  233



>ref|XP_005880123.1| PREDICTED: 40S ribosomal protein S4, X isoform-like isoform X1 
[Myotis brandtii]
 ref|XP_005880124.1| PREDICTED: 40S ribosomal protein S4, X isoform-like isoform X2 
[Myotis brandtii]
Length=288

 Score =   310 bits (794),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = +2

Query  77   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  256
            MARG KKH+KR+ APKHWMLDKL G FAP+PS+GPHK RECLPL++ +RNRLKYALT  E
Sbjct  1    MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDE  60

Query  257  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  436
            V  I MQR + +DGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I  EEAK
Sbjct  61   VKKICMQRFIKIDGKVRTDTTYPAGFMDVISIDKTGENFRLVYDTKGRFAVHRITPEEAK  120

Query  437  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDvgnv  616
            +KLCKVR +  G KGIP + T+D RTIRYPDPLIK NDT+++DLES K+ DFIKFD GN+
Sbjct  121  YKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLESGKITDFIKFDTGNL  180

Query  617  vmvtggrnrgrvgvIKNREKHKGSFETVHIQDATGHEFATRLGNVFTI  760
             M+TGG N GR+GVI NREKH GSF+ VH++D TG+ FATRL N+F I
Sbjct  181  CMITGGANLGRIGVITNREKHPGSFDVVHVKDTTGNSFATRLSNIFVI  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470