BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF042F11

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...    151   2e-38   Nicotiana tomentosiformis
emb|CDP02527.1|  unnamed protein product                                147   2e-37   Coffea canephora [robusta coffee]
emb|CDP02523.1|  unnamed protein product                                147   5e-37   Coffea canephora [robusta coffee]
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg                142   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...    142   3e-35   Nicotiana sylvestris
ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...    136   1e-33   
ref|XP_004233445.1|  PREDICTED: uncharacterized protein At4g06744...    133   2e-32   Solanum lycopersicum
ref|XP_011099103.1|  PREDICTED: uncharacterized protein At4g06744...    130   2e-31   Sesamum indicum [beniseed]
ref|XP_010555995.1|  PREDICTED: uncharacterized protein At4g06744...    122   2e-28   Tarenaya hassleriana [spider flower]
gb|AEI72268.1|  leucine-rich repeat family protein                      121   3e-28   Citrus trifoliata [hardy orange]
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                   121   4e-28   Citrus sinensis [apfelsine]
ref|XP_007042489.1|  Leucine-rich repeat family protein, putative       121   6e-28   
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg             120   1e-27   Citrus clementina [clementine]
ref|XP_010519298.1|  PREDICTED: uncharacterized protein At4g06744...    118   4e-27   Tarenaya hassleriana [spider flower]
ref|XP_011088225.1|  PREDICTED: uncharacterized protein At4g06744...    118   5e-27   Sesamum indicum [beniseed]
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...    117   6e-27   Cucumis melo [Oriental melon]
ref|XP_008236575.1|  PREDICTED: uncharacterized protein At4g06744...    117   7e-27   Prunus mume [ume]
gb|KDO59786.1|  hypothetical protein CISIN_1g048561mg                   117   7e-27   Citrus sinensis [apfelsine]
ref|XP_002518710.1|  serine-threonine protein kinase, plant-type,...    117   8e-27   
ref|XP_006487027.1|  PREDICTED: uncharacterized protein At4g06744...    117   8e-27   Citrus sinensis [apfelsine]
gb|KHN22492.1|  Hypothetical protein glysoja_041167                     117   1e-26   Glycine soja [wild soybean]
ref|XP_003545325.1|  PREDICTED: uncharacterized protein At4g06744...    117   1e-26   Glycine max [soybeans]
ref|XP_006472980.1|  PREDICTED: uncharacterized protein At4g06744...    116   2e-26   
ref|XP_007160878.1|  hypothetical protein PHAVU_001G024400g             116   2e-26   Phaseolus vulgaris [French bean]
ref|XP_010466072.1|  PREDICTED: uncharacterized protein At4g06744...    115   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...    115   3e-26   Elaeis guineensis
ref|XP_002313863.2|  hypothetical protein POPTR_0009s10140g             115   3e-26   
ref|XP_009592678.1|  PREDICTED: uncharacterized protein At4g06744...    115   3e-26   Nicotiana tomentosiformis
ref|XP_004291077.1|  PREDICTED: uncharacterized protein At4g06744...    115   4e-26   Fragaria vesca subsp. vesca
gb|KDO37099.1|  hypothetical protein CISIN_1g037101mg                   115   4e-26   Citrus sinensis [apfelsine]
ref|XP_006346520.1|  PREDICTED: uncharacterized protein At4g06744...    114   5e-26   Solanum tuberosum [potatoes]
ref|XP_006433575.1|  hypothetical protein CICLE_v10003526mg             115   5e-26   Citrus clementina [clementine]
ref|XP_011000899.1|  PREDICTED: uncharacterized protein At4g06744...    114   7e-26   Populus euphratica
ref|XP_009784047.1|  PREDICTED: uncharacterized protein At4g06744...    114   7e-26   Nicotiana sylvestris
ref|XP_010107857.1|  Uncharacterized protein L484_027444                114   7e-26   Morus notabilis
ref|XP_007227115.1|  hypothetical protein PRUPE_ppa025707mg             114   8e-26   
ref|XP_008220262.1|  PREDICTED: uncharacterized protein At4g06744...    114   8e-26   Prunus mume [ume]
ref|XP_009107284.1|  PREDICTED: uncharacterized protein At4g06744       114   1e-25   Brassica rapa
emb|CDY29337.1|  BnaA05g16040D                                          114   1e-25   Brassica napus [oilseed rape]
ref|XP_004141388.1|  PREDICTED: uncharacterized protein At4g06744...    114   1e-25   Cucumis sativus [cucumbers]
ref|XP_011029410.1|  PREDICTED: uncharacterized protein At4g06744...    113   2e-25   Populus euphratica
gb|KDP41695.1|  hypothetical protein JCGZ_16102                         113   2e-25   Jatropha curcas
ref|XP_003550327.1|  PREDICTED: uncharacterized protein At4g06744...    113   2e-25   Glycine max [soybeans]
ref|XP_008236564.1|  PREDICTED: uncharacterized protein At4g06744...    113   2e-25   Prunus mume [ume]
ref|XP_008452581.1|  PREDICTED: uncharacterized protein At4g06744...    113   2e-25   Cucumis melo [Oriental melon]
ref|XP_006297641.1|  hypothetical protein CARUB_v10013659mg             113   2e-25   Capsella rubella
gb|KFK39280.1|  hypothetical protein AALP_AA3G224000                    113   2e-25   Arabis alpina [alpine rockcress]
ref|XP_006374888.1|  hypothetical protein POPTR_0014s02430g             113   3e-25   Populus trichocarpa [western balsam poplar]
emb|CDY16514.1|  BnaA08g02530D                                          113   3e-25   Brassica napus [oilseed rape]
ref|XP_011004883.1|  PREDICTED: uncharacterized protein At4g06744...    112   3e-25   Populus euphratica
emb|CDY20865.1|  BnaC05g26270D                                          113   3e-25   Brassica napus [oilseed rape]
ref|XP_010507626.1|  PREDICTED: uncharacterized protein At4g06744...    113   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007199295.1|  hypothetical protein PRUPE_ppa023082mg             112   3e-25   
ref|XP_011000139.1|  PREDICTED: uncharacterized protein At4g06744...    112   3e-25   Populus euphratica
ref|XP_009359966.1|  PREDICTED: uncharacterized protein At4g06744...    113   3e-25   Pyrus x bretschneideri [bai li]
ref|XP_007201703.1|  hypothetical protein PRUPE_ppa004109mg             113   5e-25   Prunus persica
gb|KDP24991.1|  hypothetical protein JCGZ_23974                         112   5e-25   Jatropha curcas
ref|XP_010061722.1|  PREDICTED: uncharacterized protein At4g06744...    112   6e-25   Eucalyptus grandis [rose gum]
ref|XP_009762067.1|  PREDICTED: uncharacterized protein At4g06744...    112   6e-25   Nicotiana sylvestris
emb|CDP01296.1|  unnamed protein product                                111   7e-25   Coffea canephora [robusta coffee]
gb|KDP24986.1|  hypothetical protein JCGZ_23969                         111   8e-25   Jatropha curcas
gb|KJB32334.1|  hypothetical protein B456_005G236100                    111   9e-25   Gossypium raimondii
ref|XP_009622015.1|  PREDICTED: uncharacterized protein At4g06744...    111   9e-25   Nicotiana tomentosiformis
emb|CDX99236.1|  BnaC05g33510D                                          111   1e-24   
ref|XP_004231393.1|  PREDICTED: uncharacterized protein At4g06744       111   1e-24   Solanum lycopersicum
ref|NP_188563.1|  leucine-rich repeat-containing protein                111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004167460.1|  PREDICTED: uncharacterized protein At4g06744...    111   1e-24   
ref|XP_009145802.1|  PREDICTED: uncharacterized protein At4g06744       111   1e-24   Brassica rapa
emb|CDX92324.1|  BnaA05g20830D                                          111   1e-24   
ref|XP_008393778.1|  PREDICTED: uncharacterized protein At4g06744...    111   1e-24   
ref|XP_006406513.1|  hypothetical protein EUTSA_v10020680mg             110   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010487869.1|  PREDICTED: uncharacterized protein At4g06744...    110   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003589141.1|  hypothetical protein MTR_1g018910                  110   2e-24   Medicago truncatula
ref|XP_007201495.1|  hypothetical protein PRUPE_ppa014775mg             110   2e-24   
ref|XP_011074595.1|  PREDICTED: uncharacterized protein At4g06744...    110   2e-24   
ref|XP_006422962.1|  hypothetical protein CICLE_v10028712mg             110   2e-24   
ref|XP_002282482.2|  PREDICTED: uncharacterized protein At4g06744...    111   2e-24   Vitis vinifera
ref|XP_002300228.2|  hypothetical protein POPTR_0001s30990g             110   3e-24   
emb|CDY32853.1|  BnaC08g02750D                                          110   3e-24   Brassica napus [oilseed rape]
ref|XP_011004900.1|  PREDICTED: uncharacterized protein At4g06744...    110   3e-24   Populus euphratica
ref|XP_009145107.1|  PREDICTED: uncharacterized protein At4g06744...    111   3e-24   Brassica rapa
ref|XP_010263447.1|  PREDICTED: uncharacterized protein At4g06744...    110   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010688602.1|  PREDICTED: uncharacterized protein At4g06744       109   4e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008236576.1|  PREDICTED: uncharacterized protein At4g06744...    109   7e-24   
ref|XP_008342943.1|  PREDICTED: uncharacterized protein At4g06744...    108   1e-23   
ref|XP_009417193.1|  PREDICTED: uncharacterized protein At4g06744...    108   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO97205.1|  unnamed protein product                                107   2e-23   Coffea canephora [robusta coffee]
ref|XP_004499033.1|  PREDICTED: uncharacterized protein At4g06744...    107   2e-23   Cicer arietinum [garbanzo]
gb|KDP47120.1|  hypothetical protein JCGZ_22116                         107   2e-23   Jatropha curcas
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...    108   2e-23   
gb|KJB14612.1|  hypothetical protein B456_002G134000                    107   2e-23   Gossypium raimondii
ref|XP_004140807.1|  PREDICTED: uncharacterized protein LOC101203557    110   2e-23   
ref|NP_001053250.1|  Os04g0505200                                       106   3e-23   
ref|XP_006393218.1|  hypothetical protein EUTSA_v10011424mg             107   4e-23   Eutrema salsugineum [saltwater cress]
ref|XP_002510174.1|  serine-threonine protein kinase, plant-type,...    106   5e-23   Ricinus communis
gb|KCW54905.1|  hypothetical protein EUGRSUZ_I00883                     107   5e-23   Eucalyptus grandis [rose gum]
ref|XP_010927582.1|  PREDICTED: uncharacterized protein At4g06744...    106   6e-23   
gb|EEE61292.1|  hypothetical protein OsJ_15379                          106   6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009413340.1|  PREDICTED: uncharacterized protein At4g06744...    106   7e-23   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAE02949.1|  OSJNBa0014K14.21                                       106   8e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010028214.1|  PREDICTED: uncharacterized protein At4g06744...    106   8e-23   Eucalyptus grandis [rose gum]
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...    105   1e-22   Oryza brachyantha
gb|EYU37650.1|  hypothetical protein MIMGU_mgv11b016249mg               105   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_004304027.1|  PREDICTED: uncharacterized protein At4g06744...    105   1e-22   Fragaria vesca subsp. vesca
gb|KDP47121.1|  hypothetical protein JCGZ_22117                         105   1e-22   Jatropha curcas
ref|XP_002514194.1|  serine-threonine protein kinase, plant-type,...    105   1e-22   Ricinus communis
ref|XP_007017157.1|  Leucine-rich repeat family protein                 105   2e-22   
ref|XP_009345138.1|  PREDICTED: uncharacterized protein At4g06744...    105   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...    105   2e-22   
emb|CAN61023.1|  hypothetical protein VITISV_001143                     105   2e-22   Vitis vinifera
ref|XP_006397360.1|  hypothetical protein EUTSA_v10028721mg             104   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_010523006.1|  PREDICTED: uncharacterized protein At4g06744...    104   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_008796513.1|  PREDICTED: uncharacterized protein At4g06744...    104   2e-22   
ref|XP_007042487.1|  Leucine-rich repeat family protein, putative       104   2e-22   
ref|XP_010094650.1|  Uncharacterized protein L484_008882                104   3e-22   Morus notabilis
gb|EQB58412.1|  RAM signaling pathway protein                           103   3e-22   Colletotrichum gloeosporioides Cg-14
ref|XP_010455221.1|  PREDICTED: uncharacterized protein At4g06744...    103   3e-22   Camelina sativa [gold-of-pleasure]
ref|NP_849339.1|  Leucine-rich repeat-containing protein                103   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011069732.1|  PREDICTED: uncharacterized protein At4g06744...    103   4e-22   Sesamum indicum [beniseed]
ref|XP_010664552.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    103   5e-22   Vitis vinifera
ref|XP_007601154.1|  crisp-1                                            102   5e-22   
ref|XP_010270768.1|  PREDICTED: uncharacterized protein At4g06744...    104   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_004248758.1|  PREDICTED: uncharacterized protein At4g06744...    103   6e-22   Solanum lycopersicum
ref|XP_008799889.1|  PREDICTED: uncharacterized protein At4g06744...    103   6e-22   Phoenix dactylifera
ref|XP_010438766.1|  PREDICTED: uncharacterized protein At4g06744       103   7e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006289202.1|  hypothetical protein CARUB_v10002650mg             103   7e-22   Capsella rubella
ref|XP_002885307.1|  leucine-rich repeat family protein                 103   8e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_007285579.1|  aldo/keto reductase, putative                      104   9e-22   
ref|XP_010928365.1|  PREDICTED: uncharacterized protein At4g06744...    103   9e-22   Elaeis guineensis
ref|XP_006356575.1|  PREDICTED: uncharacterized protein At4g06744...    102   1e-21   Solanum tuberosum [potatoes]
ref|XP_009617390.1|  PREDICTED: uncharacterized protein At4g06744...    102   1e-21   
ref|XP_002282474.2|  PREDICTED: uncharacterized protein At4g06744       102   1e-21   Vitis vinifera
ref|XP_003555862.1|  PREDICTED: uncharacterized protein At4g06744...    102   1e-21   Glycine max [soybeans]
ref|XP_010421726.1|  PREDICTED: uncharacterized protein At4g06744       102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010227187.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-21   
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg            102   2e-21   
ref|XP_003528523.1|  PREDICTED: uncharacterized protein At4g06744...    101   2e-21   Glycine max [soybeans]
ref|XP_009141276.1|  PREDICTED: uncharacterized protein At4g06744...    100   3e-21   Brassica rapa
ref|XP_006653860.1|  PREDICTED: uncharacterized protein At4g06744...    101   3e-21   Oryza brachyantha
ref|XP_009141268.1|  PREDICTED: uncharacterized protein At4g06744...    100   3e-21   Brassica rapa
ref|XP_009768848.1|  PREDICTED: uncharacterized protein At4g06744...    100   3e-21   Nicotiana sylvestris
gb|KFK39606.1|  hypothetical protein AALP_AA3G265800                    100   4e-21   Arabis alpina [alpine rockcress]
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...    101   4e-21   
ref|XP_002874478.1|  leucine-rich repeat family protein                 100   4e-21   
ref|XP_010066095.1|  PREDICTED: uncharacterized protein At4g06744...    100   5e-21   Eucalyptus grandis [rose gum]
emb|CDX75185.1|  BnaC09g24970D                                        99.4    8e-21   
emb|CDY29128.1|  BnaA09g53810D                                        99.4    9e-21   Brassica napus [oilseed rape]
ref|XP_008663372.1|  PREDICTED: uncharacterized protein At4g06744...    101   9e-21   
gb|ENH81556.1|  leucine-rich repeat family protein                    99.0    9e-21   
ref|XP_010065987.1|  PREDICTED: uncharacterized protein At4g06744...  99.8    1e-20   Eucalyptus grandis [rose gum]
ref|XP_010263446.1|  PREDICTED: uncharacterized protein At4g06744...    100   1e-20   Nelumbo nucifera [Indian lotus]
gb|AEV40972.1|  uncharacterized protein At4g06744 precursor             100   1e-20   Oryza punctata
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                     99.8    1e-20   Triticum urartu
ref|XP_002518709.1|  serine-threonine protein kinase, plant-type,...    100   1e-20   Ricinus communis
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg             101   2e-20   Capsella rubella
gb|EYU25462.1|  hypothetical protein MIMGU_mgv1a024676mg              99.0    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_011467740.1|  PREDICTED: uncharacterized protein At4g06744       100   2e-20   Fragaria vesca subsp. vesca
gb|EPS72402.1|  hypothetical protein M569_02357                       99.0    2e-20   Genlisea aurea
gb|ACG34018.1|  protein binding protein                               99.4    2e-20   Zea mays [maize]
emb|CDX94809.1|  BnaC03g43790D                                          100   2e-20   
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-20   
gb|KJB12258.1|  hypothetical protein B456_002G008600                  99.4    3e-20   Gossypium raimondii
emb|CAB37452.1|  extensin-like protein                                  100   3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505255.1|  PREDICTED: uncharacterized protein At4g06744...  98.6    3e-20   Cicer arietinum [garbanzo]
ref|NP_193602.4|  leucine-rich repeat extensin-like protein 5           100   3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395500.1|  PREDICTED: uncharacterized protein At4g06744...  99.0    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX93014.1|  BnaA03g37360D                                        99.0    3e-20   
gb|KJB54313.1|  hypothetical protein B456_009G028700                  97.8    3e-20   Gossypium raimondii
gb|EPS58531.1|  hypothetical protein M569_16282                       97.8    3e-20   Genlisea aurea
ref|XP_002867981.1|  hypothetical protein ARALYDRAFT_492992             100   3e-20   
ref|XP_009605357.1|  PREDICTED: uncharacterized protein At4g06744...  97.8    4e-20   Nicotiana tomentosiformis
gb|EMT03089.1|  hypothetical protein F775_11041                       98.6    4e-20   
dbj|BAJ86461.1|  predicted protein                                    98.6    4e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002885650.1|  predicted protein                                99.0    4e-20   
dbj|BAJ86489.1|  predicted protein                                    98.2    5e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91151.1|  predicted protein                                    99.0    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...  99.8    6e-20   
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...  99.8    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010094651.1|  Uncharacterized protein L484_008883              97.8    6e-20   Morus notabilis
gb|EMT08852.1|  hypothetical protein F775_11606                       98.6    7e-20   
ref|XP_006848210.1|  hypothetical protein AMTR_s00029p00242610        95.9    8e-20   
ref|XP_003580786.1|  PREDICTED: uncharacterized protein At4g06744     97.4    8e-20   Brachypodium distachyon [annual false brome]
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...  99.4    8e-20   
gb|AEV41023.1|  uncharacterized protein At4g06744 precursor           97.8    9e-20   Oryza minuta
gb|KJB32335.1|  hypothetical protein B456_005G236200                  97.1    9e-20   Gossypium raimondii
gb|KHN05611.1|  Hypothetical protein glysoja_047056                   97.1    9e-20   Glycine soja [wild soybean]
gb|AEV41070.1|  uncharacterized protein At4g06744 precursor           97.4    1e-19   Oryza minuta
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg           99.0    1e-19   
ref|XP_003538630.1|  PREDICTED: uncharacterized protein At4g06744...  97.1    1e-19   Glycine max [soybeans]
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...  99.4    1e-19   Brassica rapa
ref|XP_004140710.1|  PREDICTED: uncharacterized protein At4g06744...  97.4    1e-19   Cucumis sativus [cucumbers]
gb|AEV41116.1|  uncharacterized protein At4g06744 precursor           97.4    1e-19   Oryza officinalis
ref|NP_001054210.2|  Os04g0670100                                     97.1    1e-19   
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...  99.0    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004976154.1|  PREDICTED: uncharacterized protein At4g06744...  97.4    1e-19   Setaria italica
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4         97.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004168435.1|  PREDICTED: uncharacterized protein At4g06744...  97.1    1e-19   
ref|XP_001767662.1|  predicted protein                                95.9    1e-19   
gb|AIE88270.1|  hypothetical protein OG_BBa0063K01.1                  97.4    1e-19   Oryza glaberrima
gb|EAZ32358.1|  hypothetical protein OsJ_16568                        97.4    1e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86091.1|  H0818H01.13                                          97.4    1e-19   Oryza sativa [red rice]
ref|XP_007157716.1|  hypothetical protein PHAVU_002G092300g           96.7    1e-19   Phaseolus vulgaris [French bean]
ref|XP_002446758.1|  hypothetical protein SORBIDRAFT_06g021870        97.1    2e-19   Sorghum bicolor [broomcorn]
ref|XP_007017156.1|  LRR-family protein                               96.7    2e-19   
ref|XP_010479447.1|  PREDICTED: leucine-rich repeat extensin-like...  97.4    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009132101.1|  PREDICTED: leucine-rich repeat extensin-like...  98.2    2e-19   Brassica rapa
ref|XP_010461823.1|  PREDICTED: uncharacterized protein At4g06744...  97.1    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007012977.1|  Leucine-rich repeat family protein / extensi...  95.9    2e-19   
gb|EMT04546.1|  hypothetical protein F775_44003                       95.5    2e-19   
ref|XP_004141032.1|  PREDICTED: leucine-rich repeat extensin-like...  95.5    3e-19   Cucumis sativus [cucumbers]
ref|XP_011093658.1|  PREDICTED: leucine-rich repeat extensin-like...  95.5    3e-19   
ref|XP_004157952.1|  PREDICTED: leucine-rich repeat extensin-like...  95.5    3e-19   
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein        96.7    3e-19   
ref|NP_001141186.1|  leucine-rich repeat (LRR) family protein pre...  95.5    3e-19   Zea mays [maize]
gb|EMS61305.1|  hypothetical protein TRIUR3_11917                     95.1    4e-19   Triticum urartu
ref|XP_009396708.1|  PREDICTED: uncharacterized protein At4g06744...  95.5    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK35980.1|  hypothetical protein AALP_AA4G062700                  96.3    4e-19   Arabis alpina [alpine rockcress]
gb|ACG42798.1|  leucine-rich repeat, plant specific                   95.5    4e-19   Zea mays [maize]
gb|KCW63737.1|  hypothetical protein EUGRSUZ_G01385                   94.4    4e-19   Eucalyptus grandis [rose gum]
ref|XP_009795730.1|  PREDICTED: leucine-rich repeat extensin-like...  95.1    5e-19   Nicotiana sylvestris
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...  95.9    5e-19   Sesamum indicum [beniseed]
ref|XP_002516600.1|  serine-threonine protein kinase, plant-type,...  95.9    6e-19   Ricinus communis
gb|EYU27248.1|  hypothetical protein MIMGU_mgv1a007527mg              94.4    7e-19   Erythranthe guttata [common monkey flower]
ref|XP_010228296.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    8e-19   Brachypodium distachyon [annual false brome]
gb|KDP43798.1|  hypothetical protein JCGZ_23006                       96.3    9e-19   Jatropha curcas
gb|KHN30415.1|  Hypothetical protein glysoja_033153                   94.0    9e-19   Glycine soja [wild soybean]
ref|XP_004503826.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    1e-18   Cicer arietinum [garbanzo]
gb|KJB06895.1|  hypothetical protein B456_001G004000                  94.7    1e-18   Gossypium raimondii
ref|XP_002447298.1|  hypothetical protein SORBIDRAFT_06g032310        94.4    1e-18   Sorghum bicolor [broomcorn]
gb|EPS61338.1|  hypothetical protein M569_13456                       93.2    1e-18   Genlisea aurea
ref|XP_008459038.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    2e-18   Cucumis melo [Oriental melon]
ref|XP_009602497.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    2e-18   Nicotiana tomentosiformis
ref|XP_003516778.2|  PREDICTED: uncharacterized protein At4g06744...  94.0    2e-18   Glycine max [soybeans]
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg              93.2    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g         93.2    2e-18   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g           94.0    2e-18   
gb|KJB06894.1|  hypothetical protein B456_001G004000                  94.7    2e-18   Gossypium raimondii
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    2e-18   Populus euphratica
gb|ADN33724.1|  LRR-family protein                                    93.6    2e-18   Cucumis melo subsp. melo
gb|KJB06897.1|  hypothetical protein B456_001G004000                  94.7    2e-18   Gossypium raimondii
ref|XP_003529407.1|  PREDICTED: uncharacterized protein At4g06744...  93.6    2e-18   Glycine max [soybeans]
emb|CDP03355.1|  unnamed protein product                              95.1    2e-18   Coffea canephora [robusta coffee]
ref|XP_010532845.1|  PREDICTED: leucine-rich repeat extensin-like...  94.7    2e-18   Tarenaya hassleriana [spider flower]
gb|KHN43047.1|  Hypothetical protein glysoja_007577                   93.6    2e-18   Glycine soja [wild soybean]
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    2e-18   Populus euphratica
gb|KJB77660.1|  hypothetical protein B456_012G149500                  93.6    2e-18   Gossypium raimondii
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                  95.1    2e-18   Arabis alpina [alpine rockcress]
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    2e-18   Populus euphratica
gb|KJB14611.1|  hypothetical protein B456_002G133900                  93.6    2e-18   Gossypium raimondii
gb|KJB06896.1|  hypothetical protein B456_001G004000                  94.7    2e-18   Gossypium raimondii
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610        94.0    3e-18   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg          92.8    3e-18   
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3         94.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337109.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  93.6    3e-18   
ref|XP_010270780.1|  PREDICTED: uncharacterized protein At4g06744...  93.6    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009394537.1|  PREDICTED: uncharacterized protein At4g06744...  93.2    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348443.1|  PREDICTED: leucine-rich repeat extensin-like...  94.7    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_010500525.1|  PREDICTED: leucine-rich repeat extensin-like...  93.6    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004955608.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    4e-18   
ref|XP_003566833.2|  PREDICTED: leucine-rich repeat extensin-like...  93.6    4e-18   
ref|XP_008444596.1|  PREDICTED: uncharacterized protein At4g06744...  93.2    4e-18   
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg          93.2    4e-18   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g           93.2    4e-18   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  93.2    5e-18   
ref|XP_010050506.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    5e-18   Eucalyptus grandis [rose gum]
gb|EPS58069.1|  hypothetical protein M569_16746                       91.3    5e-18   Genlisea aurea
ref|XP_004142874.1|  PREDICTED: uncharacterized protein At4g06744...  92.4    5e-18   Cucumis sativus [cucumbers]
gb|AGE09569.1|  LRRK-like protein                                     92.0    6e-18   Eucalyptus cladocalyx
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g           93.2    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_007013226.1|  Leucine-rich repeat family protein               93.6    6e-18   
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    8e-18   
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    8e-18   Prunus mume [ume]
ref|XP_006307323.1|  hypothetical protein CARUB_v10008944mg           92.4    9e-18   Capsella rubella
gb|KEH30896.1|  Serine/Threonine kinase, plant-type protein, puta...  91.3    1e-17   Medicago truncatula
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    1e-17   Sesamum indicum [beniseed]
gb|EPS66537.1|  extensin-like protein                                 90.5    1e-17   Genlisea aurea
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006372265.1|  hypothetical protein POPTR_0018s14790g           91.7    1e-17   
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  92.8    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    1e-17   
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  92.4    1e-17   
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    1e-17   
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    1e-17   
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...  92.0    1e-17   
ref|XP_002894215.1|  hypothetical protein ARALYDRAFT_474107           91.7    2e-17   
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    2e-17   
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g           91.3    2e-17   
gb|KJB54162.1|  hypothetical protein B456_009G023700                  91.7    2e-17   
ref|XP_011019927.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    2e-17   
ref|XP_002308303.1|  hypothetical protein POPTR_0006s15750g           90.5    2e-17   
gb|KJB54163.1|  hypothetical protein B456_009G023700                  92.0    2e-17   
ref|XP_009408506.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    2e-17   
ref|XP_004171357.1|  PREDICTED: uncharacterized protein At4g06744...  90.9    2e-17   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051           91.7    2e-17   
ref|XP_004137106.1|  PREDICTED: uncharacterized protein At4g06744...  90.1    2e-17   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g           91.3    2e-17   
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    2e-17   
ref|XP_010691719.1|  PREDICTED: uncharacterized protein At4g06744...  90.9    2e-17   
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    3e-17   
gb|KDP24107.1|  hypothetical protein JCGZ_25764                       90.1    3e-17   
ref|XP_010047660.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    3e-17   
ref|XP_008794093.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  90.1    3e-17   
ref|XP_011007265.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    3e-17   
gb|KHM99821.1|  Leucine-rich repeat extensin-like protein 6           90.1    3e-17   
gb|KCW82299.1|  hypothetical protein EUGRSUZ_C03706                   90.1    3e-17   
ref|XP_010049599.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    3e-17   
ref|XP_007013716.1|  Leucine-rich repeat family protein               91.3    3e-17   
gb|EMT28947.1|  hypothetical protein F775_27022                       88.2    3e-17   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...  91.3    4e-17   
gb|KJB12465.1|  hypothetical protein B456_002G019800                  89.4    4e-17   
gb|KGN43905.1|  hypothetical protein Csa_7G073410                     90.1    4e-17   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    4e-17   
ref|XP_006451102.1|  hypothetical protein CICLE_v100107081mg          86.7    4e-17   
ref|XP_003525293.2|  PREDICTED: leucine-rich repeat extensin-like...  89.7    4e-17   
ref|XP_002455880.1|  hypothetical protein SORBIDRAFT_03g026730        90.9    5e-17   
emb|CDY68356.1|  BnaA09g55960D                                        89.4    5e-17   
ref|XP_001759047.1|  predicted protein                                90.1    5e-17   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...  90.9    5e-17   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                     90.9    5e-17   
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    5e-17   
emb|CDP07600.1|  unnamed protein product                              90.1    6e-17   
ref|NP_175397.1|  leucine-rich repeat (LRR) family protein            90.1    6e-17   
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                 90.1    6e-17   
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    6e-17   
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    6e-17   
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    6e-17   
ref|XP_002992971.1|  hypothetical protein SELMODRAFT_136258           87.4    6e-17   
ref|XP_009117517.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    6e-17   
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    6e-17   
ref|XP_002991811.1|  hypothetical protein SELMODRAFT_134330           87.4    7e-17   
ref|XP_007043626.1|  Leucine-rich repeat family protein               89.0    7e-17   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                       90.5    7e-17   
ref|XP_006354850.1|  PREDICTED: uncharacterized protein At4g06744...  88.6    7e-17   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    7e-17   
gb|KDP41694.1|  hypothetical protein JCGZ_16101                       89.0    7e-17   
ref|XP_009406957.1|  PREDICTED: pollen-specific leucine-rich repe...  88.6    8e-17   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg           89.4    8e-17   
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    8e-17   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    8e-17   
ref|XP_006361150.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    9e-17   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...  90.1    9e-17   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                  90.1    9e-17   
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    9e-17   
emb|CDX81947.1|  BnaC08g36540D                                        88.2    1e-16   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                       87.8    1e-16   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4      90.1    1e-16   
ref|NP_001043463.1|  Os01g0594300                                     89.4    1e-16   
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...  88.2    1e-16   
gb|KJB65054.1|  hypothetical protein B456_010G078700                  88.2    1e-16   
dbj|BAB91812.1|  extensin precursor-like                              89.4    1e-16   
ref|XP_011092901.1|  PREDICTED: pollen-specific leucine-rich repe...  90.1    1e-16   
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...  89.4    1e-16   
ref|XP_008357497.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.4    1e-16   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099           89.7    1e-16   
emb|CDO97126.1|  unnamed protein product                              89.4    1e-16   
ref|XP_010664550.1|  PREDICTED: uncharacterized protein At4g06744...  88.2    1e-16   
gb|KGN43906.1|  hypothetical protein Csa_7G073420                     88.6    1e-16   
ref|XP_008378297.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    1e-16   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                 87.8    1e-16   
dbj|BAJ86997.1|  predicted protein                                    87.4    2e-16   
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg           87.8    2e-16   
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...  87.8    2e-16   
emb|CDY03339.1|  BnaC09g10090D                                        87.4    2e-16   
ref|XP_002284965.1|  PREDICTED: uncharacterized protein At4g06744...  88.2    2e-16   
ref|XP_008454973.1|  PREDICTED: uncharacterized protein At4g06744...  88.6    2e-16   
gb|KEH30699.1|  LRR/extensin                                          87.8    2e-16   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.4    2e-16   
ref|XP_001769850.1|  predicted protein                                86.7    2e-16   
ref|XP_008454972.1|  PREDICTED: uncharacterized protein At4g06744...  87.8    2e-16   
emb|CDY18974.1|  BnaC01g20940D                                        87.4    2e-16   
ref|NP_194653.1|  leucine-rich repeat-containing protein              87.8    2e-16   
ref|XP_006849391.1|  hypothetical protein AMTR_s00160p00027170        87.4    2e-16   
ref|XP_002869445.1|  leucine-rich repeat family protein               87.4    2e-16   
gb|AES90113.2|  Serine/Threonine kinase, plant-type protein, puta...  88.2    2e-16   
ref|XP_007198810.1|  hypothetical protein PRUPE_ppa026805mg           87.4    2e-16   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...  89.0    2e-16   
emb|CDY72552.1|  BnaCnng78240D                                        87.0    2e-16   
ref|XP_010433232.1|  PREDICTED: pollen-specific leucine-rich repe...  87.0    2e-16   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...  89.0    2e-16   
ref|XP_009118117.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    2e-16   
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2         89.0    2e-16   
gb|KJB27056.1|  hypothetical protein B456_004G274900                  87.8    3e-16   
ref|XP_003567675.1|  PREDICTED: pollen-specific leucine-rich repe...  88.2    3e-16   
ref|XP_006842252.1|  hypothetical protein AMTR_s00078p00197410        89.0    3e-16   
gb|EPS73249.1|  hypothetical protein M569_01507                       87.0    3e-16   
ref|XP_010925512.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    3e-16   
emb|CDY26536.1|  BnaA09g47410D                                        88.2    3e-16   
ref|XP_008224557.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    3e-16   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1         88.6    3e-16   
gb|AGT16787.1|  Leucine rich repeat protein                           88.2    3e-16   
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    3e-16   
ref|XP_010688564.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    3e-16   
ref|XP_011018198.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  87.8    4e-16   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    4e-16   
emb|CDY15964.1|  BnaC08g41590D                                        87.8    4e-16   
ref|XP_004170987.1|  PREDICTED: uncharacterized protein At4g06744...  85.9    4e-16   
gb|AEK28682.1|  leucine rich repeat family protein                    84.0    4e-16   
emb|CDY49661.1|  BnaC09g41390D                                        86.7    4e-16   
ref|XP_002437554.1|  hypothetical protein SORBIDRAFT_10g029260        88.2    4e-16   
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    4e-16   
ref|XP_010251729.1|  PREDICTED: pollen-specific leucine-rich repe...  87.8    4e-16   
ref|XP_009800281.1|  PREDICTED: pollen-specific leucine-rich repe...  87.8    4e-16   
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    4e-16   
ref|XP_009613983.1|  PREDICTED: leucine-rich repeat extensin-like...  87.4    5e-16   
ref|XP_007225572.1|  hypothetical protein PRUPE_ppa019759m1g          87.0    5e-16   
ref|XP_010092426.1|  Leucine-rich repeat extensin-like protein 6      86.7    5e-16   
ref|XP_009377376.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    5e-16   
ref|XP_010541003.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    5e-16   
ref|XP_004242113.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    6e-16   
ref|XP_002964014.1|  hypothetical protein SELMODRAFT_81544            85.9    6e-16   
ref|XP_008798454.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    6e-16   
dbj|BAJ91841.1|  predicted protein                                    87.0    7e-16   
ref|XP_002517887.1|  serine-threonine protein kinase, plant-type,...  86.3    7e-16   
ref|XP_002889910.1|  hypothetical protein ARALYDRAFT_312231           87.0    7e-16   
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    7e-16   
ref|XP_006299675.1|  hypothetical protein CARUB_v10015862mg           85.9    7e-16   
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...  87.4    7e-16   
ref|XP_011081863.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    7e-16   
emb|CDY48727.1|  BnaA09g10020D                                        85.5    7e-16   
ref|XP_002982230.1|  hypothetical protein SELMODRAFT_54019            85.9    8e-16   
gb|EPS67596.1|  hypothetical protein M569_07180                       85.9    8e-16   
ref|XP_003524389.2|  PREDICTED: leucine-rich repeat extensin-like...  87.0    8e-16   
ref|XP_008371522.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    8e-16   
ref|XP_004296668.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    8e-16   
ref|XP_010438472.1|  PREDICTED: pollen-specific leucine-rich repe...  85.5    8e-16   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    9e-16   
ref|XP_010447991.1|  PREDICTED: pollen-specific leucine-rich repe...  85.5    9e-16   
ref|XP_008225431.1|  PREDICTED: pollen-specific leucine-rich repe...  87.4    9e-16   
ref|XP_008361263.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    1e-15   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    1e-15   
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg           85.5    1e-15   
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    1e-15   
ref|XP_010915366.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    1e-15   
gb|KJB74832.1|  hypothetical protein B456_012G009700                  86.7    1e-15   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    1e-15   
ref|XP_003602966.1|  Serine/threonine protein kinase BRI1-like pr...  86.7    1e-15   
gb|KHN21547.1|  Leucine-rich repeat extensin-like protein 5           86.3    1e-15   
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
gb|KJB74831.1|  hypothetical protein B456_012G009700                  86.3    1e-15   
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    1e-15   
ref|XP_006582471.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    1e-15   
gb|EPS67208.1|  hypothetical protein M569_07569                       84.3    1e-15   
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    1e-15   
ref|NP_001147644.1|  receptor protein kinase CLAVATA1 precursor       85.1    1e-15   
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg           86.7    1e-15   
ref|XP_010694037.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    1e-15   
ref|XP_008798585.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    1e-15   
ref|XP_004137107.1|  PREDICTED: uncharacterized protein At4g06744...  85.9    1e-15   
ref|XP_003620758.1|  Leucine-rich repeat receptor protein kinase EXS  85.5    1e-15   
ref|XP_009389012.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    1e-15   
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    1e-15   
gb|KCW60691.1|  hypothetical protein EUGRSUZ_H03422                   84.0    1e-15   
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg              85.5    1e-15   
ref|XP_010024229.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    1e-15   
ref|XP_006451343.1|  hypothetical protein CICLE_v10008452mg           84.7    2e-15   
ref|XP_006855188.1|  hypothetical protein AMTR_s00051p00142580        85.5    2e-15   
ref|XP_003630813.1|  Extensin-like protein                            86.3    2e-15   
ref|XP_009112629.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    2e-15   
ref|NP_001175075.1|  Os07g0176400                                     84.0    2e-15   
ref|XP_006451344.1|  hypothetical protein CICLE_v10008452mg           85.1    2e-15   
gb|AGT16949.1|  hypothetical protein SHCRBa_028_D11_F_270             86.3    2e-15   
gb|EYU28282.1|  hypothetical protein MIMGU_mgv1a024954mg              81.6    2e-15   
ref|XP_009409048.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    2e-15   
ref|XP_010921838.1|  PREDICTED: pollen-specific leucine-rich repe...  85.5    2e-15   
ref|XP_009336235.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    2e-15   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    2e-15   
ref|XP_003523588.1|  PREDICTED: pollen-specific leucine-rich repe...  85.5    2e-15   
ref|XP_009798822.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    2e-15   
dbj|BAD53794.1|  putative extensin                                    85.5    2e-15   
gb|KEH27082.1|  LRR extensin-like protein                             86.3    2e-15   
ref|XP_002310403.2|  hypothetical protein POPTR_0007s01000g           84.0    2e-15   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg           84.3    2e-15   
ref|XP_009376329.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    2e-15   
gb|EAZ02952.1|  hypothetical protein OsI_25092                        84.3    2e-15   
ref|XP_003620502.1|  Extensin-like protein                            85.9    2e-15   
ref|NP_179568.1|  leucine-rich repeat-containing protein              84.3    2e-15   
ref|XP_009773829.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    2e-15   
ref|XP_008342893.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    2e-15   
ref|XP_006351117.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    2e-15   
gb|AGT17110.1|  hypothetical protein SHCRBa_170_G03_R_510             85.5    2e-15   
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    3e-15   
ref|XP_007202178.1|  hypothetical protein PRUPE_ppa006630mg           84.3    3e-15   
ref|XP_001780811.1|  predicted protein                                83.2    3e-15   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    3e-15   
ref|XP_004239326.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    3e-15   
gb|AGT17203.1|  hypothetical protein SHCRBa_102_P01_R_230             85.5    3e-15   
ref|XP_007014601.1|  Leucine-rich repeat/extensin 2                   85.5    3e-15   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    3e-15   
ref|XP_007157715.1|  hypothetical protein PHAVU_002G092200g           84.7    3e-15   
emb|CDY19550.1|  BnaC09g13530D                                        85.5    3e-15   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    3e-15   
ref|XP_007136648.1|  hypothetical protein PHAVU_009G062000g           85.1    3e-15   
ref|XP_007214112.1|  hypothetical protein PRUPE_ppa017121mg           85.5    3e-15   
gb|ACF82634.1|  unknown                                               83.2    3e-15   
gb|EMD88368.1|  hypothetical protein COCHEDRAFT_1216289               82.8    3e-15   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg              84.3    3e-15   
ref|XP_008225416.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    4e-15   



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 129/184 (70%), Gaps = 10/184 (5%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            L   +RK IK I+ FKK+IT DP  +T++W GN++C   +KY GF CY      K  V  
Sbjct  147  LTAELRKVIKVIQNFKKTITSDPFGVTKTWVGNDIC---RKYVGFTCY------KNHVVA  197

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKL  587
            I FNG+ FNG+ LSL  F+E    LV+IH+NSNNFTG+ P I  +  P LFELDLSNNKL
Sbjct  198  IDFNGFRFNGSQLSLRKFIEEIKTLVIIHLNSNNFTGSVPEISTKTLPKLFELDLSNNKL  257

Query  588  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            AG FP AVL ATNLTYLD+RFN LTGPV PQVFTLDLD LFLNNN FSG +P+  G T  
Sbjct  258  AGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTLDLDVLFLNNNGFSGEIPETFGRTAA  317

Query  768  FFLT  779
             F+T
Sbjct  318  LFIT  321



>emb|CDP02527.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            L   ++ +I+ I+ FK+ I  DP  +T++W GN +C +K KY+GF C      +K RV G
Sbjct  115  LSEELKMAIQVIQRFKRRIKSDPFCVTKTWTGNRICYDKSKYKGFVCDRSTKDNKFRVVG  174

Query  411  iyfngynfngng---lslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNN  581
            + FNG+NF+G     L    FVE   DLV+ HVNSNNFTG     + K P  FE DLSNN
Sbjct  175  VNFNGFNFDGGPGCPLVATDFVEDLKDLVIFHVNSNNFTGDIPFGISKLPNFFEFDLSNN  234

Query  582  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGST  761
            KL GAFP A L ATNLTYLD+RFN LTG + PQ FTLDLD LFLNNN FSG +P NLG T
Sbjct  235  KLVGAFPAAALGATNLTYLDVRFNQLTGTIPPQAFTLDLDVLFLNNNAFSGKIPGNLGQT  294

Query  762  PVFFLT  779
            PV +LT
Sbjct  295  PVLYLT  300



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 123/186 (66%), Gaps = 3/186 (2%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            L   ++ +I+ I+ FK+ I YDP  IT++W G  +C +  KY+GF C      +K RV G
Sbjct  110  LSKELKMAIQVIQRFKRRIKYDPFGITKTWTGKRICFDNSKYKGFVCDRSTKDNKFRVVG  169

Query  411  iyfngynfngng---lslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNN  581
            + FNGYNFNG     L    F+E   DLV+ HVNSNNFTG     + K P  FE DLSNN
Sbjct  170  VNFNGYNFNGGPGCPLVATDFIEDLKDLVIFHVNSNNFTGDIPFGISKLPNFFEFDLSNN  229

Query  582  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGST  761
            KL GAFP A L ATNLTYLD+RFN LTG + PQ FTLDLD LFLNNN FSG +P NLG T
Sbjct  230  KLVGAFPAAALGATNLTYLDVRFNQLTGTIPPQAFTLDLDVLFLNNNAFSGKIPGNLGQT  289

Query  762  PVFFLT  779
            PV +LT
Sbjct  290  PVLYLT  295



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 1/183 (1%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            L P +  ++K I  F+++IT DP  +T++W+G  +C +K  Y+GF C       K RV  
Sbjct  123  LTPELLVAVKVIEKFRQTITKDPLGVTKTWKG-RICADKSAYRGFTCDTTISDGKVRVAL  181

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
            + FNG+NF+GN L+L +F++   DL+V HVN+NNF G     + K PTL+ELDLSNNKLA
Sbjct  182  VNFNGFNFSGNPLALTNFIDGLTDLIVFHVNTNNFAGQVPAGISKLPTLYELDLSNNKLA  241

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP  VL ATNLT+LDLRFN LTG + P VFTLDLD LFLNNN F+G +P+ LG TPV 
Sbjct  242  GEFPKPVLAATNLTFLDLRFNQLTGKLPPAVFTLDLDVLFLNNNQFTGNIPETLGKTPVL  301

Query  771  FLT  779
            +LT
Sbjct  302  YLT  304



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 127/184 (69%), Gaps = 11/184 (6%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            L   +R+ IK I+ FKK+IT DP  +T++W GN++C     Y+G+ CY      K  V  
Sbjct  147  LTAELREVIKVIQKFKKTITSDPFGVTRTWVGNDVCC----YKGYTCY------KNHVVA  196

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLSNNKL  587
            I FNG++ NGN L+LN+F+E    LVVIH+NSNNFT   P I  +  P LFE DLSNNKL
Sbjct  197  IDFNGFHLNGNQLALNNFIEKIKTLVVIHLNSNNFTSPVPEISTKTHPKLFEFDLSNNKL  256

Query  588  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            AG FP AVL ATNLTYLD+RFN LTGPV PQVFTLDLD LFLNNN FSG +P+  G T  
Sbjct  257  AGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTLDLDVLFLNNNGFSGEIPETFGRTAA  316

Query  768  FFLT  779
             F+T
Sbjct  317  LFIT  320



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 120/182 (66%), Gaps = 8/182 (4%)
 Frame = +3

Query  240  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            ++  +I  I+ F+K+IT DP  IT++WEGN++C +  KY GF C      +  +V  + F
Sbjct  17   LLASAISVIKRFRKTITSDPSGITKTWEGNDICKDPTKYIGFIC------NNNKVVAVNF  70

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAG  593
            NG NF GN LSL  F+     L + H NSNNFTG     I  Q  P LFELDLSNNK  G
Sbjct  71   NGRNFKGNPLSLKDFINGIPTLEIFHSNSNNFTGEIPNNISTQSIPNLFELDLSNNKYVG  130

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP AVL AT LTYLDLRFN + GPV+PQVFTLDLD LFLNNN FSG +P+NLG T   +
Sbjct  131  FFPKAVLGATRLTYLDLRFNQIKGPVNPQVFTLDLDILFLNNNCFSGKIPENLGRTAALY  190

Query  774  LT  779
            LT
Sbjct  191  LT  192



>ref|XP_004233445.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=464

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 118/184 (64%), Gaps = 8/184 (4%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            + ++  +I  I+ FKK+IT DP  IT++W G ++C +  KY GF C      +K +V  +
Sbjct  93   NDLLTSAISVIQRFKKTITSDPSGITKTWVGKDICKDSTKYVGFIC------NKNKVVAV  146

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKL  587
             FNG NF GN LSL  F+     L + H NSNNFTG     I  Q  P LFELDLSNNK 
Sbjct  147  NFNGRNFKGNPLSLKDFINGIPTLEIFHSNSNNFTGEIPNNISTQSIPNLFELDLSNNKY  206

Query  588  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             G FP AVL AT LTYLDLRFN + GPV PQVFTLDLD LFLNNN FSG +P+N G T  
Sbjct  207  VGLFPRAVLGATRLTYLDLRFNQIEGPVDPQVFTLDLDILFLNNNQFSGKIPENFGRTAA  266

Query  768  FFLT  779
             +LT
Sbjct  267  LYLT  270



>ref|XP_011099103.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=487

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 119/178 (67%), Gaps = 1/178 (1%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            ++ ++K I  F+++IT DP NIT++W G  +C +K  Y+GF C      +K  V  + FN
Sbjct  118  LQMAVKVIERFRRTITEDPFNITKTWTG-RICKDKHAYRGFACDTTIRDNKTVVAYVLFN  176

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            G+ F G  L L +F+    DL+V H N+N FTG     + K P+LFE DLSNN+L+G FP
Sbjct  177  GFRFKGKPLKLENFLGGLKDLIVFHANTNFFTGGVPSGISKIPSLFEFDLSNNRLSGGFP  236

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
             AVL ATNLT+LDLRFN LTG + P+VF LDLD LFLNNN F G +P+ LG TPV +L
Sbjct  237  RAVLAATNLTFLDLRFNQLTGKLPPEVFRLDLDVLFLNNNHFEGDIPETLGKTPVRYL  294



>ref|XP_010555995.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=481

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            IRK+I  I+ F+  I  DP++IT++W G ++C + K Y GF C +  G     V  + FN
Sbjct  110  IRKAIPVIQRFRGLIECDPKDITRTWNGTDVCADDK-YVGFDCAIYPGTKDLAVASVRFN  168

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  599
             +NF+G  L L++F++   ++ + H NSN F G+  +P V+    LFELDLSNNKL+G F
Sbjct  169  EFNFSGKNLRLDNFLDKLEEVTIFHANSNQFVGS--VPRVENLKYLFELDLSNNKLSGEF  226

Query  600  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            P++VL+A NLT+LDLRFN L+G V PQVF LD+D LF+NNN     LPDNLGS    +LT
Sbjct  227  PSSVLQAKNLTFLDLRFNSLSGSVPPQVFNLDVDVLFINNNNLVQRLPDNLGSITALYLT  286



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 116/179 (65%), Gaps = 3/179 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I+ + K I+ FKK ITYDPQ I ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  81   IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  137

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  138  GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKFLYELDVSNNKLFGGFP  197

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              V+   NLT+LDLRFN  +GPV  ++F LDLD LFLNNN FS  LP+N+GST   ++T
Sbjct  198  MEVVNIKNLTFLDLRFNSFSGPVPAEIFYLDLDVLFLNNNKFSQNLPENIGSTGALYVT  256



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I+ + K I+ FKK ITYDPQ I  +W G ++C    KY+GF C V     KK V G+ FN
Sbjct  126  IQLAFKVIQRFKKRITYDPQGIANTWMGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  182

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  183  GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKFLYELDVSNNKLFGGFP  242

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              V+   NLT+LDLRFN  +GPV  ++F LDLD LFLNNN FS  LP+N+GST   ++T
Sbjct  243  MEVVNIKNLTFLDLRFNSFSGPVPAEIFYLDLDVLFLNNNKFSQNLPENIGSTGALYVT  301



>ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=497

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 6/183 (3%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I K+   I+ FK  I  DP+   ++W+GN +C    KY+GF C        K V  + 
Sbjct  124  PLIAKAYPVIQNFKTQIFSDPKGYAKTWKGNNVC----KYKGFTCATRPDLKLKAVAAVD  179

Query  417  fngynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
            FN     G+G  L  + F++  +DL + H NSNNFTG     V K   L+ELDLSNNK+ 
Sbjct  180  FNAALLAGHGSCLPLDGFIDKLDDLAIFHANSNNFTGTVPFGVSKIKYLYELDLSNNKIN  239

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP  VL A+NLT+LD+RFN L G V  QVF LDLD LF+NNN     LPDNLG TPV 
Sbjct  240  GDFPMEVLGASNLTFLDIRFNSLKGEVPQQVFKLDLDVLFINNNNLEQTLPDNLGDTPVL  299

Query  771  FLT  779
            +LT
Sbjct  300  YLT  302



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I+ + K I+ FKK ITYDPQ I ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  137  IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  193

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  194  GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKYLYELDVSNNKLFGGFP  253

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
               +   NLT+LDLRFN  +GPV  ++F LDLD LFLNNN FS  LP+N+GST   ++T
Sbjct  254  LEAVNIKNLTFLDLRFNSFSGPVPAEIFYLDLDVLFLNNNKFSQNLPENIGSTGALYVT  312



>ref|XP_010519298.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=451

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            + P+I K    I+ F+K + YDP+N  ++WEG ++C  K KY G  C +  G +   V  
Sbjct  78   VSPLIEKVFPVIKRFQKLVEYDPKNKLKTWEGYDVCA-KDKYVGLECAIYPGTNYLAVAS  136

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKL  587
            + FN +N  G  L L++F++   ++ + H NSNNF G+  +P V K   L+ELD+S+NKL
Sbjct  137  VQFNEFNLAGKQLRLDNFLDKLEEVTIFHANSNNFVGS--VPRVDKLKYLYELDISSNKL  194

Query  588  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            +G FP++VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP+NLGS   
Sbjct  195  SGEFPSSVLQAKNLTFLDLRFNSFSGMVPPQVFNLDLDVLFINNNNLVQNLPENLGSITA  254

Query  768  FFLT  779
             +LT
Sbjct  255  LYLT  258



>ref|XP_011088225.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=460

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC--YVPRGGDKKRVggiyfngynfn  437
            I+ FK+ I YDP  IT++W G ++C    KY+GF C   +P G  +K + G+ FNG+N +
Sbjct  97   IQKFKQKIKYDPYGITKTWIGPDIC---NKYKGFICDTLIPLG--EKALAGVKFNGFNLD  151

Query  438  gnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLE  617
            G  L+L+SF++   D++V H NSNNF GA  + + K   L+ELDLSNNK +  FP  VL 
Sbjct  152  GPDLNLDSFIDELPDIMVFHANSNNFKGAFPLKISKIKYLYELDLSNNKYSCEFPYEVLG  211

Query  618  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            AT LT+LDLRFN   G + PQVF LD+D L+LNNN F+  LPDNLGSTP  +LT
Sbjct  212  ATKLTFLDLRFNSFYGMLPPQVFMLDVDVLYLNNNNFTQKLPDNLGSTPALYLT  265



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 108/183 (59%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +  +   I+TFK  IT DP N+TQ+W G+++C    KYQGF+C  P   +K  V  
Sbjct  57   LDQRLAVAYPIIQTFKALITSDPLNVTQTWVGSDIC----KYQGFYCDNPPD-NKSAVAI  111

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     +L+ F++S  DL + H NSNNF+G     +   P L+ELDLSNN+L+
Sbjct  112  AGIDFNGFQLTASTLDGFIDSLPDLAIFHANSNNFSGTITPKIASLPYLYELDLSNNQLS  171

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP A+L  T+L++ D+RFN  TG V  Q+F    D LFLNNN F   LP N GST   
Sbjct  172  GTFPVAILSVTDLSFFDIRFNFFTGFVPQQLFVKSFDFLFLNNNNFGMKLPINFGSTTTS  231

Query  771  FLT  779
            ++T
Sbjct  232  YIT  234



>ref|XP_008236575.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=423

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I  FK +IT DP  ITQ+W G+++C     Y+GF+C +P   +K  V     +   F  +
Sbjct  76   INAFKNTITSDPLGITQTWVGSDIC----TYKGFYCDIPPD-NKSAVALASIDFNGFQLS  130

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              S++ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  131  APSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGTFPTAVLTMN  190

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++LD+RFN  TG V PQ+F   LD LF+NNN F+  LPDNLG+TP  +LT
Sbjct  191  SLSFLDIRFNSFTGSVPPQIFKKSLDVLFINNNKFTLKLPDNLGATPARYLT  242



>gb|KDO59786.1| hypothetical protein CISIN_1g048561mg, partial [Citrus sinensis]
Length=382

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 108/183 (59%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+TFK +IT DP NIT +W G+++C    KY+GF+C  P   +   +  
Sbjct  15   LDQRLAAIYPIIQTFKNTITSDPFNITSTWIGSDIC----KYKGFYCGHPPD-NLTAIAL  69

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     +L+ F++   DL + H NSN F+G     + + P L+ELD+SNNK +
Sbjct  70   ASIDFNGFELAAPTLDGFIDQLPDLSLFHANSNKFSGTISPKLAQLPYLYELDISNNKFS  129

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP A+L   +L++LD+RFN  TG V PQVF   LD LFLNNN F   LP NLGSTP  
Sbjct  130  GTFPVAILGKNDLSFLDIRFNFFTGSVPPQVFMQTLDVLFLNNNNFMQKLPQNLGSTPAL  189

Query  771  FLT  779
            +LT
Sbjct  190  YLT  192



>ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=418

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 108/183 (59%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I++FK  +T DP NITQSW G+++C     Y+GF+C  P   +   +  
Sbjct  51   LDQRLATVYPIIQSFKAIVTSDPLNITQSWVGSDIC----NYRGFYCDNPPD-NLSAIAL  105

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN  +
Sbjct  106  AAIDFNGFQLAAPSLDGFIDQLPDLAIFHANSNNFSGTISPKIANLQYLYELDLSNNNFS  165

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FPTAVL  T L +LD+RFN  TG V PQVF L LD LFLNNN F   LP+NLG+TPV 
Sbjct  166  GNFPTAVLSITGLFFLDIRFNFFTGSVPPQVFALRLDVLFLNNNNFMQKLPENLGTTPVP  225

Query  771  FLT  779
            +LT
Sbjct  226  YLT  228



>ref|XP_006487027.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=418

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 108/183 (59%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+TFK +IT DP NIT +W G+++C    KY+GF+C  P   +   +  
Sbjct  51   LDQRLAAIYPIIQTFKNTITSDPFNITSTWIGSDIC----KYKGFYCGHP-PDNLTAIAL  105

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     +L+ F++   DL + H NSN F+G     + + P L+ELD+SNNK +
Sbjct  106  ASIDFNGFELAAPTLDGFIDQLPDLSLFHANSNKFSGTISPKLAQLPYLYELDISNNKFS  165

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP A+L   +L++LD+RFN  TG V PQVF   LD LFLNNN F   LP NLGSTP  
Sbjct  166  GTFPVAILGKNDLSFLDIRFNFFTGSVPPQVFMQTLDVLFLNNNNFMQKLPQNLGSTPAL  225

Query  771  FLT  779
            +LT
Sbjct  226  YLT  228



>gb|KHN22492.1| Hypothetical protein glysoja_041167 [Glycine soja]
Length=410

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 108/172 (63%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP  +T++W G+++C     Y+GF+C +P   +         +   F  +
Sbjct  74   IQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDIPPD-NSSATALASIDLNGFQLS  128

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FPTAVL   
Sbjct  129  ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPTAVLGMN  188

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +LT+LDLRFN  +G V PQ+FT +L  LF+NNN F+  LPDNL ST +  LT
Sbjct  189  SLTFLDLRFNSFSGEVPPQIFTQNLQVLFINNNIFTQGLPDNLASTHILLLT  240



>ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=435

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 108/172 (63%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP  +T++W G+++C     Y+GF+C +P   +         +   F  +
Sbjct  99   IQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDIPPD-NSSATALASIDLNGFQLS  153

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FPTAVL   
Sbjct  154  ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPTAVLGMN  213

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +LT+LDLRFN  +G V PQ+FT +L  LF+NNN F+  LPDNL ST +  LT
Sbjct  214  SLTFLDLRFNSFSGEVPPQIFTQNLQVLFINNNIFTQGLPDNLASTHILLLT  265



>ref|XP_006472980.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=429

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 106/173 (61%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K  +     +   F  
Sbjct  91   VIQEFKSIITSDPLGITKTWVGSDIC----DYKGFYCESPPD-NKTAIAVASIDFNGFQL  145

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
            +  +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL  
Sbjct  146  SAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGM  205

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             NL +LD+RFN  TG V PQ+FT +LD LF+NNN F   LPDN+GST + FLT
Sbjct  206  NNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLT  258



>ref|XP_007160878.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
 gb|ESW32872.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
Length=427

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP  +T +W G+++C     Y+GF+C  P   +         +   F   
Sbjct  92   IQKFKSTITSDPLGVTNTWVGSDIC----SYKGFYCDTPPD-NTSATALASIDFNGFQLA  146

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FP+AVL  +
Sbjct  147  ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPSAVLGLS  206

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LDLRFN  +GPV PQ+F  +L  LF+NNN F+  LPDNL +T +  LT
Sbjct  207  TLTFLDLRFNFFSGPVPPQIFIQNLQVLFINNNIFTQGLPDNLATTQILLLT  258



>ref|XP_010466072.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=469

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I+K    I+ F+K I  DP+ I ++W G ++C  + KY G  C    G +   +G I 
Sbjct  98   PLIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDKYIGLECAKFPGTNDDALGSIQ  156

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +NF G  L L++F++   ++ + H NSNNF G+  +P +     LFELDLSNNKL+G
Sbjct  157  FNNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKLNNLKYLFELDLSNNKLSG  214

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD  F+N+N  +  LPDNLGS    +
Sbjct  215  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVFFINDNNLAQRLPDNLGSITALY  274

Query  774  LT  779
            LT
Sbjct  275  LT  276



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 107/181 (59%), Gaps = 7/181 (4%)
 Frame = +3

Query  240  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            ++ ++ K I+ FK +IT DPQ IT SW+G  +C     Y GFFC +P      R      
Sbjct  88   LLYRAYKVIQKFKSTITCDPQGITNSWQGYNIC---STYNGFFCGIPPSRTTMR-NVASI  143

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  596
            +   +N    ++N FV+   DL + H NSNNF+G   +P + K P  +ELDLSNN L G+
Sbjct  144  DFNGYNLAAPTINGFVDQMPDLAIFHANSNNFSGT--VPDLTKLPFFYELDLSNNILMGS  201

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FPT VL   NLT+LDLRFN  +G V P VF + LD LF+NNN  + PLP  LG T   +L
Sbjct  202  FPTTVLPLANLTFLDLRFNQFSGCVPPGVFDIKLDVLFINNNNLNQPLPAELGRTTAAYL  261

Query  777  T  779
            T
Sbjct  262  T  262



>ref|XP_002313863.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
 gb|EEE87818.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
Length=424

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 104/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP +ITQ+W G ++C     Y+GF+C  P   D   +     +   F  +
Sbjct  64   IQDFKNTITSDPLDITQTWVGADIC----NYKGFYCTSPPDNDSA-ITLASIDFNGFQLS  118

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   G+FP  VL   
Sbjct  119  APTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFFGSFPMEVLAIP  178

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+RFN  TG V PQVFT  LD LFLNNN F   LP+NLGSTPV +LT
Sbjct  179  ALSFLDIRFNFFTGTVPPQVFTQRLDVLFLNNNNFMQGLPENLGSTPVLYLT  230



>ref|XP_009592678.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=425

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 107/183 (58%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK +IT DP  +TQSW G ++C     Y+GF+C  P   +   +  
Sbjct  60   LDQRLALIFPIIQNFKSTITLDPLGVTQSWTGPDIC----NYKGFYCDNPPY-NTSAISL  114

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     +L+ F++   DL V H NSNNF+G     + + P L+ELDLSNNK  
Sbjct  115  ASIDFNGFQLTAPTLDGFIDQLPDLAVFHANSNNFSGIISSKITQLPYLYELDLSNNKFI  174

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP ++L    LT+LD+R+N+ TG + PQ+FT +LDA FLNNN F   LPDNLGST   
Sbjct  175  GTFPLSILNIKTLTFLDIRYNLFTGIIPPQIFTQNLDAFFLNNNNFVQKLPDNLGSTSAL  234

Query  771  FLT  779
            +LT
Sbjct  235  YLT  237



>ref|XP_004291077.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=430

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP NIT+SW G+++C     Y+GF+C  P   +   +     +   F   
Sbjct  88   IQKFKSIITSDPLNITKSWVGSDIC----NYKGFYCDNPPY-NSSAIALASIDFNGFQLG  142

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN  +G+FPTAVL   
Sbjct  143  ASSLDGFLDQLPDIALFHANSNNFSGTISSKIANLPYLYELDISNNLFSGSFPTAVLGMN  202

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++LDLRFN  TG V PQ+FT DLDALFLNNN F   LPDNLGS+ +  LT
Sbjct  203  SLSFLDLRFNFFTGSVPPQIFTQDLDALFLNNNNFMQSLPDNLGSSHIILLT  254



>gb|KDO37099.1| hypothetical protein CISIN_1g037101mg, partial [Citrus sinensis]
Length=395

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   ++  +     +   F  +
Sbjct  71   IQEFKSIITSDPLGITKTWVGSDIC----NYKGFYCESPPD-NETAIAVASIDFNGFQLS  125

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL   
Sbjct  126  APTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMN  185

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            NL +LD+RFN  TG V PQ+FT +LD LF+NNN F   LPDN+GST + FLT
Sbjct  186  NLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLT  237



>ref|XP_006346520.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=397

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP  +T++W G ++C     Y+GF+C  P   +   +     +   F  +
Sbjct  43   IQNFKNTITLDPFGVTKTWTGPDIC----NYKGFYCDNPPN-NSSAISLASIDFNGFQLS  97

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H N+NNF+G     +   P L+ELDLSNN+  G FP ++L   
Sbjct  98   APTLDGFIDQLPDLAIFHANTNNFSGIISSKISNLPYLYELDLSNNQFIGTFPMSILNIK  157

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+R+N+LTG + PQ+F   LDA FLNNN F   LPDN+GSTP ++LT
Sbjct  158  TLTFLDIRYNLLTGIIPPQIFVQYLDAFFLNNNNFIQKLPDNIGSTPAYYLT  209



>ref|XP_006433575.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
 gb|ESR46815.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
Length=429

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   ++  +     +   F  +
Sbjct  92   IQEFKSIITSDPLGITKTWVGSDIC----NYKGFYCESPPD-NETAIAVASIDFNGFQLS  146

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL   
Sbjct  147  APTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMN  206

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            NL +LD+RFN  TG V PQ+FT +LD LF+NNN F   LPDN+GST + FLT
Sbjct  207  NLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLT  258



>ref|XP_011000899.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=423

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP NITQ+W G ++C     Y+GF+C  P   D   +     +   F  +
Sbjct  64   IQDFKNTITSDPLNITQTWVGADIC----NYRGFYCTSPPDNDSA-ITLASIDFNGFQLS  118

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H NSN F+GA    + K   L+ELD+SNN   G+FP  VL   
Sbjct  119  APTLDGFIDQLPDLALFHANSNKFSGAISPKITKLQFLYELDISNNNFFGSFPMEVLGIP  178

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+RFN  TG V PQVFT  LD LFLNNN F   LP NLGSTPV +LT
Sbjct  179  ALSFLDIRFNFFTGTVPPQVFTQRLDVLFLNNNNFMQRLPQNLGSTPVLYLT  230



>ref|XP_009784047.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=426

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 106/183 (58%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK +IT DP  +TQSW G  +C     Y+GF+C  P   +   +  
Sbjct  61   LDQRLALIFPIIQNFKNTITLDPLGVTQSWTGPNIC----NYKGFYCDNPPY-NTSAISL  115

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     +L+ F++   DL + H NSNNF+G     + + P L+ELDLSNNK  
Sbjct  116  ASIDFNGFQLTAPTLDGFIDQLPDLAIFHANSNNFSGIISSKITQLPYLYELDLSNNKFI  175

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP +VL    LT+LD+R+N+ TG + PQ+FT +LDA FLNNN F   LPDNLGST   
Sbjct  176  GTFPLSVLNIKTLTFLDIRYNLFTGIIPPQIFTQNLDAFFLNNNNFIQKLPDNLGSTTAL  235

Query  771  FLT  779
            +LT
Sbjct  236  YLT  238



>ref|XP_010107857.1| Uncharacterized protein L484_027444 [Morus notabilis]
 gb|EXC17257.1| Uncharacterized protein L484_027444 [Morus notabilis]
Length=420

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 95/172 (55%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+TFK  IT DP  IT++W G++LC    KY GF+C  P   D   V             
Sbjct  60   IQTFKNIITSDPLGITKTWVGSDLC----KYAGFYCGTPPDNDTATVIASIDFNGFGLSA  115

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
                  F++   DL + H NSNNFTG     +     LFELDLSNN L G FPTAVL  T
Sbjct  116  PTLDG-FLDQLPDLAIFHANSNNFTGTISPKIANLRYLFELDLSNNNLVGTFPTAVLSMT  174

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++LD+RFN   G V P +F   LD LFLN+N F+  LP  +GST   +LT
Sbjct  175  SLSFLDIRFNSFAGVVPPHIFMQTLDFLFLNDNNFAQTLPQTIGSTSAAYLT  226



>ref|XP_007227115.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
 gb|EMJ28314.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
Length=482

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK +IT DP  IT++W G+ +C     Y+GF+C  P   +   +  
Sbjct  74   LDQKLEIVYPIIQKFKSTITSDPLGITKTWVGSNIC----SYRGFYCDNPPN-NGSAIAL  128

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     SL+ F++   D+ + H NSNNF+G     + K P L+ELDLSNN+ +
Sbjct  129  ASIDFNGFQLGASSLDGFLDQLPDIALFHANSNNFSGTISANIAKLPYLYELDLSNNQFS  188

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP+ VL  ++LT+LD+RFN  TG V PQ+FT DLDALF+NNN F   LPDNLGS+ + 
Sbjct  189  GPFPSVVLGMSSLTFLDIRFNFFTGSVPPQIFTQDLDALFINNNNFMQKLPDNLGSSHIL  248

Query  771  FLT  779
             LT
Sbjct  249  LLT  251



>ref|XP_008220262.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=464

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP  IT++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  120  IQKFKSTITSDPLGITKTWVGSNIC----SYRGFYCDNPPN-NSSAIALASIDFNGFQLG  174

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   D+ + H NSNNF+G     + K P L+ELDLSNN+ +G FP+ VL  +
Sbjct  175  ASSLDGFLDQLPDIALFHANSNNFSGTISANIAKLPYLYELDLSNNQFSGPFPSVVLGMS  234

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +LT+LD+RFN  TG V PQ+FT DLDALF+NNN F   LPDNLGS+ +  LT
Sbjct  235  SLTFLDIRFNFFTGSVPPQIFTQDLDALFINNNNFMQKLPDNLGSSHILLLT  286



>ref|XP_009107284.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=475

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+++K    ++ F+K +T DP +I ++WEG ++C NK KY G  C +      K +  I 
Sbjct  101  PLLKKVFPVLKAFQKLVTRDPMHILKTWEGTDIC-NKYKYLGLECAIFPNTTDKALASIQ  159

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FNG+NF G+ L L++F++  + + + H NSN+F G+  +P V     LFELDLSNNKL G
Sbjct  160  FNGFNFGGDKLVLHNFLDKLDTVTIFHANSNDFLGS--VPEVTNLKYLFELDLSNNKLTG  217

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP +VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  218  DFPASVLKAKNLTFLDLRFNTFSGCVPPQVFNLDLDVLFINNNNLVQTLPSNLGSITALY  277

Query  774  LT  779
            LT
Sbjct  278  LT  279



>emb|CDY29337.1| BnaA05g16040D [Brassica napus]
Length=475

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 117/182 (64%), Gaps = 6/182 (3%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+++K    ++ FKK +  DP+NI  SW G+++C    KY+G  C +  G   + V  + 
Sbjct  103  PLLKKVYPVLQAFKKLVEVDPKNILASWNGSDIC---GKYRGLECAMFPGTKYQAVASVQ  159

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FNG+NF+G  L L++F++  + + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  160  FNGFNFSGKNLRLDNFLDKLDTVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLTG  217

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP +VL+ATNLT+LDLRFN  +G V  QVF LDLD LF+NNN     LP NLGS    +
Sbjct  218  EFPASVLKATNLTFLDLRFNTFSGSVPRQVFNLDLDVLFINNNNLVQKLPHNLGSITALY  277

Query  774  LT  779
            LT
Sbjct  278  LT  279



>ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN55219.1| hypothetical protein Csa_4G641530 [Cucumis sativus]
Length=433

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 105/173 (61%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K        +   F  
Sbjct  87   VIQKFKSIITSDPLGITKTWVGSDIC----NYKGFYCDNPPD-NKSATAVASIDFNGFQL  141

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
            +  SL+ F++   D+ V H NSNNF+G     + K P L+ELD+SNN+L+G FPTAV+  
Sbjct  142  SAPSLDGFLDQLPDIAVFHANSNNFSGTISTNIAKLPYLYELDVSNNRLSGPFPTAVIGM  201

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             +LT+LDLRFN  TG V PQVF  DLD L +NNN F   LPD+L  T + +LT
Sbjct  202  NSLTFLDLRFNFFTGSVPPQVFVQDLDFLLINNNNFMQSLPDSLSITHILYLT  254



>ref|XP_011029410.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=430

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G+++C     Y+GFFC  P   +         +   F+  
Sbjct  88   IQKFKSLITSDPLGITKTWVGSDIC----NYKGFFCDSPPD-NNSATAVASIDFNGFHLA  142

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSNNF G     + + P L+ELD+SNN  +G+FPTAVL   
Sbjct  143  APTLDGFLDQLPDVALFHANSNNFAGTLSSNIARLPYLYELDISNNLFSGSFPTAVLGMD  202

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+RFN  +G V PQ+FT +L+ LF+NNN F   LPDNLGST + +LT
Sbjct  203  GLTFLDIRFNFFSGAVPPQIFTQNLEVLFINNNNFMTTLPDNLGSTHILYLT  254



>gb|KDP41695.1| hypothetical protein JCGZ_16102 [Jatropha curcas]
Length=424

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G++LC     Y+GF+C  P   +K  V     +   F   
Sbjct  82   IQKFKSIITSDPLGITKTWVGSDLC----NYKGFYCDNPPD-NKSAVAVASIDFNGFQLA  136

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSN F+G+    + K P L+ELD+SNN  +G FPTAVL   
Sbjct  137  APTLDGFLDQLPDIALFHANSNFFSGSISPNIAKLPYLYELDISNNLFSGLFPTAVLSMN  196

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+RFN  +G + PQ+FT +LDALFLNNN F   LPDNLGST + +LT
Sbjct  197  GLTFLDIRFNFFSGSIPPQLFTKELDALFLNNNNFMTSLPDNLGSTHIIYLT  248



>ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=443

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            ++ FK +IT DP  +T++W G+++C     Y+GF+C  P   +         +   F  +
Sbjct  107  VQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDTPPD-NSSATALASIDLNGFQLS  161

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F+++  D+ + H NSNNF G     + K   L+ELD+SNN+L+G FPTAVL  +
Sbjct  162  ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLSYLYELDVSNNQLSGPFPTAVLGMS  221

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LDLRFN  +G V PQ+FT +L  LF+NNN  +  LPDNL ST +  LT
Sbjct  222  TLTFLDLRFNFFSGAVPPQIFTQNLQVLFINNNILTQGLPDNLASTHILLLT  273



>ref|XP_008236564.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=416

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +R +   I+ FK+ I  DP+N T +W GN +C    KY+GF C V     K  V G+ FN
Sbjct  37   LRNAFNVIQAFKRRIQSDPKNYTGTWVGNNVC----KYKGFTCAVVPDLKKLTVIGVSFN  92

Query  423  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  596
            G  F G    L  N F++   DLV  H NSNNFTG       +    +ELDLSNNKL+G 
Sbjct  93   GALFGGFNNRLPLNGFIDKLEDLVFFHANSNNFTGTVPRGTARHRFFYELDLSNNKLSGG  152

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP   L ATNLT+LDLRFN     V P+VF LD+D LFLNNN F   LP NLGSTP  +L
Sbjct  153  FPNETLGATNLTFLDLRFNSFRATVPPKVFNLDVDLLFLNNNNFQQRLPANLGSTPAHYL  212

Query  777  T  779
            T
Sbjct  213  T  213



>ref|XP_008452581.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=433

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 105/173 (61%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K        +   F  
Sbjct  87   VIQKFKSIITSDPLGITKTWVGSDIC----NYKGFYCDNPPD-NKSATAVASIDFNGFQL  141

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
            +  SL+ F++   D+ V H NSNNF+G     + K P L+ELD+SNN+L+G FPTAV+  
Sbjct  142  SAPSLDGFLDQLPDIAVFHANSNNFSGTISTNIAKLPYLYELDVSNNQLSGPFPTAVIGM  201

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             +LT+LDLRFN  TG V PQVF  DLD L +NNN F   LPD+L  T + +LT
Sbjct  202  NSLTFLDLRFNFFTGSVPPQVFVQDLDFLLINNNNFMQSLPDSLSITHILYLT  254



>ref|XP_006297641.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
 gb|EOA30539.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
Length=458

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 115/182 (63%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I+K    I+ F+  I  DP+ I ++W G ++C  K KY G  C    G +   +  I 
Sbjct  87   PLIKKVYPVIKNFQMLIEDDPKKILKTWVGTDICA-KDKYIGLECAKFPGTNHLALASIQ  145

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +N  G  L L++F+   +++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  146  FNNFNLGGKKLRLDNFLNKLDEVTIFHANSNNFVGS--VPKVSNLKYLFELDLSNNKLSG  203

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N     LP+NLGS    +
Sbjct  204  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINDNNLVQSLPENLGSITALY  263

Query  774  LT  779
            LT
Sbjct  264  LT  265



>gb|KFK39280.1| hypothetical protein AALP_AA3G224000 [Arabis alpina]
Length=480

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 116/182 (64%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I+K    I+ F+K I  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  109  PLIKKVYPVIKNFQKLIEDDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNNLALASIQ  167

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +N  G  + L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  168  FNQFNLGGKKIRLDNFLDKLEEVTIFHANSNNFVGS--VPKVSNLKYLFELDLSNNKLSG  225

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP +VL+ATNLT+LDLRFN  +G V PQVF LDLDALF+NNN     LP+NLGS    +
Sbjct  226  EFPRSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDALFINNNNLVQRLPENLGSITALY  285

Query  774  LT  779
            LT
Sbjct  286  LT  287



>ref|XP_006374888.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
 gb|ERP52685.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
Length=430

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G+++C     Y+GFFC  P   +         +   F   
Sbjct  88   IQKFKSLITSDPLGITKTWVGSDIC----NYKGFFCDSPPD-NNSATAVASIDFNGFQLA  142

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSNNF G     + + P L+ELD+SNN  +G+FPTAVL   
Sbjct  143  APTLDGFLDQLPDVALFHANSNNFAGTISSNIARLPYLYELDISNNLFSGSFPTAVLGMN  202

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+RFN   G V PQ+FT +L+ LF+NNN F   LPDNLGST + +LT
Sbjct  203  GLTFLDIRFNFFAGAVPPQIFTQNLEVLFINNNNFLTTLPDNLGSTHILYLT  254



>emb|CDY16514.1| BnaA08g02530D [Brassica napus]
Length=475

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 116/182 (64%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P++ K    ++ FKK +T DP  I ++WEG ++C NK KY G  C +      K +  I 
Sbjct  101  PLLEKVFPVLKAFKKLVTRDPMLILKTWEGTDIC-NKYKYLGLECAIFPNTTDKALASIQ  159

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FNG+NF G+ L L++F++  + + + H NSN+F G+  +P V     LFELDLSNNKL G
Sbjct  160  FNGFNFGGDKLVLHNFLDKLDTVTIFHANSNDFLGS--VPEVTNLKYLFELDLSNNKLTG  217

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP +VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  218  DFPASVLKAKNLTFLDLRFNTFSGCVPPQVFNLDLDVLFINNNNLVQTLPSNLGSITALY  277

Query  774  LT  779
            LT
Sbjct  278  LT  279



>ref|XP_011004883.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Populus 
euphratica]
Length=394

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 109/181 (60%), Gaps = 6/181 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I +    I+ FKK IT DP  I + W+G ++C     Y GF C          +    FN
Sbjct  24   IERDFHTIQRFKKLITIDPLGIKKKWKGTDVC----NYPGFKCATVPDQKVTALAAADFN  79

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  596
            GY F G  L L  F++   DL + H NSNNFTG     I   +   LFE+DLSNNK +G 
Sbjct  80   GYFFGGRDLQLTGFLDQLPDLSIFHANSNNFTGPVPKSIGTSRVRYLFEVDLSNNKYSGG  139

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP +VL+ATNLT+LD+RFN  +G V  +VFTLDLD LF+NNN FS  LP NLGSTPV +L
Sbjct  140  FPMSVLQATNLTFLDIRFNSFSGSVPAEVFTLDLDVLFINNNKFSQQLPGNLGSTPVLYL  199

Query  777  T  779
            T
Sbjct  200  T  200



>emb|CDY20865.1| BnaC05g26270D [Brassica napus]
Length=516

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 116/182 (64%), Gaps = 6/182 (3%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+++K    ++ FKK +  DP+NI  SW G+++C    KY+G  C +  G   + V  + 
Sbjct  145  PLLKKVYPVLQAFKKLVEVDPKNILASWNGSDIC---GKYRGLECAIFPGTKYQAVASVQ  201

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FNG+NF+G  L L++F++    + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  202  FNGFNFSGKKLRLDNFLDKLETVTIFHANSNNFLGS--VPKVSNLNYLFELDLSNNKLTG  259

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP +VL+ATNLT+LDLRFN  +G V  QVF LDLD LF+NNN     LP NLGS    +
Sbjct  260  EFPASVLKATNLTFLDLRFNTFSGSVPRQVFNLDLDVLFINNNNLVQKLPHNLGSITALY  319

Query  774  LT  779
            LT
Sbjct  320  LT  321



>ref|XP_010507626.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=458

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 118/181 (65%), Gaps = 4/181 (2%)
 Frame = +3

Query  240  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            +I+K    I+ F+K I  DP+ I ++W G ++C  + KY G  C    G +   +G I F
Sbjct  88   LIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDKYIGLECAKFPGTNDDALGSIQF  146

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  596
            N +NF G  L L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G 
Sbjct  147  NNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLSGE  204

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N  +  LP+NLGS    +L
Sbjct  205  FPSSVLKATNLTFLDLRFNSFSGSVPPQVFYLDLDVLFINDNNLAQRLPENLGSITALYL  264

Query  777  T  779
            T
Sbjct  265  T  265



>ref|XP_007199295.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
 gb|EMJ00494.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
Length=398

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 102/172 (59%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I  FK +IT DP  ITQ+W G+++C     Y+GF+C  P   ++        +   F  +
Sbjct  42   INAFKNTITSDPLGITQTWVGSDICT----YKGFYCDRPPD-NQSAFALASIDFNGFQLS  96

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              S++ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  97   APSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMN  156

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            NL++LD+RFN  TG V PQ+F   LD LF+NNN F   LPDNLG+TP  +LT
Sbjct  157  NLSFLDIRFNSFTGSVPPQIFKKTLDVLFINNNKFIQKLPDNLGATPARYLT  208



>ref|XP_011000139.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=421

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 106/183 (58%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK +IT DP NITQ+W G ++C     Y+GF+C  P   +   V  
Sbjct  53   LDQRLASVYPIIQVFKDTITSDPFNITQTWVGPDIC----NYEGFYCTSPPDNNSA-VAV  107

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F  +  +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   
Sbjct  108  ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFH  167

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G+FP  +L    L++LD+RFN  TG V PQVFT  LD LFLNNN F   LP+NLGST V 
Sbjct  168  GSFPMEILGIPGLSFLDIRFNFFTGTVPPQVFTQGLDVLFLNNNNFIQELPENLGSTTVL  227

Query  771  FLT  779
            +LT
Sbjct  228  YLT  230



>ref|XP_009359966.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=468

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP NIT++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  126  IQNFKSLITSDPLNITKTWVGSNIC----SYKGFYCDSPPN-NSSAIALASIDFNGFQLG  180

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +GAFP+AVL   
Sbjct  181  APSLDGFLDQLPDIALFHANSNNFSGTVSPAIANLPYLYELDISNNQFSGAFPSAVLGMN  240

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L +LD+RFN  TG V PQ+FT +LDALFLNNN F   LPDNLGS+ +  LT
Sbjct  241  TLGFLDIRFNFFTGAVPPQIFTQELDALFLNNNNFMQNLPDNLGSSHILLLT  292



>ref|XP_007201703.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
 gb|EMJ02902.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
Length=529

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 109/181 (60%), Gaps = 6/181 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I  +    + F+  IT DP++I +SW+G  +C    KY+G  C +     +K V G+  N
Sbjct  163  IELAYHVFQNFRPLITSDPKHIAKSWQGPHVC----KYKGVVCAMHPTYKQKAVAGLDIN  218

Query  423  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  596
            G  F G+   L  + F++   DL   H NSNNFTG+    V K    +ELDLSNNKL G 
Sbjct  219  GALFGGDNAKLPLDGFLDKLEDLAFFHANSNNFTGSVPKDVSKLKFFYELDLSNNKLIGG  278

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP  VL ATNLT+LDLRFN   G V P+VF LD+D LFLNNN F+  +PDNLGS+P  + 
Sbjct  279  FPNEVLAATNLTFLDLRFNYFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYF  338

Query  777  T  779
            T
Sbjct  339  T  339



>gb|KDP24991.1| hypothetical protein JCGZ_23974 [Jatropha curcas]
Length=413

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 104/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+TFKK+IT DP NITQ+W G ++C     Y+GF C  P   +         +   F  +
Sbjct  60   IQTFKKAITSDPLNITQTWVGPDIC----NYKGFSCDHPPD-NISATPLAAIDFNGFRLS  114

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   DL + H NSNNF+G     +   P L+ELDLSNN   G FP A+L  T
Sbjct  115  APSLDGFIDQLPDLAIFHANSNNFSGTISPKLADLPFLYELDLSNNFFFGNFPMAILSIT  174

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+RFN  TG V PQ+FT  LD LFLNNN F   LP+ LG+TPV +LT
Sbjct  175  GLSFLDIRFNFFTGSVPPQIFTQRLDVLFLNNNNFMLKLPETLGATPVLYLT  226



>ref|XP_010061722.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=455

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP  IT SW G ++C    KY+GF+C  P   +K        +   F  +
Sbjct  111  IQLFKSTITSDPLGITNSWVGGDIC----KYKGFYCDSPPD-NKSATALASIDFNGFGLS  165

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   D+ + H NSN F G     + K   L+ELDLSNNKL+G FPT VL  T
Sbjct  166  APSLDGFLDQLPDIALFHANSNKFAGTISPNIAKLRYLYELDLSNNKLSGPFPTVVLGMT  225

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L +LDLRFN  +G V  Q+FT DL  LFLNNN F   LPDNLG+T V +LT
Sbjct  226  DLIFLDLRFNSFSGAVPAQIFTRDLYVLFLNNNAFDQTLPDNLGNTHVLYLT  277



>ref|XP_009762067.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=462

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 106/179 (59%), Gaps = 3/179 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I  +   I+ FK  I YDP  I  +W G ++C    KY+GF C +      + +  + FN
Sbjct  90   IEIAYNVIQKFKAKIKYDPLGIKNTWVGYDVC---NKYKGFHCAIVPDYKVQALAAVDFN  146

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
             +NF G  L+LN F++   D+ + H NSN FTG     +     L+ELDLSNN   G FP
Sbjct  147  QFNFAGPDLTLNGFLDELPDITIFHANSNKFTGTIPKKIANLRYLYELDLSNNNYNGEFP  206

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              VL A NLT+LDLRFN  +G V PQVF L+LD LF+NNN     LPDNLGSTPV +LT
Sbjct  207  NDVLGAKNLTFLDLRFNTFSGLVPPQVFMLNLDVLFINNNNLMQKLPDNLGSTPVLYLT  265



>emb|CDP01296.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 111/189 (59%), Gaps = 11/189 (6%)
 Frame = +3

Query  231  LDPVIRKSIK------AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGD  392
            L+P+I   ++       I  FKK I  DP  IT+SW G ++C     Y GF+C  P   +
Sbjct  56   LEPLIFADLRLAVVYPIILKFKKIINSDPLGITKSWVGADIC----NYTGFYCTSPPD-N  110

Query  393  KKRVggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDL  572
               +     +   F  +  +L+ F++   DL + H NSNNF+G     + K P L+ELD+
Sbjct  111  CSAIALASIDFNGFRLSAPTLDGFLDQLPDLALFHANSNNFSGTVSADISKLPYLYELDI  170

Query  573  SNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNL  752
            SNN+ +G FPTAVL   +L++LD+RFN  TG V PQ+FT   DA+FLNNN F   LP+N+
Sbjct  171  SNNQFSGPFPTAVLGMNSLSFLDIRFNFFTGSVPPQLFTQAFDAIFLNNNNFMQRLPENI  230

Query  753  GSTPVFFLT  779
            G+T  F+LT
Sbjct  231  GNTRAFYLT  239



>gb|KDP24986.1| hypothetical protein JCGZ_23969 [Jatropha curcas]
Length=413

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+TFK SIT DP NITQ+W G ++C     Y+GF+C  P   +         +   F  +
Sbjct  60   IQTFKNSITSDPFNITQTWVGPDIC----NYKGFYCDHP-PDNISATALAAIDFNGFRLS  114

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+  ++   DL + H NSNNF+G     +   P L+ELDLSNN   G FP A+L  T
Sbjct  115  APSLDGLIDQLPDLAIFHANSNNFSGTISPKLADLPFLYELDLSNNFFFGNFPMAILSIT  174

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+RFN  TG V PQ+FT  LD LFLNNN F   LP+ LG+TPV +LT
Sbjct  175  GLSFLDIRFNFFTGSVPPQIFTQRLDVLFLNNNNFMLKLPETLGATPVLYLT  226



>gb|KJB32334.1| hypothetical protein B456_005G236100 [Gossypium raimondii]
Length=433

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 112/183 (61%), Gaps = 8/183 (4%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYD--PQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            + K+   I+TFK  I  D   +  T++W G E+C     Y+GF C +    ++  V  + 
Sbjct  62   LAKTHDVIQTFKSKILVDDNSKKYTETWRGTEIC----NYKGFTCDIRPDVNETAVASVD  117

Query  417  fngynfn--gnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
            FNG  F      L L+ F++  +DL + H NSNNFTG     V K   L+ELDLSNN+L+
Sbjct  118  FNGAKFAGPNGYLPLDGFIDKLDDLAIFHANSNNFTGTIPYEVSKIKYLYELDLSNNQLS  177

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP  VL+ATNLT+LDLRFN + G V  QVF LDLD LF+NNN F   LP+NLG TPV 
Sbjct  178  GDFPMNVLKATNLTFLDLRFNSIKGLVPQQVFNLDLDVLFINNNNFEQRLPENLGDTPVL  237

Query  771  FLT  779
            +LT
Sbjct  238  YLT  240



>ref|XP_009622015.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=466

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 106/179 (59%), Gaps = 3/179 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I  +   I+ FK  I YDP  I  +W G ++C    KY+GF C +      + +  + FN
Sbjct  93   IEIAYNVIQKFKAKIKYDPLGIKNTWVGYDVC---NKYKGFHCAIVPNYKVQALAAVDFN  149

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
             +NF G  L+LN F++   D+ + H NSN FTG     +     L+ELDLSNN   G FP
Sbjct  150  QFNFAGPDLTLNDFLDELPDITIFHANSNKFTGTIPKKIANLRYLYELDLSNNNYNGEFP  209

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              +L A NLT+LDLRFN  +G V PQVF L+LD LF+NNN     LPDNLGSTPV +LT
Sbjct  210  YNILGAKNLTFLDLRFNTFSGLVPPQVFMLNLDVLFINNNNLMQKLPDNLGSTPVLYLT  268



>emb|CDX99236.1| BnaC05g33510D [Brassica napus]
Length=458

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 113/182 (62%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I K    I+ F+  +  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  87   PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  145

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +N  G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  146  FNQFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  203

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LD+D LF+N+N     LP+NLGS    +
Sbjct  204  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDVDVLFINHNNLVQRLPENLGSITALY  263

Query  774  LT  779
            LT
Sbjct  264  LT  265



>ref|XP_004231393.1| PREDICTED: uncharacterized protein At4g06744 [Solanum lycopersicum]
Length=394

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 104/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP  +T++W G ++C     Y+GF+C  P   +   +     +   F  +
Sbjct  43   IQNFKNTITLDPFGVTKTWTGPDIC----NYKGFYCDNPPN-NSSAISLASIDFNGFQLS  97

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H N+NNF+G     +   P L+ELDLSNN+  G FP ++L   
Sbjct  98   APTLDGFIDQLPDLAIFHANTNNFSGIISSKISNLPYLYELDLSNNQFIGTFPMSILNIK  157

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+R+N+LTG + PQ+F   LDA FLNNN F   LPD++GST  F+LT
Sbjct  158  TLTFLDIRYNLLTGIIPPQIFLQYLDAFFLNNNNFIQKLPDSIGSTSAFYLT  209



>ref|NP_188563.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02456.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76223.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=493

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 115/182 (63%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I+K    I+ F+  I  DP++I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  122  PLIKKVYPVIKNFQTLIEDDPKSILKTWVGTDICA-QDKYIGLECAKLPGTNDLALASIQ  180

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +N  G  L L++F+    ++ + H NSNNF G+  +P   K   LFELDLSNNKL+G
Sbjct  181  FNNFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGS--VPNFSKLKYLFELDLSNNKLSG  238

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP+NLGS    +
Sbjct  239  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQRLPENLGSITALY  298

Query  774  LT  779
            LT
Sbjct  299  LT  300



>ref|XP_004167460.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57510.1| hypothetical protein Csa_3G200700 [Cucumis sativus]
Length=429

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (57%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+TFK  IT DP  +TQ+W G+++C    KYQGF+C  P   +K  V  
Sbjct  62   LDQRLAVVYPIIQTFKALITSDPLGVTQTWVGSDIC----KYQGFYCDHPPD-NKSAVTI  116

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     +L+ F++   DL + H NSNNF G     +   P L+ELDLSNN+L+
Sbjct  117  AAIDFNGFQLTASTLDGFIDGLPDLAIFHANSNNFFGTITPKIASLPYLYELDLSNNQLS  176

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP A+L  T+L++ D+RFN  TG V  Q+F    D LFLNNN F   LP N GST   
Sbjct  177  GTFPVAILSVTDLSFFDIRFNFFTGFVPQQLFVKSFDFLFLNNNNFGMKLPINFGSTTTP  236

Query  771  FLT  779
            ++T
Sbjct  237  YIT  239



>ref|XP_009145802.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=459

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I K    I+ F+  +  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  88   PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  146

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +NF G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  147  FNQFNFGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  204

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LFLN+N     LP+NLGS    +
Sbjct  205  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFLNHNNLVQRLPENLGSITALY  264

Query  774  LT  779
            LT
Sbjct  265  LT  266



>emb|CDX92324.1| BnaA05g20830D [Brassica napus]
Length=459

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I K    I+ F+  +  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  88   PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  146

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +NF G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  147  FNQFNFGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  204

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LFLN+N     LP+NLGS    +
Sbjct  205  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFLNHNNLVQRLPENLGSITALY  264

Query  774  LT  779
            LT
Sbjct  265  LT  266



>ref|XP_008393778.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=463

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP NIT++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  121  IQNFKSLITSDPLNITKTWVGSNIC----XYKGFYCDSPPN-NSSAIALASIDFNGFQLG  175

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +GAFP+AVL   
Sbjct  176  APSLDGFLDQLPDIALFHANSNNFSGTVSPAIANLPYLYELDISNNQFSGAFPSAVLGMN  235

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L +LD+RFN  TG V P++FT +LDALFLNNN F   LPDNLGS+ +  LT
Sbjct  236  TLGFLDIRFNFFTGAVPPEIFTQELDALFLNNNNFMQNLPDNLGSSHILLLT  287



>ref|XP_006406513.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
 gb|ESQ47966.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
Length=464

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 113/182 (62%), Gaps = 4/182 (2%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+I K    I+ F+  I  DP+ I +SW G ++C + K Y G  C    G +   +  I 
Sbjct  93   PLIEKVYPVIKNFQNLIEDDPKKILKSWVGTDICADDK-YIGLECAKFPGTNNLALASIQ  151

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FN +N  G  L L++F+    ++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  152  FNQFNLGGKKLRLDNFLYKLEEVTIFHANSNNFVGS--VPKVSHLKYLFELDLSNNKLSG  209

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N     LP+NLGS    +
Sbjct  210  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINDNNLVQRLPENLGSITALY  269

Query  774  LT  779
            LT
Sbjct  270  LT  271



>ref|XP_010487869.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=459

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 117/181 (65%), Gaps = 4/181 (2%)
 Frame = +3

Query  240  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            +I+K    I+ F+K I  DP+ I ++W G ++C  +  Y G  C    G +   +G I F
Sbjct  88   LIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDTYIGLECAKFPGTNDDALGSIQF  146

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  596
            N +NF G  L L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G 
Sbjct  147  NNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLSGE  204

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N  +  LP+NLGS    +L
Sbjct  205  FPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINDNNLAQRLPENLGSITALYL  264

Query  777  T  779
            T
Sbjct  265  T  265



>ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula]
 gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula]
 gb|ACJ86225.1| unknown [Medicago truncatula]
 gb|AES59392.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
 gb|AFK35532.1| unknown [Medicago truncatula]
Length=378

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 103/173 (60%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP  +T+SW G+++C     Y+GF+C  P   +   +     +   F  
Sbjct  38   VIQKFKSLITSDPLGVTKSWIGSDIC----NYKGFYCDHPPDNNSA-IALASIDFNGFQL  92

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
            +  +LN F++   D+ + H NSNNF G     + K P L+ELDLSNNK +G FP AVL  
Sbjct  93   SASTLNGFIDKLPDIALFHANSNNFIGTITSQISKLPYLYELDLSNNKFSGPFPMAVLGM  152

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              LT+LD+RFN  +G V  Q+FT +L+ LF+NNN  +  LPDNL ++ +F LT
Sbjct  153  NTLTFLDIRFNSFSGGVPQQIFTQNLEVLFINNNLLTQNLPDNLATSSIFLLT  205



>ref|XP_007201495.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
 gb|EMJ02694.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
Length=427

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 105/181 (58%), Gaps = 6/181 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +R +   I+ FK+ I  DP+N T +W GN +C    KY+GF C V     K  V G+ FN
Sbjct  48   LRNAFNVIQAFKRRIQSDPKNYTGTWVGNNVC----KYKGFTCAVVPDLKKLTVIGVSFN  103

Query  423  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  596
            G  F G    L  N F++   DLV  H NSNNFTG       +    +ELDLSNNKL G 
Sbjct  104  GALFGGFNNRLPLNGFIDRLEDLVFFHANSNNFTGTVPRGTARHRFFYELDLSNNKLTGG  163

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP   L ATNLT+LDLRFN     V P+VF LD+D LFLNNN F   LP NLGST   +L
Sbjct  164  FPNETLAATNLTFLDLRFNSFNATVPPKVFNLDVDLLFLNNNNFQQRLPGNLGSTRAHYL  223

Query  777  T  779
            T
Sbjct  224  T  224



>ref|XP_011074595.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=411

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP NIT SW G ++C    KY+GF+C  P   +K  +     +   F  +
Sbjct  69   IQRFKNLITSDPLNITSSWIGTDIC----KYKGFYCESPPD-NKSAIALASIDFNGFQLS  123

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L  F++   DL + H NSNNF G     + K P L+ELD+SNN+ +G FPTA+L   
Sbjct  124  SPTLVGFLDLLPDLALFHANSNNFAGTIPGNIVKLPYLYELDISNNRFSGPFPTAILAME  183

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+R+N  +G V P++F  DLDALFLNNN F   LPD++G+T V +LT
Sbjct  184  GLSFLDIRYNFFSGSVPPELFAKDLDALFLNNNNFMTRLPDDIGATHVEYLT  235



>ref|XP_006422962.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
 gb|ESR36202.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
Length=360

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = +3

Query  276  KKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  455
            K +IT DP NIT +W G+++C    KY+GF+C  P   +   +     +   F     +L
Sbjct  8    KNTITSDPFNITSTWIGSDIC----KYKGFYCGHPPD-NLTAIALASIDFNGFELAAPTL  62

Query  456  nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  635
            + F++   DL + H NSN F+G     + + P L+ELD+SNNK +G FP A+L   +L++
Sbjct  63   DGFIDQLPDLSLFHANSNKFSGTISPRLAQLPYLYELDISNNKFSGTFPVAILGKNDLSF  122

Query  636  LDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            LD+RFN  TG V PQVF   LD LFLNNN F   LP NLGSTP  +LT
Sbjct  123  LDIRFNFFTGSVPPQVFMQTLDVLFLNNNNFMQKLPQNLGSTPALYLT  170



>ref|XP_002282482.2| PREDICTED: uncharacterized protein At4g06744-like [Vitis vinifera]
Length=507

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 112/180 (62%), Gaps = 5/180 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            ++ ++KAIR F+  IT DP NI + W+GN  C    K++GF C      +   V G+ FN
Sbjct  147  LKIALKAIRIFQAKITVDPFNIAKGWKGNNPC----KFKGFVCSTVPDKNLNAVAGVDFN  202

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAF  599
            G+NF G  L+L+ F+    D+ + H NSN+F G  P I   K   L+ELDLSNNKL G F
Sbjct  203  GFNFGGPNLALDGFLNGLPDITIFHANSNDFNGRIPKIDTTKLRYLYELDLSNNKLHGEF  262

Query  600  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            P  VL A  LT+LDLRFN  +G V P VF LD+D +F+N+N F   LP+N+G TP  +LT
Sbjct  263  PYEVLAAKQLTFLDLRFNSFSGVVPPHVFILDVDVIFINDNNFIQQLPENIGDTPALYLT  322



>ref|XP_002300228.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
 gb|EEE85033.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
Length=421

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 105/183 (57%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK +IT DP NITQ+W G ++C     Y+GF+C  P   +   V  
Sbjct  53   LDQRLASVFPIIQVFKDTITSDPFNITQTWVGPDIC----NYKGFYCTSPPD-NNSAVAL  107

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F  +  +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   
Sbjct  108  ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFL  167

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP  +L    L++LD+RFN  TG V P+VFT  LD LFLNNN F   LP+NLGST V 
Sbjct  168  GNFPMEILGIPGLSFLDIRFNFFTGTVPPEVFTQGLDVLFLNNNNFIQKLPENLGSTTVL  227

Query  771  FLT  779
            +LT
Sbjct  228  YLT  230



>emb|CDY32853.1| BnaC08g02750D [Brassica napus]
Length=481

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 114/182 (63%), Gaps = 6/182 (3%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P++ K    ++ FKK +T+DP +I ++W G ++C    KY G  C +      K +  I 
Sbjct  109  PLLEKVFPVLQAFKKLVTHDPMHILKTWNGPDIC---NKYLGLECAIFPNTTDKALASIQ  165

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FNGYNF G  L L++F++  N + + H NSNNF G+  +P V     LFELDLS+NKL G
Sbjct  166  FNGYNFGGKKLVLHNFLDKLNTVTIFHANSNNFLGS--VPEVTNLKYLFELDLSHNKLTG  223

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP +VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  224  DFPASVLKAKNLTFLDLRFNTFSGCVPPQVFNLDLDVLFINNNNLVQKLPSNLGSITALY  283

Query  774  LT  779
            LT
Sbjct  284  LT  285



>ref|XP_011004900.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=406

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 110/183 (60%), Gaps = 11/183 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I +    I+ FK++I  DP  IT+ W GN++C     Y GF C    G D+K +     +
Sbjct  37   IERDYYTIQRFKETIK-DPLGITKKWVGNDVC----NYPGFKCAT--GPDQKVIALAAAD  89

Query  423  gynfngn--glslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLA  590
               ++       L  F++   DL + H NSNNFTG     I   +   LFE+DLSNNK +
Sbjct  90   FNGYSFGGPDSQLTGFLDQLLDLSIFHANSNNFTGPVPKNIGTSRVRYLFEVDLSNNKYS  149

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FP +VL+ATNLT+LD+RFN  +G V  +VFTLDLD LF+NNN FS  LP NLGSTPV 
Sbjct  150  GGFPMSVLQATNLTFLDIRFNSFSGSVPAEVFTLDLDVLFINNNKFSQQLPGNLGSTPVL  209

Query  771  FLT  779
            +LT
Sbjct  210  YLT  212



>ref|XP_009145107.1| PREDICTED: uncharacterized protein At4g06744-like [Brassica rapa]
Length=555

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 6/182 (3%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P+++K    ++ FKK +  D +NI  SW G+++C    KY+G  C    G   + V  + 
Sbjct  183  PLLKKVYPVLQAFKKLVEVDSKNILASWNGSDIC---GKYRGLECATFPGTKYQAVASVQ  239

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
            FNG+NF+G  L L++F++  + + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  240  FNGFNFSGKNLRLDNFLDKLDTVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLTG  297

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP +VL+ATNLT+LDLRFN  +G V  QVF LDLD LF+NNN     LP NLGS    +
Sbjct  298  EFPASVLKATNLTFLDLRFNTFSGSVPRQVFNLDLDVLFINNNNLVQKLPHNLGSITALY  357

Query  774  LT  779
            LT
Sbjct  358  LT  359



>ref|XP_010263447.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=467

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 96/172 (56%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I  FKKSIT DP  IT +W G  +C     Y GF+C  P   +  R            G 
Sbjct  101  IHRFKKSITSDPHGITNTWVGPRIC----NYTGFYCDHPPDDNSLRALAGIDFNGYQLGA  156

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
                + FV+   D+ + H N+NNF GA    + +   L+ELDLSNNK +G FP AVL   
Sbjct  157  PTLDD-FVDQLPDIAIFHANTNNFAGAISPKIAQLRYLYELDLSNNKFSGQFPMAVLGMD  215

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+RFN  TG V  Q+FT  LD LF+NNN F   LP NLGSTPV +LT
Sbjct  216  GLSFLDIRFNSFTGTVPAQIFTQPLDVLFINNNNFMQTLPANLGSTPVRYLT  267



>ref|XP_010688602.1| PREDICTED: uncharacterized protein At4g06744 [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G+++C     Y+GFFC VP   +   +     +   +  +
Sbjct  131  IQNFKNIITSDPLGITKTWVGSDIC----SYKGFFCDVPPN-NASAIAVASIDFNGYGLS  185

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H NSNNFTG     + K P L+ELD+SNNK  G FP AV+   
Sbjct  186  APTLDGFIDQLPDLALFHANSNNFTGTLSSNIAKLPYLYELDISNNKFTGPFPLAVVGMD  245

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L +LD+RFN+ +G + P +FT +LD LFLN+N F   LP +LG+T + +LT
Sbjct  246  SLIFLDIRFNLFSGSIPPAIFTQNLDVLFLNDNNFVSSLPQSLGNTHILYLT  297



>ref|XP_008236576.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=481

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 106/181 (59%), Gaps = 6/181 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I+ +    + F+  I  DP+N  +SW G ++C    KY+G  C +     ++ V G+  N
Sbjct  115  IKLAYYVFKNFRPLIKDDPKNYKKSWRGRDVC----KYKGVVCAIHPDYKQRAVAGLDIN  170

Query  423  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  596
            G  F G    L  + F++   DL   H NSNNFTG     V K    +ELDLSNNKL G 
Sbjct  171  GALFGGYNAKLPLDGFLDKLEDLAFFHANSNNFTGFVPKDVYKLKFFYELDLSNNKLIGG  230

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP  VL ATNLT+LDLRFN   G V P+VF LD+D LFLNNN F+  +PDNLGS+P  + 
Sbjct  231  FPNEVLAATNLTFLDLRFNSFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYF  290

Query  777  T  779
            T
Sbjct  291  T  291



>ref|XP_008342943.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=424

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 101/172 (59%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I TF+  I  DP  ITQ+W G+++C     Y+GF+C  P   +K        +   F  +
Sbjct  79   IMTFRNMIISDPLGITQTWVGSDIC----NYKGFYCDNPPD-NKSATTLASIDFNGFQLS  133

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN  +G FPTAVL   
Sbjct  134  APTLDGFIDQLPDLALFHANSNNFSGIVSPKIANLQYLYELDISNNNFSGPFPTAVLTMN  193

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++LD+R+N  TG V PQ+F   LD LF+NNN F   LPDNLG+T   +LT
Sbjct  194  SLSFLDIRYNSFTGSVPPQIFKQTLDVLFINNNNFIQKLPDNLGATRALYLT  245



>ref|XP_009417193.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=456

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 98/174 (56%), Gaps = 5/174 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKK-YQGFFCYVPRGGDKKRVggiyfngynfng  440
            I+ FK+++T DP+N T SW G  +C N  + YQGF+C  P G    R             
Sbjct  82   IQRFKQTVTCDPKNKTGSWTGFRICNNDGRGYQGFYCETPPGLSNMRTIASVDFNGFTLS  141

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLE  617
                   FV+   DL + H NSN+F G   +P +   P  +ELDLSNN+L+G FP +VL 
Sbjct  142  APTVCG-FVDQLPDLALFHANSNSFGGT--VPALASLPFFYELDLSNNRLSGGFPASVLP  198

Query  618  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              +L +LDLR+N   GPV P VF +  D LFLNNN F+  +P NLGST   +LT
Sbjct  199  LVDLAFLDLRYNGYAGPVPPAVFLIRTDVLFLNNNGFTQNIPANLGSTTAAYLT  252



>emb|CDO97205.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+  K  IT DP  IT+SW G ++C    KYQGF C        K +  + FNGYNF+G 
Sbjct  90   IQRLKAKITCDPLGITKSWVGPDIC---NKYQGFRCATVPDYGVKALADVQFNGYNFSGP  146

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
             L+L  F++   DL + H NSN F G     +     LFELDLSNN   G FP  VL AT
Sbjct  147  DLTLEGFIDELPDLSIFHGNSNKFAGNIPKKLSTIRYLFELDLSNNNFNGQFPYEVLGAT  206

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LDLRFN  +G V PQVFTLDLD LF+NNN F   LPDNLGS PV FLT
Sbjct  207  KLTFLDLRFNSFSGAVPPQVFTLDLDVLFINNNNFVQRLPDNLGSLPVLFLT  258



>ref|XP_004499033.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=382

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 108/186 (58%), Gaps = 9/186 (5%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            D  + K    I+ FK  IT DP  +T+SW G+ +C     Y+GF+C  P   +   +   
Sbjct  29   DQRLAKVYPVIQKFKSLITSDPLGVTKSWVGSNIC----NYKGFYCDNPPDNNSA-IALA  83

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
              +   F  +  +L+ F++   D+ + H NSNNF G+    ++  P L+ELDLSNNKL+G
Sbjct  84   SIDFNGFQLSASTLDGFIDKLPDIALFHANSNNFVGSITPLIRNLPYLYELDLSNNKLSG  143

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP---  764
             FP +VL   +LT+LDLRFN  +G V PQ+FT +L+ LF+NNN  +  LPDN  +T    
Sbjct  144  PFPNSVLGMNSLTFLDLRFNFFSGGVPPQIFTENLEVLFINNNLLTQNLPDNFDTTKSGN  203

Query  765  -VFFLT  779
             +F LT
Sbjct  204  HIFLLT  209



>gb|KDP47120.1| hypothetical protein JCGZ_22116 [Jatropha curcas]
Length=455

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 110/181 (61%), Gaps = 4/181 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I +  K+I+ FK  ITYDP  +T+SW  N+   N   Y+GF C          V    FN
Sbjct  83   IVRDFKSIQQFKNQITYDPLEVTKSW--NQDNFNICTYKGFTCAHRPDSGVLSVAATDFN  140

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  596
            GYNFNG  L +  F++   DL + H NSNNFTG     I +Q    L+E D+SNNK  G 
Sbjct  141  GYNFNGPNLEIKDFIDKLKDLTIFHANSNNFTGIVPNDISIQNINFLYEFDISNNKYTGG  200

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP  +L A NLT+LD+RFN  +GP+  +VF LDLDALFLNNN F+  LPDN+G+T   +L
Sbjct  201  FPFPLLSARNLTFLDIRFNQFSGPIPREVFMLDLDALFLNNNQFNQQLPDNVGNTSALYL  260

Query  777  T  779
            T
Sbjct  261  T  261



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 102/176 (58%), Gaps = 7/176 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFCYVPRGGDKKRVggiyfngynf  434
            I+ FKK+IT DP  +T +WEG +LC    N  KY+GF+C  P   +   +     +   F
Sbjct  156  IQAFKKTITCDPLGVTATWEGPDLCSSFFNGTKYRGFYCEYPPNANAT-LTVASIDFNGF  214

Query  435  ngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAV  611
                 SL  FV+ F DL + H NSNNF+G   +P +   P  +ELDLSNN  +G+FP AV
Sbjct  215  GLCAPSLVGFVDQFPDLALFHANSNNFSG--DVPDLTHLPFFYELDLSNNNFSGSFPDAV  272

Query  612  LEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +    L +LDLRFN   G V P VF L ++AL LNNN F G +PD+ GST   +L 
Sbjct  273  VPLGGLLFLDLRFNRYAGAVPPAVFALTVEALLLNNNGFDGRIPDSFGSTGAKYLV  328



>gb|KJB14612.1| hypothetical protein B456_002G134000 [Gossypium raimondii]
Length=422

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  ITQ+W G+++C     Y+GF+C  P   +K  +     +   F  +
Sbjct  81   IQKFKSLITSDPLGITQTWVGSDIC----SYKGFYCDNPPD-NKSAIAVASIDFNGFQLS  135

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   D+ + H NSNNF+G+    + K   L+ELD+SNN+ +G FP AVL   
Sbjct  136  APSLDGFLDQLPDIALFHANSNNFSGSLSPNIAKLRYLYELDISNNRFSGPFPDAVLNMP  195

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+RFN  TG V  Q+FT +LDALF+NNN F   LPDN+ +T +F+LT
Sbjct  196  GLTFLDIRFNFFTGSVPSQIFTQNLDALFINNNEFMIHLPDNIVNTHIFYLT  247



>ref|XP_004140807.1| PREDICTED: uncharacterized protein LOC101203557 [Cucumis sativus]
Length=1406

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 101/172 (59%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+TFK  IT DP  +TQ+W G+++C    KYQGF+C  P   +K  V     +   F   
Sbjct  716  IQTFKALITSDPLGVTQTWVGSDIC----KYQGFYCDHP-PDNKSAVTIAAIDFNGFQLT  770

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H NSNNF G     +   P L+ELDLSNN+L+G FP A+L  T
Sbjct  771  ASTLDGFIDGLPDLAIFHANSNNFFGTITPKIASLPYLYELDLSNNQLSGTFPVAILSVT  830

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++ D+RFN  TG V  Q+F    D LFLNNN F   LP N GST   ++T
Sbjct  831  DLSFFDIRFNFFTGFVPQQLFVKSFDFLFLNNNNFGMKLPINFGSTTTPYIT  882



>ref|NP_001053250.1| Os04g0505200 [Oryza sativa Japonica Group]
 dbj|BAF15164.1| Os04g0505200 [Oryza sativa Japonica Group]
Length=306

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 110/188 (59%), Gaps = 21/188 (11%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P     + +     +
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTI--ASVD  138

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  596
               +N    SL  FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  139  FNGYNLQASSLKEFVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  597  FPTAVLEATNLTYLDLRFNMLTGPV-------HPQVftldldalflnnnffSGPLPDNLG  755
            FPT VL+  N T++D+RFN   G +        PQV      A+F+NNN FSG LPDN+G
Sbjct  197  FPTDVLKLKNATFVDIRFNSFYGELPGGVFCSFPQV-----QAIFVNNNQFSGSLPDNIG  251

Query  756  STPVFFLT  779
             +PV +L+
Sbjct  252  DSPVNYLS  259



>ref|XP_006393218.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
 gb|ESQ30504.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
Length=496

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 111/181 (61%), Gaps = 7/181 (4%)
 Frame = +3

Query  240  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            ++ K+   ++ FK  +  DP+N+  SW G+++C    KY+G  C +  G     V  + F
Sbjct  126  LLEKAYPILQAFKNLVEDDPKNVLDSWNGSDIC----KYRGLECAIFPGTKDLAVASVQF  181

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  596
            N +NF G  L L++F++    + + H NSNNF G+  +P V     LFELDLSNNKL G 
Sbjct  182  NEFNFAGKKLRLDNFLDKLETVTIFHANSNNFLGS--VPDVSNLKYLFELDLSNNKLTGD  239

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP +VL+A +LT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +L
Sbjct  240  FPASVLKAKDLTFLDLRFNTFSGSVPPQVFNLDLDVLFINNNNLVQQLPTNLGSITALYL  299

Query  777  T  779
            T
Sbjct  300  T  300



>ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=437

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G+++C     Y+GFFC  P   +K  +     +   F  +
Sbjct  97   IQKFKSIITSDPLGITKTWVGSDIC----SYKGFFCDNPPD-NKSAIAVASIDFNGFQLS  151

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSN F+G     + K P L+ELD+SNN  +G FPTAVL   
Sbjct  152  AATLDGFLDQLPDIALFHANSNFFSGTISPDIAKLPYLYELDISNNLFSGPFPTAVLGMN  211

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+RFN  +G + PQ+FT +LDALFLNNN F   LPDN+ +T + +LT
Sbjct  212  GLTFLDIRFNFFSGAIPPQLFTQELDALFLNNNNFMTNLPDNIVNTHILYLT  263



>gb|KCW54905.1| hypothetical protein EUGRSUZ_I00883 [Eucalyptus grandis]
Length=469

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = +3

Query  264  IRTFKKSITY---DPQNITQSWEG--NELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  428
            I+ FKK I+    DP+ +T +W G   ++C     Y+GF C    G     + GI FNG+
Sbjct  146  IQDFKKLISKGNCDPKKVTATWNGTGEKIC----NYKGFTCATVPGYKMSGLAGIDFNGF  201

Query  429  n--fngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
                +   L +++F+E   DLV  H NSNN TG     + K    +ELDLSNNKL GAFP
Sbjct  202  GFCNDKGQLPIDNFIEKLPDLVFFHTNSNNITGRIPSNLSKLKYFYELDLSNNKLRGAFP  261

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              VL ATNLT+LDLRFN LTGP+  QVFTLDL+ LFLNNN F+G +P+NLG TPV +LT
Sbjct  262  LTVLGATNLTFLDLRFNNLTGPIPAQVFTLDLEVLFLNNNEFNGAIPENLGKTPVSYLT  320



>ref|XP_010927582.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=469

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 107/179 (60%), Gaps = 8/179 (4%)
 Frame = +3

Query  246  RKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfng  425
            R++ K I+ FKK+IT DP  I+++W G ++C    KY+GF+C  P    K        + 
Sbjct  95   RQAYKVIQRFKKTITCDPMRISRTWNGAKVC----KYKGFYCETP-PNRKNTPTIASVDF  149

Query  426  ynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFP  602
              F+    ++++F+    D+ + H NSNNF+G  P +   +F  L+ELD+SNN   G FP
Sbjct  150  NIFHLCAPTVDNFINKLPDVALFHANSNNFSGTVPDLTGLQF--LYELDVSNNNQTGFFP  207

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            T VL   NLT+LDLRFN   G V P VF + LD LFLNNN FS  LPDNLG T   +LT
Sbjct  208  TNVLPLLNLTFLDLRFNHFLGTVPPDVFDIKLDVLFLNNNNFSERLPDNLGRTTAAYLT  266



>gb|EEE61292.1| hypothetical protein OsJ_15379 [Oryza sativa Japonica Group]
Length=432

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 110/188 (59%), Gaps = 21/188 (11%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P     + +     +
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTI--ASVD  138

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  596
               +N    SL  FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  139  FNGYNLQASSLKEFVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  597  FPTAVLEATNLTYLDLRFNMLTGPV-------HPQVftldldalflnnnffSGPLPDNLG  755
            FPT VL+  N T++D+RFN   G +        PQV      A+F+NNN FSG LPDN+G
Sbjct  197  FPTDVLKLKNATFVDIRFNSFYGELPGGVFCSFPQV-----QAIFVNNNQFSGSLPDNIG  251

Query  756  STPVFFLT  779
             +PV +L+
Sbjct  252  DSPVNYLS  259



>ref|XP_009413340.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 94/174 (54%), Gaps = 5/174 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKK-YQGFFCYVPRGGDKKRVggiyfngynfng  440
            I+ FK++IT DP N T +W G +LC N    YQGF+C  P      R            G
Sbjct  90   IQRFKRTITCDPLNKTDTWSGFKLCNNDGDGYQGFYCETPPNRKNMRTIASVDFNGFKLG  149

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLE  617
                   FV+   DL + H NSNN  G   +P ++  P  +ELDLSNN  +G FP  VL 
Sbjct  150  APTVSR-FVDQLPDLALFHANSNNLGGT--VPYIRTLPFFYELDLSNNDFSGGFPVNVLP  206

Query  618  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              NL++LDLR+N    P+ P VF +    LFLNNN F   +PDNLGSTP  ++T
Sbjct  207  LVNLSFLDLRYNGFASPLPPSVFLIQTQVLFLNNNKFYQHIPDNLGSTPAAYIT  260



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 110/188 (59%), Gaps = 21/188 (11%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P     + +     +
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTI--ASVD  138

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  596
               +N    SL  FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  139  FNGYNLQASSLKEFVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  597  FPTAVLEATNLTYLDLRFNMLTGPV-------HPQVftldldalflnnnffSGPLPDNLG  755
            FPT VL+  N T++D+RFN   G +        PQV      A+F+NNN FSG LPDN+G
Sbjct  197  FPTDVLKLKNATFVDIRFNSFYGELPGGVFCSFPQV-----QAIFVNNNQFSGSLPDNIG  251

Query  756  STPVFFLT  779
             +PV +L+
Sbjct  252  DSPVNYLS  259



>ref|XP_010028214.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=513

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = +3

Query  264  IRTFKKSITY---DPQNITQSWEG--NELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  428
            I+ FKK I+    DP+ +T +W G   ++C     Y+GF C    G     + GI FNG+
Sbjct  146  IQDFKKLISKGNCDPKKVTATWNGTGEKIC----NYKGFTCATVPGYKMSGLAGIDFNGF  201

Query  429  n--fngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
                +   L +++F+E   DLV  H NSNN TG     + K    +ELDLSNNKL GAFP
Sbjct  202  GFCNDKGQLPIDNFIEKLPDLVFFHTNSNNITGRIPSNLSKLKYFYELDLSNNKLRGAFP  261

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              VL ATNLT+LDLRFN LTGP+  QVFTLDL+ LFLNNN F+G +P+NLG TPV +LT
Sbjct  262  LTVLGATNLTFLDLRFNNLTGPIPAQVFTLDLEVLFLNNNEFNGAIPENLGKTPVSYLT  320



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 109/188 (58%), Gaps = 21/188 (11%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++ K I+ F++++T DPQNI QSW G +LC     Y+GFFC  P     + +     +
Sbjct  88   LYRAYKVIQKFRRTVTCDPQNIIQSWSGTDLC---GSYKGFFCERPPNVSDRTI--ASVD  142

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GA  596
               +N    S+  FV++  DL + H NSNNF GA  +P +      +ELDLSNNKLA   
Sbjct  143  FNGYNLQSSSIKDFVDALPDLALFHANSNNFGGA--VPDLSGLQYFYELDLSNNKLAPNP  200

Query  597  FPTAVLEATNLTYLDLRFNMLTGPV-------HPQVftldldalflnnnffSGPLPDNLG  755
            FPT VL+  N T++D+RFN   G +        PQV      A+F+NNN FSG LPDN+G
Sbjct  201  FPTDVLKLRNATFVDIRFNSFYGELPGGVFCSFPQV-----QAIFVNNNQFSGNLPDNIG  255

Query  756  STPVFFLT  779
             +PV +L+
Sbjct  256  DSPVNYLS  263



>gb|EYU37650.1| hypothetical protein MIMGU_mgv11b016249mg [Erythranthe guttata]
Length=440

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGG-DKKRVggiyfngynfng  440
            I+ FK+ IT DP NIT +W G ++C N   Y+GFFC    G  +   + G+ FNG+NF+G
Sbjct  77   IQKFKQKITSDPYNITNTWVGPDICNN---YKGFFCDTLLGDYNSVALAGVTFNGFNFDG  133

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
              LSL  F++   D++V H NSNNF G     + K   L+ELDLSNNK    FP  +L  
Sbjct  134  PDLSLAGFIDELPDIIVFHANSNNFKGPFPSNISKIKYLYELDLSNNKYTCEFPHEIL-G  192

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            + LT+LDLR+N  +G V PQVFTLD+D LF+NNN F   LPDNLGSTP  ++T
Sbjct  193  SQLTFLDLRYNTFSGAVPPQVFTLDVDVLFINNNNFMQKLPDNLGSTPALYVT  245



>ref|XP_004304027.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=411

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 101/172 (59%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I++FK  IT DP  IT++W G ++C     Y+GF+C +P   +         +   F  +
Sbjct  65   IQSFKNIITSDPLGITKTWVGADIC----NYKGFYCDIPPD-NATATAIASIDFNGFQLS  119

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  120  APTLDGFIDQLPDLALFHANSNNFSGILTPKIANLQYLYELDISNNNFFGPFPTAVLTMN  179

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++LD+R+N  TG + P++F   LD LFLNNN F   LPDNLG+T   +LT
Sbjct  180  SLSFLDIRYNSFTGSIPPEIFKQTLDVLFLNNNNFMQSLPDNLGATSALYLT  231



>gb|KDP47121.1| hypothetical protein JCGZ_22117 [Jatropha curcas]
Length=497

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 110/187 (59%), Gaps = 7/187 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWE--GNELCINKKKYQGFFCYVPRGGDKKRV  404
            L P + +   AI+ F K IT DPQ I +SW+     +C   K Y+GFFC          V
Sbjct  118  LTPNLIRDYNAIQQFSKLITDDPQGIKKSWDPKNKNVC---KGYKGFFCDTRPDTSVFSV  174

Query  405  ggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSN  578
                FNGYNFNG  L +  F+    DL + H NSNNFTG    G+ +     L+E D+SN
Sbjct  175  AAADFNGYNFNGPKLKIEDFLGELKDLAIFHANSNNFTGKVPKGVSIDNINFLYEFDISN  234

Query  579  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGS  758
            NK +  FP+ +L+ATNLT+LD+RFN   GPV    F LDLD LFLNNN FS  LPDN+G+
Sbjct  235  NKYSDEFPSQILKATNLTFLDIRFNNFFGPVPAGAFNLDLDVLFLNNNKFSQQLPDNIGN  294

Query  759  TPVFFLT  779
            T   ++T
Sbjct  295  TAALYVT  301



>ref|XP_002514194.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF48148.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=414

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 96/178 (54%), Gaps = 7/178 (4%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +  +  A++ +K +IT DP  I  +W G  +C     Y+G FC VPRG D+         
Sbjct  61   LNNAYTALQAWKSAITDDPSKILDTWVGTNVC----SYKGIFCAVPRGDDRYAASTGPVV  116

Query  423  gynfngnglslnsFVESFN---DLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                  +     + V+  +   D+ + H+NSN F+G      +   +L ELDLSNN  +G
Sbjct  117  SGIDLNHANLQGNLVKELSLLTDMSLFHLNSNRFSGTIPDTFKDLISLQELDLSNNHFSG  176

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            +FPT  L   NL YLDLRFN  +GPV   +F   LDA+ LNNN F G +PDNLG++P 
Sbjct  177  SFPTVTLYIPNLVYLDLRFNSFSGPVPDDLFNKGLDAILLNNNQFDGQIPDNLGNSPA  234



>ref|XP_007017157.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14382.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=441

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 104/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K  +     +   F   
Sbjct  100  IQKFKSIITSDPLGITETWLGSDVC----SYKGFYCDNPPD-NKSAIAVASIDFNGFQLA  154

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D  + H NSNNF G     + K   L+ELD+SNN+ +G FP AV++ +
Sbjct  155  APTLDGFLDKLPDTALFHANSNNFGGTLSPNIAKLRYLYELDISNNQFSGPFPAAVVDMS  214

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             LT+LD+RFN  TG V  Q+FT +LDALF+NNN     LPD++GST + +LT
Sbjct  215  GLTFLDIRFNFFTGSVPAQIFTQNLDALFINNNNLMIQLPDSIGSTHILYLT  266



>ref|XP_009345138.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=426

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 100/172 (58%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I +F+ +I  DP  IT +W G+++C     Y+GF+C  P   +K        +   F  +
Sbjct  79   IMSFRNTIISDPLGITNTWVGSDIC----NYKGFYCDNPPD-NKSATTLASIDFNGFQLS  133

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN  +G FPTAVL   
Sbjct  134  APTLDGFIDQLPDLALFHANSNNFSGIVSPKIANLQYLYELDISNNNFSGPFPTAVLTMN  193

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L +LD+R+N  TG V PQ+F   L+ LF+NNN F   LPDNLG+T   +LT
Sbjct  194  SLLFLDIRYNSFTGSVPPQIFEQTLEVLFINNNNFIQKLPDNLGATRALYLT  245



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 101/180 (56%), Gaps = 7/180 (4%)
 Frame = +3

Query  246  RKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfng  425
            R++   I+ FKK+IT DP+ +T++W G ++C    KY+GFFC  P    KK       + 
Sbjct  87   RRAYYVIQRFKKTITSDPRGVTRTWRGAKVC----KYKGFFCETP-PNRKKMPTIASVDF  141

Query  426  ynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPV-QKFPTLFELDLSNNKLAGAFP  602
              F     S+  FV+   DL + H NSNN +    IP+  K    +ELD+SNN + G+FP
Sbjct  142  NTFRLAAPSVKKFVDQLPDLALFHANSNNLSARDTIPLLSKLRFFYELDVSNNNIPGSFP  201

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQV-ftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              VL   N+T+LDLRFN  +GP+ P V     +  LFLNNN F   LPD LG T   +LT
Sbjct  202  INVLPLQNVTFLDLRFNKFSGPLPPAVFDLKLIQVLFLNNNNFYQRLPDALGRTTAAYLT  261



>emb|CAN61023.1| hypothetical protein VITISV_001143 [Vitis vinifera]
Length=479

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 102/172 (59%), Gaps = 5/172 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT  P  I +SW+G ++C  K    GF+C  P   +K  +     +   F  
Sbjct  170  VIQKFKAIITSVPLGIAKSWQGLDICSCK----GFYCDNP-PDNKTAIALASIDFNGFQL  224

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               +L+ F+    D+ + H NSNNF G     + K P L+ELD+SNNKL+G+FP A+L  
Sbjct  225  GAPTLDGFINQLTDIALFHANSNNFAGTNPPDIAKLPXLYELDISNNKLSGSFPXAILGI  284

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
             +LT+LD+RFN+ TG V  Q+F+ +LD LF+ +N F   LPDNLG+T + FL
Sbjct  285  KSLTFLDIRFNLFTGSVPSQLFSQNLDVLFIKDNNFRQTLPDNLGNTHIGFL  336



>ref|XP_006397360.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
 gb|ESQ38813.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
Length=391

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 105/183 (57%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  31   LDQRLAVVYPVIQRFKSLITLDPFKVTQTWFGSDIC----SYRGFHCDNPPD-NKTAVTV  85

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +  +F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNNK  
Sbjct  86   ASIDFNDFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNKFT  145

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FPTAV+    LT+LD+RFN  +G V PQ+F  +L+ LF+N+N F+  LP+  G + + 
Sbjct  146  GPFPTAVVGMPGLTFLDIRFNSFSGSVPPQIFGQNLEVLFINDNTFTASLPEIPGDSHIL  205

Query  771  FLT  779
            FLT
Sbjct  206  FLT  208



>ref|XP_010523006.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=423

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 104/173 (60%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
            AI+ FK  I+ DP N+T +W G+++C     Y+GFFC  P   +   +     +   F  
Sbjct  70   AIQKFKSLISSDPFNVTGTWVGSDIC----SYRGFFCDNPPD-NGSAIAVASIDFNGFQL  124

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
            +  S++ F++   DL + H N+NNF G     + +   L+E D+SNN+ +G FPTAVL  
Sbjct  125  SAPSIDGFLDQLPDLAIFHANTNNFGGVVPPKIAELKYLYEFDISNNRFSGPFPTAVLGM  184

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              LT+LD+RFN  TG V PQ+FT +LD LF+N+N F+  LP+ LG T + FLT
Sbjct  185  PGLTFLDIRFNRFTGSVPPQIFTQNLDVLFINDNEFTANLPETLGETHIQFLT  237



>ref|XP_008796513.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Phoenix 
dactylifera]
Length=402

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 110/184 (60%), Gaps = 7/184 (4%)
 Frame = +3

Query  240  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELC--INKKKYQGFFCYVPRGGDKKRVggi  413
            ++ ++   I+ F+K+IT DP+ I++SW G ++C    +  Y+GFFC +P      R    
Sbjct  19   LLYRAYFVIQRFRKTITDDPKGISKSWRGYDICHKYTQDTYKGFFCGIPPTRKTMR-NVA  77

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  590
              +   +N    +L  F++   DL + H NSNNF+G   +P + K   L+ELD SNNKL 
Sbjct  78   SIDFNGYNLGAETLQGFIDRMPDLAIFHANSNNFSGT--VPDLSKLRFLYELDFSNNKLT  135

Query  591  GAFPTAVLE-ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            G+FP  VL    N+++LDLRFN   G V P VF + LD LF+NNN F+  LPD+LGST  
Sbjct  136  GSFPINVLPLLANISFLDLRFNQFFGTVPPSVFGIKLDVLFINNNNFTQALPDDLGSTNA  195

Query  768  FFLT  779
             +LT
Sbjct  196  SYLT  199



>ref|XP_007042487.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98318.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=415

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 101/173 (58%), Gaps = 8/173 (5%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP N T +W G ++C     Y GFFC  P   ++  +     +   F   
Sbjct  61   IQAFKGTITGDPLNKTGNWVGCDIC----NYTGFFCDNPPD-NESALALAGIDFNGFLLT  115

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  620
              +L  F++   DL + H NSN FTG+  +P V   P  +ELD+SNN  +G FPT VL  
Sbjct  116  APTLEGFIDMLPDLAIFHANSNKFTGS--VPDVSNLPYFYELDISNNIFSGTFPTTVLGI  173

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             +L++LD+RFN   G V PQ+F   L+ LF+N+N F+  LP+N GSTPV +LT
Sbjct  174  KDLSFLDIRFNSFAGTVPPQIFNQALEVLFINDNDFTATLPENFGSTPVLYLT  226



>ref|XP_010094650.1| Uncharacterized protein L484_008882 [Morus notabilis]
 gb|EXB56501.1| Uncharacterized protein L484_008882 [Morus notabilis]
Length=415

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP NIT+SW G+++C     Y GF+C  P   +   +     +   F  +
Sbjct  64   IQKFKSIITSDPLNITKSWVGSDIC----NYTGFYCESP-PDNASAMAVASVDFNGFQLS  118

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSNNF+G     + K   L+ELD+SNNKL+G+FP AVL   
Sbjct  119  APTLDGFLDQLPDIALFHANSNNFSGTLSPNIAKLKYLYELDVSNNKLSGSFPNAVLGME  178

Query  624  NLTYLDLRFNMLTGPVHPQV  683
            +L++LD+RFN+ TG V PQ+
Sbjct  179  SLSFLDIRFNLFTGSVPPQI  198



>gb|EQB58412.1| RAM signaling pathway protein [Colletotrichum gloeosporioides 
Cg-14]
Length=317

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 114/179 (64%), Gaps = 5/179 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + + +  + +FK+ IT DPQ IT++W GN++C    ++ GF C       +K + GI FN
Sbjct  28   LHRDLLLVESFKQKITSDPQGITKNWTGNDVC----EFNGFSCDNNPNTGQKALAGIDFN  83

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            G+ F G  L+L+ F++   DL   H NSN F G     +     L+ELDLS+NKL+G FP
Sbjct  84   GFGFEGQKLTLDGFLDKLTDLTFFHANSNGFVGQIPSDLSALKWLYELDLSSNKLSGPFP  143

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             AVL A +LT+LDLRFN  +G +  ++FTLDLD +FLN+N F G +PD +GSTP  ++T
Sbjct  144  NAVLNA-DLTFLDLRFNEFSGSIPRELFTLDLDVIFLNDNKFVGSIPDTIGSTPARYIT  201



>ref|XP_010455221.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=407

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 105/185 (57%), Gaps = 7/185 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSQIVNLKYLYELDISNNRFT  158

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPD--NLGSTP  764
            G FPTAV+  + LT+LD+RFN  +G V PQ+   +LD LF+N+N F+  LP+    G+T 
Sbjct  159  GQFPTAVVGMSGLTFLDIRFNSFSGSVPPQILGQNLDVLFINDNGFTASLPEVPGDGTTH  218

Query  765  VFFLT  779
            + +LT
Sbjct  219  ILYLT  223



>ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
 sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=404

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 106/185 (57%), Gaps = 7/185 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK  IT DP N+T++W G+++C     Y+GF C  P   +K  V  
Sbjct  41   LDQRLAVVYPVIQRFKSLITLDPYNVTKTWIGSDIC----SYRGFHCDNPPH-NKTAVTV  95

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  96   ASIDFNGFQLSAPSIEGFIDQFADLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNRFT  155

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPD--NLGSTP  764
            G FPTAV+  + LT++D+RFN  +G + PQ+   +L+ LF+N+N F+  LP+    G+T 
Sbjct  156  GQFPTAVVGMSGLTFIDIRFNSFSGSIPPQILGQNLEVLFINDNGFTASLPEIPGDGTTH  215

Query  765  VFFLT  779
            + FLT
Sbjct  216  ILFLT  220



>ref|XP_011069732.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=424

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 104/172 (60%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP NIT SW G ++C     Y+GF+C  P   +K  +     +   F  +
Sbjct  79   IQKFKNLITSDPLNITGSWVGADIC----NYRGFYCESPPD-NKSAIALASIDFNGFQLS  133

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SLN F++   D+ + H NSNNF GA    + K   L+ELD+SNN  +G FPTA+L   
Sbjct  134  APSLNGFLDQLPDIALFHANSNNFAGAISPNIAKLQYLYELDISNNNFSGPFPTALLGMD  193

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++LD+RFN  +G V  Q+F+ DLDALF+NNN F   LPD +GS  + +LT
Sbjct  194  SLSFLDVRFNSFSGAVPQQLFSKDLDALFINNNNFMTRLPDTIGSGRILYLT  245



>ref|XP_010664552.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06744-like 
[Vitis vinifera]
Length=459

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 101/172 (59%), Gaps = 5/172 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT  P  I +SW+G ++C  K    GF+C  P   +K  +     +   F  
Sbjct  107  VIQKFKAIITSVPLGIAKSWQGLDICSCK----GFYCDNPPD-NKTAIALASIDFNGFQL  161

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               +L+ F+    D+ + H NSNNF G     + K P L+ELD+SNNKL+G+FP A+L  
Sbjct  162  GAPTLDGFINQLTDIALFHANSNNFAGTNPPDIAKLPCLYELDISNNKLSGSFPRAILGI  221

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
             +LT+LD+RFN+ TG V  Q+F+ +LD LF+ +N F   LPDNLG+T V  L
Sbjct  222  KSLTFLDIRFNLFTGSVPSQLFSQNLDVLFIKDNNFRQTLPDNLGNTHVLCL  273



>ref|XP_007601154.1| crisp-1 [Colletotrichum fioriniae PJ7]
 gb|EXF75160.1| crisp-1 [Colletotrichum fioriniae PJ7]
Length=316

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 107/179 (60%), Gaps = 5/179 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + + +  +++ K  IT DP  +T++W GN +C     + GF C          + GI  N
Sbjct  28   LGRDLSLVQSLKHKITVDPSGVTKNWTGNNVC----NFDGFSCAKNPNTGNNALSGIDLN  83

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            G+   G  L L+ F++   DL   H NSN FTG+    +     L+E+D+SNNKL+G FP
Sbjct  84   GFGLEGKDLVLDGFLDKLTDLTFFHANSNGFTGSLPKDLSALKWLWEIDVSNNKLSGPFP  143

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            T V +  NLT+LDLRFN  +GP+  + F LDL+ LFLN+N FSG +P N+GS+PV +LT
Sbjct  144  TGVFD-LNLTFLDLRFNEFSGPIPKEAFNLDLEVLFLNDNKFSGSIPSNVGSSPVIYLT  201



>ref|XP_010270768.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=475

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 97/172 (56%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I++FK  IT DP  IT +W G+++C     Y+GF+C  P      R              
Sbjct  109  IQSFKNIITSDPLGITSTWVGSDIC----NYRGFYCDNPPDDPSVRALAGIDFNGYQLAA  164

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
                  F++   DL + H N+NNFTG     + +   L+ELD+SNN  +G FPTAVL   
Sbjct  165  PTLDG-FIDLLPDLAIFHANTNNFTGIISPKIAQLRYLYELDISNNLFSGQFPTAVLGMN  223

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+RFN  +G V  Q+FT  LD LF+NNN F   LP+NLG+TPV +LT
Sbjct  224  GLSFLDIRFNSFSGSVPAQIFTQPLDVLFINNNNFMQTLPNNLGNTPVRYLT  275



>ref|XP_004248758.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=442

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 106/180 (59%), Gaps = 4/180 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +  +   I+  K  IT+DP  IT++W G+++C    KY+GF C        K +  + FN
Sbjct  77   VEIAYHVIQKLKSKITHDPLGITKTWNGSDVC---NKYKGFRCATVPDLKVKALAAVDFN  133

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
             Y F+G  L+++ F++   D+ + H N+NNF G     +     L+ELDLSNNK  G FP
Sbjct  134  QYKFDGPDLTIDGFIDELPDITIFHANTNNFKGTIPKKIANLRYLYELDLSNNKYNGEFP  193

Query  603  -TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
               V  A  L +LDLRFN  +G V PQ+F L+LD LF+NNN     LPDNLGSTPV +LT
Sbjct  194  NNIVFGAKKLYFLDLRFNSFSGLVSPQLFMLNLDVLFINNNNLIQKLPDNLGSTPVLYLT  253



>ref|XP_008799889.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=447

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 98/174 (56%), Gaps = 10/174 (6%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FKK+IT DP N+T +W GN  C     YQGF+C  P                     
Sbjct  85   IQRFKKTITCDPNNVTGTWVGNLPC----TYQGFYCEAPPDSPNTPTIASVDFNGFHLCA  140

Query  444  glslnsFVESFNDLVVIHVNSNNFTGA-PGI-PVQKFPTLFELDLSNNKLAGAFPTAVLE  617
                  F++   DL + H NSNNFTG  P + P+Q F   +ELD+SNN ++G+FP  VL 
Sbjct  141  PTIAG-FIDQLPDLALFHANSNNFTGTIPDLTPLQYF---YELDVSNNNMSGSFPGNVLP  196

Query  618  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              NLT+LDLRFN+  G V   +F + LD LFLNNN F+ PLP NLG T V +LT
Sbjct  197  LANLTFLDLRFNLFAGTVPSSIFNIALDVLFLNNNNFNQPLPANLGYTTVAYLT  250



>ref|XP_010438766.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 84/151 (56%), Gaps = 5/151 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  683
            G FPTAV+  + LT+LD+RFN  +G V PQ+
Sbjct  159  GQFPTAVVGMSGLTFLDIRFNSFSGSVPPQI  189



>ref|XP_006289202.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
 gb|EOA22100.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
Length=407

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 105/185 (57%), Gaps = 7/185 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK  IT DP N+T++W G+++C     Y+GF C  P   +   V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYNVTKTWTGSDIC----SYRGFHCDNPPD-NNTAVTV  98

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPD--NLGSTP  764
            G FPTAV+  + LT+LD+RFN  +G V PQ+   +LD LF+N+N F+  LP+    G+T 
Sbjct  159  GQFPTAVVGMSGLTFLDIRFNFFSGSVPPQILGQNLDVLFINDNGFTASLPEIPGDGTTH  218

Query  765  VFFLT  779
            + +LT
Sbjct  219  ILYLT  223



>ref|XP_002885307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61566.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 111/182 (61%), Gaps = 8/182 (4%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I+     I+ F+  I  DP+ I ++W G ++C  + KY G  C    G +   +  I FN
Sbjct  125  IKNVYSVIKNFQTLIENDPKKILRTWVGTDICA-QDKYIGLECAKFPGTNDLALASIQFN  183

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTL---FELDLSNNKLAG  593
             +N  G  L L++F+    ++ + H NSN+F G+    V KF  L   FELDLSNNKL+G
Sbjct  184  NFNLGGKKLRLDNFLNKLEEVTIFHANSNSFVGS----VPKFSNLKYLFELDLSNNKLSG  239

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP+NLGS    +
Sbjct  240  EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQRLPENLGSITALY  299

Query  774  LT  779
            LT
Sbjct  300  LT  301



>ref|XP_007285579.1| aldo/keto reductase, putative [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA25352.1| aldo/keto reductase, putative [Colletotrichum gloeosporioides 
Nara gc5]
Length=653

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 114/179 (64%), Gaps = 5/179 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + + +  + +FK+ IT DPQ IT++W GN++C    K+ GF C       +K + GI FN
Sbjct  364  LHRDLLLVESFKQKITSDPQGITKNWTGNDIC----KFNGFSCDNNPNTGQKALAGIDFN  419

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            G+ F G  L+L+ F++   DL   H NSN F G     +     L+ELDLS+NKL+G FP
Sbjct  420  GFGFEGQKLTLDGFLDKLTDLTFFHANSNGFVGQIPSDLSALKWLYELDLSSNKLSGPFP  479

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             AVL A +LT+LDLRFN  +G +  ++FTLDLD +FLN+N F G +PD +GSTP  ++T
Sbjct  480  KAVLNA-DLTFLDLRFNEFSGSIPRELFTLDLDVIFLNDNKFVGSIPDTIGSTPARYIT  537



>ref|XP_010928365.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=457

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 98/173 (57%), Gaps = 8/173 (5%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FKK+IT DP N+TQ+W G   C     YQGF+C  P                     
Sbjct  94   IQLFKKTITCDPNNVTQTWVGYRPC----TYQGFYCEAPPDSPDTPTIASIDFNGFHLCA  149

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  620
                  F++   DL + H NSNNFTG   IP +      +ELD+SNN ++G FP  VL  
Sbjct  150  PTIAG-FIDKLPDLALFHANSNNFTGT--IPDLTGLQYFYELDVSNNNMSGPFPNDVLPL  206

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             NLT+LDLRFN+  G V P +F+LDLD LFLNNNFF+  LP NLGST V +LT
Sbjct  207  ANLTFLDLRFNLFAGAVPPSIFSLDLDVLFLNNNFFNQSLPFNLGSTQVAYLT  259



>ref|XP_006356575.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=444

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 107/180 (59%), Gaps = 4/180 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +  +   I+  K  ITYDP +IT++W G+++C    KY+GF C        K +  + FN
Sbjct  79   VEIAYHVIQKLKSKITYDPLHITKTWIGSDVC---NKYKGFRCATVPDLKVKALAAVDFN  135

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
             Y F+G  L+++ F++   D+ + H N+NNF G     +     L+ELDLSNNK  G FP
Sbjct  136  QYQFDGPDLTIDGFLDELPDITIFHANTNNFKGTIPKKIANLRYLYELDLSNNKYNGEFP  195

Query  603  -TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
               V  A  L +LDLRFN  +G V P+VF L+LD LF+NNN     LPDNLGSTPV +LT
Sbjct  196  KNIVFGAKKLYFLDLRFNSFSGLVPPEVFLLNLDVLFINNNNLIQKLPDNLGSTPVLYLT  255



>ref|XP_009617390.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 101/173 (58%), Gaps = 6/173 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  +T+SW G  +C     Y GF+C  P   +K  +     +   F  +
Sbjct  70   IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCETPPD-NKSAIAVASIDFNGFQLS  124

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +G FP A+L   
Sbjct  125  APNLDGFLDQLPDIALFHANSNNFSGTLSANIANLPYLYELDISNNQFSGPFPPAILGMN  184

Query  624  NLTYLDLRFNMLTGPVHPQV-ftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L++LD+RFN  TG V PQ+     LDA+F+NNN F    PDN+GS+ V +LT
Sbjct  185  SLSFLDIRFNSFTGSVPPQLFTKDQLDAIFINNNNFMQKFPDNIGSSHVLYLT  237



>ref|XP_002282474.2| PREDICTED: uncharacterized protein At4g06744 [Vitis vinifera]
 emb|CBI32376.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 102/172 (59%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK SIT DP  IT +W G ++C    KY+GF+C  P   +   +     +   F   
Sbjct  90   IQKFKASITSDPLGITSTWVGGDIC----KYKGFYCDNPPD-NSTSLALAGIDFNGFQLA  144

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F+++  DL + H N+N F+G     + K P  +ELDLSNNK +G FP  VL   
Sbjct  145  APSLDGFIDALPDLAIFHANTNFFSGNITPKIAKLPYFYELDLSNNKFSGEFPPTVLAIP  204

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+R+N  +G V PQVF  +LD LF+NNN F+  +PD+ G+TP  ++T
Sbjct  205  GLSFLDIRYNSFSGSVPPQVFVQNLDVLFINNNNFNQKIPDDFGNTPARYIT  256



>ref|XP_003555862.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN32258.1| Hypothetical protein glysoja_039284 [Glycine soja]
Length=454

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 106/185 (57%), Gaps = 11/185 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            + K+ + +  FK ++ YDP   TQSW E  + C     + G  C      ++K V G+  
Sbjct  83   LEKARRVLLKFK-TLIYDPDCYTQSWNENTDTC----DFNGVRCATYPNSEEKAVAGLDL  137

Query  420  ngynfngnglsl---nsFVESFNDLVVIHVNSNNFTGAPGIP--VQKFPTLFELDLSNNK  584
            NG   +            V+S  +L   HVNSNNF+   G P  +  FP  FELDLSNNK
Sbjct  138  NGAKLSTKDGCNLPLTGLVDSIPELTFFHVNSNNFSFTGGFPNNITTFPFFFELDLSNNK  197

Query  585  LAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
            ++G FPT  ++   L +LDLRFN LTGP+ P++F  DLD +F+N+N F+G LP+N GSTP
Sbjct  198  VSGQFPTQAIQNNQLVFLDLRFNQLTGPIDPKLFQRDLDVIFVNDNQFTGCLPENFGSTP  257

Query  765  VFFLT  779
              +LT
Sbjct  258  ARYLT  262



>ref|XP_010421726.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 104/185 (56%), Gaps = 7/185 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPD--NLGSTP  764
            G FPTAV+  + L +LD+RFN  +G V PQ+   +LD LF+N+N F+  LP+    G+T 
Sbjct  159  GQFPTAVVGMSGLKFLDIRFNSFSGSVPPQILGQNLDVLFINDNGFTASLPEVPGDGTTH  218

Query  765  VFFLT  779
            + +LT
Sbjct  219  ILYLT  223



>ref|XP_010227187.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brachypodium distachyon]
Length=1492

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 108/183 (59%), Gaps = 9/183 (5%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++   I+ FKK++  DPQNI  SW G ++C     Y+GF+C  P     + V     +
Sbjct  79   LYRAYLVIQKFKKTVICDPQNIAGSWSGTDIC-GTSSYKGFYCDRPYKVTDRTV--ASVD  135

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GA  596
               +     S+  FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA  A
Sbjct  136  FNGYGLQADSVQGFVDGLPDLALFHANSNNFGGA--VPNLKSLQYFYELDLSNNKLAPAA  193

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVF  770
            FP  VL  TN T++D+RFN   G +   +F+    ++A+F+NNN FSGPLPDNLG +PV 
Sbjct  194  FPLEVLAITNATFIDIRFNSFYGELPAGLFSSFPVIEAIFVNNNQFSGPLPDNLGDSPVN  253

Query  771  FLT  779
            +L+
Sbjct  254  YLS  256



>ref|XP_006300268.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
 gb|EOA33166.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
Length=457

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 101/178 (57%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +R+  +
Sbjct  73   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----SYTGVFC--SRALDNRRIRTV  126

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  127  AGIDLNHGDIAGYLPLELGLLTDLALFHVNSNRFCGTVPRTFNQLKLLFELDLSNNRFAG  186

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL+  +L +LDLRFN   G V  ++F+ DLDA+F+N+N F   LP+NLG +PV
Sbjct  187  KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENLGDSPV  244



>ref|XP_003528523.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN43048.1| Hypothetical protein glysoja_007578 [Glycine soja]
Length=417

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 107/185 (58%), Gaps = 9/185 (5%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            +D  + +    I+TFK +IT DP+ +T +W G  +C     Y GF+C  P   +      
Sbjct  49   IDQRLAQVFPIIQTFKNTITSDPRGVTSTWVGPNIC----NYTGFYCDNPPD-NLTATTI  103

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTG--APGIPVQKFPTLFELDLSNNK  584
               +   F     +L+ F++   DL + H NSN F+G  +P I   KF  L+ELDLSNN 
Sbjct  104  ASIDFNGFQLTAPTLDGFIDQLPDLALFHANSNKFSGIVSPKIAGLKF--LYELDLSNNL  161

Query  585  LAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
             +GAFPT+VL    L++LD+RFN  +G + PQ+F   LD LFLN+N F   LP+NLG+ P
Sbjct  162  FSGAFPTSVLNIPTLSFLDIRFNSFSGTLPPQIFMQTLDVLFLNDNNFMLTLPNNLGNAP  221

Query  765  VFFLT  779
            V +LT
Sbjct  222  VVYLT  226



>ref|XP_009141276.1| PREDICTED: uncharacterized protein At4g06744 isoform X2 [Brassica 
rapa]
Length=343

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 98/173 (57%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP  +TQ+W G+E+C     Y+GF C  P   +K  V     +   F  
Sbjct  41   VIQGFKSLITLDPFKVTQTWIGSEIC----SYRGFHCDNPPD-NKTAVTVASIDFNGFQL  95

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  G FPTAV+  
Sbjct  96   FAPSIEGFIDQLPDLALFHANSNNFGGTVPSKIVNLKYLYELDISNNKFTGQFPTAVVGM  155

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              LT+LD+RFN  +G + PQ+F  +LD LF+N+N F+  LP+  G + + FLT
Sbjct  156  PGLTFLDIRFNSFSGSIPPQIFGQNLDVLFINDNTFTASLPEIPGDSHILFLT  208



>ref|XP_006653860.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=448

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 100/179 (56%), Gaps = 10/179 (6%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-YVPRGG---DKKRVggiyfn  422
            I+ FKK+IT DP+ +T SW G  LC        Y+GF+C Y P  G   D   +     +
Sbjct  87   IQAFKKTITCDPRGVTASWVGPNLCDSHFGGMAYKGFYCDYPPVTGAPQDNTTLTVASID  146

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  599
               F     S+  FV++F DL + H NSNN +G   +P +   P  +ELDLSNN  +GAF
Sbjct  147  FNGFGLCAPSIAGFVDAFPDLALFHANSNNLSGE--VPDLTGLPYFYELDLSNNNFSGAF  204

Query  600  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            P  V+    L +LDLRFN   G V P +F L + ALFLNNN F G +PDN GST   +L
Sbjct  205  PANVVPLGGLLFLDLRFNRFVGTVPPPIFDLSVVALFLNNNGFYGQIPDNFGSTTAEYL  263



>ref|XP_009141268.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Brassica 
rapa]
Length=391

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 101/183 (55%), Gaps = 5/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            +D  +      I+ FK  IT DP  +TQ+W G+E+C     Y+GF C  P   +K  V  
Sbjct  31   IDKRLEVVYPVIQGFKSLITLDPFKVTQTWIGSEIC----SYRGFHCDNPPD-NKTAVTV  85

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   F     S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  
Sbjct  86   ASIDFNGFQLFAPSIEGFIDQLPDLALFHANSNNFGGTVPSKIVNLKYLYELDISNNKFT  145

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            G FPTAV+    LT+LD+RFN  +G + PQ+F  +LD LF+N+N F+  LP+  G + + 
Sbjct  146  GQFPTAVVGMPGLTFLDIRFNSFSGSIPPQIFGQNLDVLFINDNTFTASLPEIPGDSHIL  205

Query  771  FLT  779
            FLT
Sbjct  206  FLT  208



>ref|XP_009768848.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=408

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 7/174 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  +T+SW G  +C     Y GF+C  P   DK  +     +   F  +
Sbjct  67   IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCDTPPD-DKSAIAVASIDFNGFQLS  121

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +G FP A+L   
Sbjct  122  APNLDGFLDQLPDIALFHANSNNFSGTLSANIANLPYLYELDISNNQFSGPFPPAILGMN  181

Query  624  NLTYLDLRFNMLTGPVHPQV-ftldldalflnnnffSGPLPDNLGSTP-VFFLT  779
            +L++LD+RFN  TG V PQ+     LDALF+NNN F    PDNLGS+  V +LT
Sbjct  182  SLSFLDIRFNSFTGSVPPQLFTKDQLDALFINNNNFMQKFPDNLGSSSHVLYLT  235



>gb|KFK39606.1| hypothetical protein AALP_AA3G265800 [Arabis alpina]
Length=403

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 105/186 (56%), Gaps = 8/186 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ F+  IT DP  IT +W G+++C     Y+GF+C  P   +K  +  
Sbjct  41   LDQRLAVVYPIIQRFRLLITLDPFKITHTWTGSDIC----SYRGFYCDNPPD-NKTALTV  95

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   +  +  S+  FV+   DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  96   ASIDFNGYQLSAPSIEGFVDQLPDLGLFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  155

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPD---NLGST  761
            G FPTAVL+   LTYLD+RFN  +G + PQ+F+ +LD LF+N+N F+  LPD   + G  
Sbjct  156  GQFPTAVLDMPGLTYLDIRFNSFSGSIPPQIFSKNLDVLFVNDNGFTASLPDIPEDDGRA  215

Query  762  PVFFLT  779
             + FLT
Sbjct  216  HILFLT  221



>ref|XP_010488556.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Camelina sativa]
Length=444

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT  W G+ +C     Y G FC   R  D +R+  +
Sbjct  73   NPRLRSAYIALQAWKQAILSDPNNITLDWIGSNVC----SYTGVFC--SRALDNRRIRTV  126

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  127  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPRKFKQLKLLFELDLSNNRFAG  186

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LP NLG +PV
Sbjct  187  KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPGNLGDSPV  244



>ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 101/177 (57%), Gaps = 9/177 (5%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP N+T++W G+++C     Y+GF C  P   +   V     +   F  
Sbjct  54   VIQRFKSLITLDPYNVTKTWIGSDIC----SYRGFHCDNPPD-NTTAVTVASIDFNGFQL  108

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
            +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  G FPTAV+  
Sbjct  109  SAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNRFTGQFPTAVVGM  168

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLP----DNLGSTPVFFLT  779
            + LT+LD+RFN  +G + PQ+   +L+ LF+N+N F+  LP    D   +T + FLT
Sbjct  169  SGLTFLDIRFNSFSGSIPPQILGQNLEVLFINDNGFTASLPEIPGDGTSTTHILFLT  225



>ref|XP_010066095.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
 gb|KCW63891.1| hypothetical protein EUGRSUZ_G01566 [Eucalyptus grandis]
Length=382

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 99/183 (54%), Gaps = 6/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK +IT DP  IT SW G  +C     Y GF+C  P   +      
Sbjct  14   LDQRLAAVYPVIQQFKNTITADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  68

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  69   AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  128

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            GAFP AV    NL++LD+RFN  TG V PQVF   LD L++NNN F   +P + GST V 
Sbjct  129  GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQVFKQALDVLYINNNKFMQKIPIDFGSTRVL  187

Query  771  FLT  779
            +LT
Sbjct  188  YLT  190



>emb|CDX75185.1| BnaC09g24970D [Brassica napus]
Length=329

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 98/173 (57%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V     +   F  
Sbjct  41   VIQGFKSLITLDPFKVTQTWIGSDIC----SYRGFHCDNP-PDNKTAVTVASIDFNGFQL  95

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  G FPTAV+  
Sbjct  96   FAPSIEGFIDQLPDLALFHANSNNFGGTVPSNIVNLKYLYELDISNNKFTGQFPTAVVGM  155

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              LT+LD+RFN  +G + PQ+F  +LD LF+N+N F+  LP+  G + + FLT
Sbjct  156  PGLTFLDIRFNSFSGSIPPQIFGQNLDVLFINDNTFTASLPEIPGDSHILFLT  208



>emb|CDY29128.1| BnaA09g53810D [Brassica napus]
Length=329

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 98/173 (57%), Gaps = 5/173 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
             I+ FK  IT DP  +TQ+W G+E+C     Y+GF C  P   +K  +     +   F  
Sbjct  41   VIQGFKSLITLDPFKVTQTWIGSEIC----SYRGFHCDNP-PDNKTAITVASIDFNGFQL  95

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  G FPTAV+  
Sbjct  96   FAPSIEGFIDQLPDLALFHANSNNFGGTVPSKIVNLKYLYELDISNNKFTGQFPTAVVGM  155

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
              L++LD+RFN  +G + PQ+F  +LD LF+N+N F+  LP+  G + + FLT
Sbjct  156  PGLSFLDIRFNSFSGSIPPQIFGQNLDVLFINDNTFTASLPEIPGDSHILFLT  208



>ref|XP_008663372.1| PREDICTED: uncharacterized protein At4g06744-like [Zea mays]
 gb|AFW58791.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=548

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 107/181 (59%), Gaps = 12/181 (7%)
 Frame = +3

Query  249  KSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  428
            ++   I+ F+ +++ DP ++T+SW G +LC     Y+GF+C  P     + +     +  
Sbjct  185  RAYLVIQQFRSAVSCDPMDVTRSWSGTDLC----GYKGFYCERPPNETDRTI--ASVDFN  238

Query  429  nfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-FP  602
             +     SL  FV S  DL + H NSN+F GA  +P +   P L+ELDLSNN+LA A FP
Sbjct  239  GYMLRADSLQGFVNSLPDLALFHANSNDFGGA--VPALAALPFLYELDLSNNRLAPATFP  296

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVFFL  776
            T VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV +L
Sbjct  297  TDVLALTNATFIDIRFNSFYGELPAGVFCRFPRVQAIFVNNNQFSGSLPDNIGQSPVNYL  356

Query  777  T  779
            +
Sbjct  357  S  357



>gb|ENH81556.1| leucine-rich repeat family protein [Colletotrichum orbiculare 
MAFF 240422]
Length=317

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 107/182 (59%), Gaps = 5/182 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            D  + + +  +++FKK IT DP   T++W GN++C    K+ GF C        K + GI
Sbjct  26   DSNLHRDLLLVQSFKKQITSDPHGYTRNWTGNDVC----KFGGFRCADNPNTGLKALSGI  81

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
              N +   GN L L  F++   DL   H N+N FTG     +     L+ELDLS+N+L+G
Sbjct  82   DLNNFELEGNPLKLEGFLDKLTDLTFFHANTNGFTGELPKDLSALKWLWELDLSSNQLSG  141

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FP AVL A NL +LDLRFN   GP+  ++F LDLD +FLN+N F G +P  +GSTP  +
Sbjct  142  PFPEAVLNA-NLVFLDLRFNGFDGPLPEKLFELDLDTIFLNDNKFGGSIPATIGSTPARY  200

Query  774  LT  779
            +T
Sbjct  201  IT  202



>ref|XP_010065987.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=418

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 99/183 (54%), Gaps = 6/183 (3%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK ++T DP  IT SW G  +C     Y GF+C  P   +      
Sbjct  50   LDQRLAAVYPVIQQFKNTVTADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  104

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  105  AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  164

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            GAFP AV    NL++LD+RFN  TG V PQVF   LD L++NNN F   +P + GST V 
Sbjct  165  GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQVFKQALDVLYINNNKFMQKIPIDFGSTRVL  223

Query  771  FLT  779
            +LT
Sbjct  224  YLT  226



>ref|XP_010263446.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=474

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 104/174 (60%), Gaps = 6/174 (3%)
 Frame = +3

Query  264  IRTFKKSITY-DPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfn  437
            I   +K + Y DP+   +SW+G  +C    K++G +C  VP    K   G  +       
Sbjct  112  IVELRKRLEYHDPKGKLKSWKGTNIC----KFEGLYCETVPDFKVKALAGIDFNGFNFGL  167

Query  438  gnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLE  617
            G+ +SL   +E+ +DL + H NSN FTG     + K   L+ELDLSNNK  G+FP  VL 
Sbjct  168  GSNVSLEGIIENLSDLAIFHANSNFFTGKIVSQIGKLRFLYELDLSNNKYTGSFPMPVLN  227

Query  618  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            A NL++LDLRFN   G + P VFTL+LD LF+NNN F GP+P NLGSTP  ++T
Sbjct  228  AKNLSFLDLRFNSFCGYLPPDVFTLNLDVLFVNNNQFDGPIPYNLGSTPARYIT  281



>gb|AEV40972.1| uncharacterized protein At4g06744 precursor [Oryza punctata]
Length=457

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 103/190 (54%), Gaps = 10/190 (5%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFCYVP--RGG--  389
            L+  +R     I+ FK +IT DP+ +T SW G  LC        Y+GF+C  P  +G   
Sbjct  78   LNEKLRTLYPVIQAFKTTITSDPRGVTASWVGPNLCDSYFGGNMYKGFYCDHPPVKGAPQ  137

Query  390  DKKRVggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFEL  566
            D   +     +   +     SL  F+++F DL + H NSNNF+G   +P +   P  +EL
Sbjct  138  DDTTLTIASIDFNGYGLGAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTGLPYFYEL  195

Query  567  DLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPD  746
            DLSNN  +G FP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PD
Sbjct  196  DLSNNNFSGVFPANVVPLGGLLFLDLRFNRFVGTVPPPVFDLSVVALFLNNNGFYGRIPD  255

Query  747  NLGSTPVFFL  776
            N GST   +L
Sbjct  256  NFGSTTAEYL  265



>gb|EMS59107.1| hypothetical protein TRIUR3_04108 [Triticum urartu]
Length=442

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 9/155 (6%)
 Frame = +3

Query  240  VIRKSIKAIR---TFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKR  401
            V+R  + A R    FK++IT DP N+T +W G  +C + K    Y+GF+C  P     K 
Sbjct  57   VVRDHVPASRVSVAFKRTITSDPLNVTATWVGANICDSAKGGGAYKGFYCDTPPDDANKT  116

Query  402  VggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSN  578
            +     +   F+    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSN
Sbjct  117  LTVASIDFNGFHLCAPTLAGFIDAFPDLALFHANSNNFSGVLPELTSLRY--FYELDLSN  174

Query  579  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  683
            N  +GAFP AV     L +LDLRFN   G V P V
Sbjct  175  NAFSGAFPAAVPPLGRLAFLDLRFNGFAGEVPPSV  209



>ref|XP_002518709.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43634.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=510

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 106/181 (59%), Gaps = 3/181 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I++    I+ FKK+IT+DP +IT SW+     +    Y+GF C +        V    FN
Sbjct  132  IKRDYFTIQKFKKTITHDPFHITDSWKEGVFNV-CATYKGFACDIRPDMGVLAVAAADFN  190

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  596
            GYNFNG    +  F++   D+ + H NSNNFTG     I +     L+ELDLSNN   G 
Sbjct  191  GYNFNGPNFQIKGFLDKLEDVAIFHANSNNFTGIVPQNIDIMNINFLYELDLSNNNYTGG  250

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FP  VL ATNLT+LD+RFN   G V  +VF LDLD LFLNNN F   LP+N+GST   +L
Sbjct  251  FPMNVLGATNLTFLDIRFNKFYGSVPKEVFNLDLDVLFLNNNQFDQQLPENIGSTSALYL  310

Query  777  T  779
            T
Sbjct  311  T  311



>ref|XP_006285388.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
 gb|EOA18286.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
Length=747

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 100/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G FC      D +R+  +
Sbjct  73   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVFCAP--ALDNRRIRTV  126

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  127  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  186

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT +L   +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  187  VFPTVILHLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  244



>gb|EYU25462.1| hypothetical protein MIMGU_mgv1a024676mg, partial [Erythranthe 
guttata]
Length=400

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 6/141 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  I  DP NIT +W G+++C     Y+GF+C  P   +K        +   F   
Sbjct  43   IQKFKNIIISDPFNITVTWVGSDIC----SYRGFYCESPPD-NKSATALASIDFNGFQLT  97

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP-TAVLEA  620
              +L  F++S  DL + H NSNNF GA    +     L+ELDLSNNK  GAFP  AVL  
Sbjct  98   APTLVGFLDSLPDLALFHANSNNFAGAISPAIGNLKYLYELDLSNNKFTGAFPAAAVLGM  157

Query  621  TNLTYLDLRFNMLTGPVHPQV  683
            T L +LDLRFN  +G V PQ+
Sbjct  158  TGLFFLDLRFNFFSGSVPPQL  178



>ref|XP_011467740.1| PREDICTED: uncharacterized protein At4g06744 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 103/183 (56%), Gaps = 11/183 (6%)
 Frame = +3

Query  252  SIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngyn  431
            +++ I+ F+K I  DP NIT +W G+  C    K+ GF C V    ++  V G+ FNG  
Sbjct  135  ALRVIKRFQKLIGVDPDNITGTWNGDNPC----KFTGFICGVVPVYNQNAVAGVNFNGRK  190

Query  432  fngnglslns------FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
              G      +      F++   DLV  H NSNNFTG   I   + P  +ELDLSNNKL G
Sbjct  191  LAGKWGGKETKLPLDGFLDQLPDLVFFHANSNNFTGQVPIGTSRLPYFYELDLSNNKLDG  250

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV-ftldldalflnnnffSGPLPDNLGSTPVF  770
             FP  VL A NLT+LDLRFN   G V  QV    D+D +FLNNN F+  +PD +GS+   
Sbjct  251  GFPYEVLSAPNLTFLDLRFNNYQGSVPSQVFLYKDIDVVFLNNNNFNEKIPDAIGSSTAH  310

Query  771  FLT  779
            +LT
Sbjct  311  YLT  313



>gb|EPS72402.1| hypothetical protein M569_02357, partial [Genlisea aurea]
Length=395

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 101/178 (57%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P ++ +  A++++K++I  DP NIT +W G ++C     Y G FC+       +R   +
Sbjct  11   NPRLQNAYIALQSWKEAILSDPNNITANWIGPDVC----DYNGIFCWTSPDNHCERTVAV  66

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                       L     +    DL ++HVNSN F G   + +     L+ELDLSNN+ +G
Sbjct  67   IDVNNGNIAGHLPHELGL--LYDLAILHVNSNRFCGVVPLSLSNLRLLYELDLSNNRFSG  124

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+ ++L YLD+RFN   GP+  ++F  +LDA+F+N+N FS  LP+N+G +P 
Sbjct  125  KFPDHVLDLSSLAYLDIRFNEFEGPIPKRLFEKNLDAIFINDNRFSSSLPENIGDSPA  182



>gb|ACG34018.1| protein binding protein [Zea mays]
 tpg|DAA37048.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=442

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 106/183 (58%), Gaps = 12/183 (7%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++   I+ F+ ++T DP  +TQSW G ++C     Y+GFFC  P     + +     +
Sbjct  82   LYRAYLVIQQFRSTVTCDPMGVTQSWSGTDVC----SYKGFFCERPPNVTDRAI--ASVD  135

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLA-GA  596
               +     SL  FV+S  DL + H NSN+F GA P +   ++   +ELDLSNNKLA  A
Sbjct  136  FNGYMLQAGSLRGFVDSLPDLALFHANSNDFGGAVPALGGLQY--FYELDLSNNKLAPAA  193

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVF  770
            FP  VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV 
Sbjct  194  FPADVLGLTNATFVDIRFNSFYGELPAGVFCKLPRVQAIFVNNNRFSGALPDNIGQSPVN  253

Query  771  FLT  779
            +L+
Sbjct  254  YLS  256



>emb|CDX94809.1| BnaC03g43790D [Brassica napus]
Length=530

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +R+  +
Sbjct  68   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----SYTGVFCS--RAPDNRRIRTV  121

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G      +    LFELDLSNN+ AG
Sbjct  122  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKHLKLLFELDLSNNRFAG  181

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LPDN G +PV
Sbjct  182  KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPV  239



>ref|XP_010513507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=719

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 100/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT  W G+ +C     Y G FC   R  D +R+  +
Sbjct  68   NPRLRSAYIALQAWKQAILSDPNNITLDWIGSNVC----SYTGVFC--SRALDNRRIRTV  121

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    D+ + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  122  AGIDLNHADIAGYLPEELGLLTDVALFHVNSNRFCGTVPRKFKQLKLLFELDLSNNRFAG  181

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LP+NLG +PV
Sbjct  182  KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPENLGDSPV  239



>gb|KJB12258.1| hypothetical protein B456_002G008600 [Gossypium raimondii]
Length=497

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 108/187 (58%), Gaps = 9/187 (5%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDP--QNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVg  407
            + ++  S   I+ FKK I  D   +  T++W G  +C    KY+GF C V     KK V 
Sbjct  116  NELLATSYGVIQKFKKLIKPDENGKRYTKTWNGPNVC----KYKGFNCDVRPDVKKKAVA  171

Query  408  giyfngynfngnglsl--nsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSN  578
             + FNG   +G   SL  + F++   DL + H NSNNFTG  P I   K   L+ELDLSN
Sbjct  172  AVDFNGAKLSGINGSLPLHDFIDGLTDLAIFHANSNNFTGTVPFIGTSKIKYLYELDLSN  231

Query  579  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGS  758
            NK+   FP  VL AT LT+LD+RFN + G V   VF LDLD LF+NNN F   LP+NLG 
Sbjct  232  NKITDDFPMEVLRATQLTFLDIRFNRIKGVVPATVFKLDLDVLFINNNNFRQRLPENLGD  291

Query  759  TPVFFLT  779
            TP  ++T
Sbjct  292  TPALYIT  298



>emb|CAB37452.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78869.1| extensin-like protein [Arabidopsis thaliana]
Length=839

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 101/178 (57%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  75   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYCAP--ALDNRRIRTV  128

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G       +   LFELDLSNN+ AG
Sbjct  129  AGIDLNHADIAGYLPQELGLLTDLALFHINSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  188

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  189  IFPTVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  246



>ref|XP_004505255.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=407

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 100/172 (58%), Gaps = 5/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+TFK +IT DP  IT +W G  +C     Y+GF+C  P   +         +   F+  
Sbjct  56   IQTFKNTITSDPLGITTTWVGPNIC----NYKGFYCDNPPD-NLTATTVASIDFNGFHLA  110

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN L+G FP ++L   
Sbjct  111  APSLDGFIDQLPDLALFHANSNNFSGTISSKLASLKYLYELDLSNNFLSGTFPISILNIP  170

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             L++LD+R+N+ TG V  Q+FT  LDA+FLNNN F   LPDNLG T   ++T
Sbjct  171  TLSFLDIRYNLFTGTVPQQIFTQTLDAIFLNNNNFILTLPDNLGDTKASYIT  222



>ref|NP_193602.4| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
 sp|Q9SN46.2|LRX5_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 5; Short=AtLRX5; 
Short=LRR/EXTENSIN5; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE84074.1| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
Length=857

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 101/178 (57%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  75   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYC--APALDNRRIRTV  128

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G       +   LFELDLSNN+ AG
Sbjct  129  AGIDLNHADIAGYLPQELGLLTDLALFHINSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  188

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  189  IFPTVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  246



>ref|XP_009395500.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 94/172 (55%), Gaps = 6/172 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK+SIT DP  + Q+W G   C     YQGF+C  P                     
Sbjct  93   IQRFKRSITCDPNGVIQTWVGYRPC----TYQGFYCAAPPDSPDTPTIASVDFNGFRLCA  148

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
                  FV+   D+ + H NSNNF+G P   +   P L+ELD+SNN  +G FP  VL  +
Sbjct  149  PTVAG-FVDQLPDVALFHANSNNFSG-PIPDLTGLPYLYELDVSNNLHSGPFPADVLALS  206

Query  624  NLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            NL +LDLR+N+  G V   VF LDLD LFLNNN F  PLP +LGS+PV +LT
Sbjct  207  NLIFLDLRYNLFAGSVPASVFALDLDVLFLNNNNFFRPLPADLGSSPVAYLT  258



>emb|CDX93014.1| BnaA03g37360D [Brassica napus]
Length=456

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +R+  +
Sbjct  70   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVCT----YTGVFC--SRAPDNRRIRTV  123

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVN+N F G      +    LFELDLSNN+ AG
Sbjct  124  AGIDLNHADIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFKHLKLLFELDLSNNRFAG  183

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LPDN G +PV
Sbjct  184  KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPV  241



>gb|KJB54313.1| hypothetical protein B456_009G028700 [Gossypium raimondii]
Length=357

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 101/175 (58%), Gaps = 5/175 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +  +  A++ +K +I  DP  I ++W G+++C     Y+G FC  P+GG          +
Sbjct  64   LSSAYTALQAWKSAIADDPMRILETWVGSDVC----SYKGVFCADPQGGVASEPFVAGID  119

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
              + N  G  ++  +    D+ ++H+NSN F+G      ++  +L ELDLSNN+L+G FP
Sbjct  120  LNHANLLGTLVSE-LSVLTDISILHLNSNRFSGTVPDSFRELSSLQELDLSNNRLSGPFP  178

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            T  L   NL YLDLRFN  +GPV   +F   LDA+FLN+N F G +P NLG++P 
Sbjct  179  TVTLYMPNLVYLDLRFNSFSGPVPQDLFNKGLDAIFLNDNQFEGEIPQNLGNSPA  233



>gb|EPS58531.1| hypothetical protein M569_16282, partial [Genlisea aurea]
Length=344

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 5/141 (4%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
            AI+ FK  ++ DP+N+T SW G ++C    +Y+GF+C  P   +   V     +   F+ 
Sbjct  14   AIQKFKSLVSSDPRNVTVSWVGADVC----RYRGFYCDSPPD-NSSAVAVASVDFNGFHL  68

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               +L  F++   D+ + H NSN F+G   + + + P L+ELDLSNN L+G FP  +L  
Sbjct  69   TAPTLAGFIDQLPDIAIFHANSNFFSGGVPVGIARLPYLYELDLSNNLLSGDFPAEILAM  128

Query  621  TNLTYLDLRFNMLTGPVHPQV  683
               + LD+RFN  TG V P +
Sbjct  129  GGFSLLDIRFNFFTGAVPPAI  149



>ref|XP_002867981.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44240.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 101/178 (57%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  76   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYCAP--ALDNRRIRTV  129

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  130  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  189

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  190  IFPTVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  247



>ref|XP_009605357.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=382

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 97/173 (56%), Gaps = 6/173 (3%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK  IT DP  +T+SW G  +C     Y GF+C  P   +K  +     +   F   
Sbjct  39   IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCESPPD-NKSAIALASIDFNGFQLT  93

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  623
              +L  F++   D+ + H NSNNF+G     +   P L+ELD+SNN+  G FP+A+L   
Sbjct  94   APTLVGFLDQLPDIAIFHANSNNFSGTLSPKIANLPYLYELDISNNQFFGPFPSAILGMN  153

Query  624  NLTYLDLRFNMLTGPVHPQV-ftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +L+ LD+RFN  TG V PQ+     LDALF+NNN F    PDN+ S+ V +LT
Sbjct  154  SLSILDIRFNSFTGSVPPQLFTKDQLDALFINNNNFMQRFPDNIASSHVIYLT  206



>gb|EMT03089.1| hypothetical protein F775_11041 [Aegilops tauschii]
Length=447

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 110/183 (60%), Gaps = 11/183 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++   I+ F+K++  DP+ +T +W G +LC     Y+GFFC  P     + V     +
Sbjct  80   LYRAYLVIQKFRKTVICDPKGVTATWAGTDLC---GSYKGFFCGRPINVSDRTV--ASVD  134

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  596
               FN    SL  FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA A 
Sbjct  135  LNGFNLRSDSLQGFVDGLPDLALFHANSNNFGGA--VPNLRGLQYFYELDLSNNKLAPAP  192

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVF  770
            FPT VL  TN T++D+RFN   G +   +F+   +++A+F+NNN FSG LPDNLG +PV 
Sbjct  193  FPTDVLGLTNCTFIDIRFNSFFGELPAGLFSSFPEVEAIFVNNNHFSGQLPDNLGDSPVN  252

Query  771  FLT  779
            +L+
Sbjct  253  YLS  255



>dbj|BAJ86461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 110/183 (60%), Gaps = 11/183 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++   I+ F+K++  DP+ +T +W G +LC     Y+GFFC  P     + V     +
Sbjct  77   LYRAYLVIQKFRKTVICDPKGVTTTWAGTDLC---GSYKGFFCGRPINVSDRTV--ASVD  131

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  596
               +N    SL  FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA A 
Sbjct  132  LNGYNLRSDSLQGFVDGLPDLALFHANSNNFGGA--VPNLRGLQYFYELDLSNNKLAPAP  189

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVF  770
            FPT VL  TN T++D+RFN   G +   +F+   +++A+F+NNN FSG LPDNLG +PV 
Sbjct  190  FPTDVLGLTNCTFIDIRFNSFFGELPAGLFSSFPEVEAIFVNNNRFSGQLPDNLGDSPVN  249

Query  771  FLT  779
            +L+
Sbjct  250  YLS  252



>ref|XP_002885650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 100/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +++  +
Sbjct  71   NPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVC----NYTGVFC--SRALDNRKIRTV  124

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  125  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL   +L +LDLRFN   G V  ++F+ +LDA+F+N+N F   LP+N G +PV
Sbjct  185  KFPTVVLHLPSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPV  242



>dbj|BAJ86489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 107/182 (59%), Gaps = 7/182 (4%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++   I+ FKK+IT DPQ +T++W G ++C +K  Y GFFC  P   + K       +
Sbjct  86   LYRAYLVIQRFKKTITCDPQGVTKTWTGTDIC-SKTCYLGFFCEAPP--NIKERALASVD  142

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA-GAF  599
               F     ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AF
Sbjct  143  FNGFKLEAPTVEGFVDALPDLALYHANSNDFGGVVPI-LRSLQYFYELDVSNNKLAPCAF  201

Query  600  PTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVFF  773
            PT VL  TN T++D+RFN   G V   +F     ++A+F+NNN FSG +P NLG +PV +
Sbjct  202  PTDVLGITNATFVDIRFNRFFGEVPAGLFCSFPIVEAIFVNNNQFSGKIPSNLGDSPVNY  261

Query  774  LT  779
            L 
Sbjct  262  LA  263



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 82/144 (57%), Gaps = 6/144 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  434
            I+ FK++IT DP N+T +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  164  IQAFKRTITSDPLNVTATWVGTKICDSAKGGGAYKGFYCDTPPDDANKTLTVASIDFNGF  223

Query  435  ngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFPTAV  611
            +    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSNN  +GAFP AV
Sbjct  224  HLCAPTLAGFIDAFPDLALFHANSNNFSGDLPDLTSLRY--FYELDLSNNGFSGAFPAAV  281

Query  612  LEATNLTYLDLRFNMLTGPVHPQV  683
                 L +LDLRFN   G V P V
Sbjct  282  PPLGRLAFLDLRFNGFAGEVPPSV  305



>ref|XP_010434500.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X1 [Camelina sativa]
Length=780

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  77   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----SYTGVFC--APALDNRRIRTV  130

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  131  AGIDLNHVDIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  190

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  191  IFPAVVLQLPSLKFLDLRFNEFEGPVPKELFSKDLDAIFINHNRFRFELPDNLGDSPV  248



>ref|XP_010434501.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X2 [Camelina sativa]
Length=768

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  77   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----SYTGVFC--APALDNRRIRTV  130

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  131  AGIDLNHVDIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  190

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  191  IFPAVVLQLPSLKFLDLRFNEFEGPVPKELFSKDLDAIFINHNRFRFELPDNLGDSPV  248



>ref|XP_010094651.1| Uncharacterized protein L484_008883 [Morus notabilis]
 gb|EXB56502.1| Uncharacterized protein L484_008883 [Morus notabilis]
Length=437

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 101/169 (60%), Gaps = 4/169 (2%)
 Frame = +3

Query  273  FKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngngls  452
             K++ITYDP N T +W GN  C+    ++G++C      +   +  I FNG  F G  L+
Sbjct  80   LKRNITYDPFNYTGTWVGNNYCL----FKGYYCDTVPDLNITGLASIDFNGARFGGRFLN  135

Query  453  lnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLT  632
               +  +  D+ + H NSNNF+G     + +   L+ELDLSNN+  GAFP  VL ATNLT
Sbjct  136  FYRYSRNLPDIALFHANSNNFSGVINRNINQLRYLYELDLSNNRFLGAFPFYVLGATNLT  195

Query  633  YLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            ++DLRFN   G V  Q+F +D D LF+NNN F+  +P N G+TP  +LT
Sbjct  196  FVDLRFNRYAGGVPTQLFNIDTDVLFINNNGFANTIPTNFGNTPASYLT  244



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 82/144 (57%), Gaps = 6/144 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  434
            I+ FK++IT DP N+T +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  147  IQAFKRTITSDPLNVTATWVGTKICDSSKGGSAYKGFYCDTPPDDANKTLTVASIDFNGF  206

Query  435  ngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFPTAV  611
            +    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSNN  +G+FP AV
Sbjct  207  HLCAPTLAGFIDAFPDLALFHANSNNFSGVLPELTSLRY--FYELDLSNNAFSGSFPAAV  264

Query  612  LEATNLTYLDLRFNMLTGPVHPQV  683
                 L +LDLRFN   G V P V
Sbjct  265  PPLGRLAFLDLRFNGFAGEVPPSV  288



>ref|XP_006848210.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
 gb|ERN09791.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
Length=258

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R++  A+ T+K++I  DP N+T +WEG ++C     Y+G FC      D   +  +
Sbjct  63   NPRLRRAYIALHTWKEAIFSDPYNVTSNWEGADVC----SYKGVFC--APALDDPSIDVV  116

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL ++H+NSN F G       K   LFELDLSNN+  G
Sbjct  117  AGIDLNHADIAGYLPPEIGLLTDLALLHINSNRFCGIVPKSFNKLELLFELDLSNNRFVG  176

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT V+    L YLDLR+N   GP+  ++F  DLDA+FLNNN F   +P+N+G++P 
Sbjct  177  PFPTVVISIPALKYLDLRYNDFEGPLPSELFDKDLDAIFLNNNRFHFHIPENMGNSPA  234



>ref|XP_003580786.1| PREDICTED: uncharacterized protein At4g06744 [Brachypodium distachyon]
Length=443

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 103/176 (59%), Gaps = 7/176 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCI---NKKKYQGFFCYVPRGGDKKRVggiyfngynf  434
            I+TFK++IT DP  +T +W G ++C    N   Y+GFFC  P             +   F
Sbjct  78   IQTFKRTITSDPLGVTSTWVGTKICDSADNGTAYKGFFCDHPPDSPPGTRTVASIDFNGF  137

Query  435  ngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAV  611
            +    +L  F+++F DL + H NSN+F+G   +P +   P  +ELDLSNN  +G+FP  V
Sbjct  138  HLRAPTLAGFIDAFPDLALFHANSNSFSG--NVPDLTGLPYFYELDLSNNAFSGSFPDTV  195

Query  612  LEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDN-LGSTPVFFL  776
            +   NL +LDLRFN  +G V   VF L ++ALFLNNN FSG +PD+  GST   +L
Sbjct  196  VPLGNLLFLDLRFNGFSGSVPAPVFALSVEALFLNNNGFSGDIPDSAFGSTTAEYL  251



>ref|XP_010439825.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=862

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  78   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----SYTGVFCA--PALDNRRIRTV  131

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  132  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  191

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  192  IFPAVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  249



>gb|AEV41023.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=472

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 124/262 (47%), Gaps = 25/262 (10%)
 Frame = +3

Query  15   LIMRMAPSFSFTPFGAAKCLLVFFSLLPTAIPSEIMPGEEESKETSPPVSLVYNVDCGCY  194
            ++ R APS+     G  K         P   PS    G E +   SP +       CGC 
Sbjct  36   MVSRNAPSWRPDRGGHGK------GSAPAPSPSLDTCGCEPTPAPSPSLDT-----CGC-  83

Query  195  VpppppppcpppLDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELC---INKKKYQGF  365
                P P     L+  ++     I+ FK +IT DP+ +T SW G  LC        Y+GF
Sbjct  84   ---EPTPAPKDFLNEKLQTLYPVIQAFKTTITSDPRGVTASWVGPNLCDSYFGGNMYKGF  140

Query  366  FCYVP----RGGDKKRVggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGI  533
            +C  P       D   +     +   +     SL  F+++F DL + H NSNNF+G   +
Sbjct  141  YCDHPPVKDAPQDDTTLTIASIDFNGYGLGAPSLAGFIDAFPDLALFHANSNNFSGD--V  198

Query  534  P-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalf  710
            P +   P  +ELDLSNN  +G FP  V+    L +LDLRFN   G V P VF L + ALF
Sbjct  199  PDLTGLPYFYELDLSNNNFSGVFPANVVPLGGLLFLDLRFNRFVGTVPPPVFDLSVVALF  258

Query  711  lnnnffSGPLPDNLGSTPVFFL  776
            LNNN F G +PDN GST   +L
Sbjct  259  LNNNGFYGQIPDNFGSTTAEYL  280



>gb|KJB32335.1| hypothetical protein B456_005G236200 [Gossypium raimondii]
Length=413

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 100/173 (58%), Gaps = 8/173 (5%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +IT DP N T +W G ++C     Y GF+C  P   +   +     +   F   
Sbjct  58   IQAFKATITEDPLNRTGNWVGGDIC----NYTGFYCDNPPD-NLSAIALAGIDFNGFLLG  112

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  620
              +L  F++   DL + H NSN F G+  IP V +    +ELD+SNN  AG FP  V+  
Sbjct  113  APTLEGFIDKLPDLAIFHANSNKFAGS--IPDVSQLKYFYELDVSNNVHAGTFPMTVIGV  170

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
             +L+++D+RFN+ +G V P++F   L+ LF+NNN F+  LP+N GSTPV +LT
Sbjct  171  KDLSFVDIRFNLFSGSVPPEIFNQALEVLFINNNDFTAKLPENFGSTPVRYLT  223



>gb|KHN05611.1| Hypothetical protein glysoja_047056 [Glycine soja]
Length=418

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 104/185 (56%), Gaps = 11/185 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK--RVggiy  416
            + ++ +A+  F + +  DP   T +W+G++ C    K++G  C     G +    +    
Sbjct  49   LERARRALEKFTRLVD-DPNGYTSNWKGSDAC----KFRGVRCAKYPDGQQAVAGLDLNG  103

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  596
                      L L+  ++   +L   HVNSNNF+GA    + K+   FELDLSNNKL G 
Sbjct  104  AGLSGKKCTALMLSGLLDRIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEGE  163

Query  597  FPTAVLE----ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
            FP  VL+       L +LDLRFN L+GP+ PQ+F LDLD +F+NNN F+G LPDN GSTP
Sbjct  164  FPKEVLQPKPKDQQLVFLDLRFNRLSGPIPPQLFDLDLDVIFINNNEFTGNLPDNFGSTP  223

Query  765  VFFLT  779
              +LT
Sbjct  224  ARYLT  228



>gb|AEV41070.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=455

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 117/226 (52%), Gaps = 18/226 (8%)
 Frame = +3

Query  126  GEEESKETSPPVSLVYNVD-CGCYVpppppppcpppLDPVIRKSIKAIRTFKKSITYDPQ  302
            GE +    SPP     ++D CGC   P P P     L+  +R     I+ FK+ IT D +
Sbjct  51   GEGKGSAPSPP-----SLDTCGC--GPAPAPAPSEFLNEKLRSLYPVIQAFKQRITSDLR  103

Query  303  NITQSWEGNELC---INKKKYQGFFCYVPRGGDKKR----Vggiyfngynfngnglslns  461
             +T SW G  LC        Y+GF+C  P   D  +    +     +   +     SL  
Sbjct  104  GVTASWVGPNLCDSYFGGNMYKGFYCDHPPVNDAPQDDTTLTIASIDFNGYGLAAPSLAG  163

Query  462  FVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYL  638
            FV++F +L + H NSNNF+G   +P +   P  +ELDLSNN  +GAFP  V+    L +L
Sbjct  164  FVDAFPELALFHANSNNFSGE--VPDLTALPYFYELDLSNNNFSGAFPANVVPLGRLLFL  221

Query  639  DLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            DLRFN   G V P VF L + ALFLNNN F G +PDN GST   +L
Sbjct  222  DLRFNHFVGTVPPPVFDLSVVALFLNNNGFYGRIPDNFGSTTAEYL  267



>ref|XP_006414071.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
 gb|ESQ55524.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
Length=739

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 100/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  80   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYCAP--APDNRRIRTV  133

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  134  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  193

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  +L+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  194  KFPAVILQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  251



>ref|XP_003538630.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=437

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 104/185 (56%), Gaps = 11/185 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK--RVggiy  416
            + ++ +A+  F + +  DP   T +W+G++ C    K++G  C     G +    +    
Sbjct  68   LERARRALEKFTRLVD-DPNGYTSNWKGSDAC----KFRGVRCAKYPDGQQAVAGLDLNG  122

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  596
                      L L+  ++   +L   HVNSNNF+GA    + K+   FELDLSNNKL G 
Sbjct  123  AGLSGKKCTALMLSGLLDRIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEGE  182

Query  597  FPTAVLE----ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
            FP  VL+       L +LDLRFN L+GP+ PQ+F LDLD +F+NNN F+G LPDN GSTP
Sbjct  183  FPKEVLQPKPKDQQLVFLDLRFNRLSGPIPPQLFDLDLDVIFINNNEFTGNLPDNFGSTP  242

Query  765  VFFLT  779
              +LT
Sbjct  243  ARYLT  247



>ref|XP_009135898.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Brassica 
rapa]
Length=909

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +R+  +
Sbjct  67   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----TYTGVFC--SRAPDNRRIRTV  120

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVN+N F G      +    LFELDLSNN+ AG
Sbjct  121  AGIDLNHADIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFKHLKLLFELDLSNNRFAG  180

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LPDN G +PV
Sbjct  181  KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPV  238



>ref|XP_004140710.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57507.1| hypothetical protein Csa_3G200180 [Cucumis sativus]
Length=450

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 104/180 (58%), Gaps = 5/180 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +RK+   IR  K  I     ++ ++W+GN++C    +Y GF C       ++ +  + FN
Sbjct  83   LRKAFFVIRRLKSKIKSGRLDVVRTWQGNDVC----QYVGFRCDPLLVEKERSISAVMFN  138

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            G+ F G  L L  F++  +D+ V H NSN F G     + +    +E+DLSNNKL G FP
Sbjct  139  GFRFGGPELFLEGFMDELDDIAVFHANSNFFRGPIPKKIDRQRFFYEMDLSNNKLPGGFP  198

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQV-ftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            T VL A+ LT+LDLR+N   GP+  Q+     + A+++NNN FS  LPDNLG TP  +LT
Sbjct  199  TNVLGASELTFLDLRYNNYCGPIPEQIFDMDIISAIYINNNQFSSNLPDNLGKTPAKYLT  258



>gb|AEV41116.1| uncharacterized protein At4g06744 precursor [Oryza officinalis]
Length=462

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 117/226 (52%), Gaps = 18/226 (8%)
 Frame = +3

Query  126  GEEESKETSPPVSLVYNVD-CGCYVpppppppcpppLDPVIRKSIKAIRTFKKSITYDPQ  302
            GE +    SPP     ++D CGC   P P P     L+  +R     I+ FK+ IT D +
Sbjct  51   GEGKGSAPSPP-----SLDTCGC--GPAPAPAPSEFLNEKLRSLYPVIQAFKQRITSDLR  103

Query  303  NITQSWEGNELC---INKKKYQGFFCYVPRGGDKKR----Vggiyfngynfngnglslns  461
             +T SW G  LC        Y+GF+C  P   D  +    +     +   +     SL  
Sbjct  104  GVTASWVGPNLCDSYFGGNMYKGFYCDHPPVNDAPQDNTTLTIASIDFNGYGLAAPSLAG  163

Query  462  FVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYL  638
            FV++F +L + H NSNNF+G   +P +   P  +ELDLSNN  +GAFP  V+    L +L
Sbjct  164  FVDAFPELALFHANSNNFSGE--VPDLTALPYFYELDLSNNNFSGAFPANVVPLGRLLFL  221

Query  639  DLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            DLRFN   G V P VF L + ALFLNNN F G +PDN GST   +L
Sbjct  222  DLRFNHFVGTVPPPVFDLSVVALFLNNNGFYGRIPDNFGSTTAEYL  267



>ref|NP_001054210.2| Os04g0670100 [Oryza sativa Japonica Group]
 emb|CAE02822.1| OSJNBa0043A12.27 [Oryza sativa Japonica Group]
 dbj|BAF16124.2| Os04g0670100 [Oryza sativa Japonica Group]
Length=446

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 98/182 (54%), Gaps = 13/182 (7%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  413
            I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  76   IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  135

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  590
              +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  136  SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  193

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  194  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  253

Query  771  FL  776
            +L
Sbjct  254  YL  255



>ref|XP_010449482.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Camelina 
sativa]
Length=825

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  82   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----GYTGVFCA--PALDNRRIRTV  135

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  136  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  195

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  196  IFPAVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  253



>ref|XP_004976154.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=458

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 106/183 (58%), Gaps = 11/183 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++   I+ F++++T DP  IT SW G +LC     Y+GFFC  P     + +     +
Sbjct  87   LYRAYLVIQQFRQTVTCDPMGITPSWSGTDLC---SSYKGFFCERPPNVTDRTI--ASVD  141

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA-  596
               +     SL  F+ S  DL + H NSN+F GA P +   ++   +ELDLSNN+LA A 
Sbjct  142  FNGYMLRSDSLQGFINSLPDLALFHANSNDFGGAVPALGGLQY--FYELDLSNNRLAPAP  199

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVF  770
            FPT VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV 
Sbjct  200  FPTDVLGLTNATFIDIRFNSFYGELPAGVFCRFPRIQAIFVNNNQFSGSLPDNIGQSPVN  259

Query  771  FLT  779
            +L+
Sbjct  260  YLS  262



>ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
 sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; 
Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
Length=494

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 100/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   +  D +++  +
Sbjct  71   NPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVC----NYTGVFC--SKALDNRKIRTV  124

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  125  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL   +L +LDLRFN   G V  ++F+ +LDA+F+N+N F   LP+N G +PV
Sbjct  185  KFPTVVLHLPSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPV  242



>ref|XP_004168435.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=453

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 104/180 (58%), Gaps = 5/180 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +RK+   IR  K  I     ++ ++W+GN++C    +Y GF C       ++ +  + FN
Sbjct  83   LRKAFFVIRRLKSKIKSGRLDVVRTWQGNDVC----QYVGFRCDPLLVEKERSISAVMFN  138

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
            G+ F G  L L  F++  +D+ V H NSN F G     + +    +E+DLSNNKL G FP
Sbjct  139  GFRFGGPELFLEGFMDELDDIAVFHANSNFFRGPIPKKIDRQRFFYEMDLSNNKLPGGFP  198

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQV-ftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            T VL A+ LT+LDLR+N   GP+  Q+     + A+++NNN FS  LPDNLG TP  +LT
Sbjct  199  TNVLGASELTFLDLRYNNYCGPIPEQIFDMDIISAIYINNNQFSSNLPDNLGKTPAKYLT  258



>ref|XP_001767662.1| predicted protein [Physcomitrella patens]
 gb|EDQ67413.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 100/170 (59%), Gaps = 5/170 (3%)
 Frame = +3

Query  261  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  440
            A++ +KK+IT DP+ I ++W G ++C    KY+G FC  P   D + +  +     N   
Sbjct  4    ALKAWKKAITDDPKGILKTWVGKDVC----KYEGVFCSPPEDPDLQYLEVVAGIDLNDAD  59

Query  441  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               +L   +    ++ + H+NSN F+G      +   TLFELDLSNN+L+G+FP  VL+ 
Sbjct  60   LKGTLVPELGLLREIGIFHLNSNRFSGEVPDSFRYMKTLFELDLSNNQLSGSFPLVVLDI  119

Query  621  TNLTYLDLRFNMLTGPVHPQVftl-dldalflnnnffSGPLPDNLGSTPV  767
             NL YLD+RFN   G +  ++F+   LDA+F+NN  F G +PDN G +PV
Sbjct  120  PNLVYLDIRFNEFFGKLPRELFSKPTLDAIFVNNCNFEGDIPDNFGESPV  169



>gb|AIE88270.1| hypothetical protein OG_BBa0063K01.1 [Oryza glaberrima]
Length=484

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 97/182 (53%), Gaps = 13/182 (7%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  413
            I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  114  IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATPPKDNTTLTIA  173

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  590
              +   +     SL  FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  174  SIDFNGYGLGAPSLAGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  231

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  232  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  291

Query  771  FL  776
            +L
Sbjct  292  YL  293



>gb|EAZ32358.1| hypothetical protein OsJ_16568 [Oryza sativa Japonica Group]
Length=480

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 98/182 (54%), Gaps = 13/182 (7%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  413
            I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  110  IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  169

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  590
              +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  170  SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  227

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  228  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  287

Query  771  FL  776
            +L
Sbjct  288  YL  289



>emb|CAJ86091.1| H0818H01.13 [Oryza sativa Indica Group]
Length=480

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 98/182 (54%), Gaps = 13/182 (7%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  413
            I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  110  IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  169

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  590
              +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  170  SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  227

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  228  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  287

Query  771  FL  776
            +L
Sbjct  288  YL  289



>ref|XP_007157716.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
 gb|ESW29710.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
Length=413

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 100/174 (57%), Gaps = 9/174 (5%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK +I  DP  IT +W G  LC     Y GF+C  P   +         +   F   
Sbjct  60   IQAFKNTIISDPLGITATWVGPNLC----NYTGFYCDHPLD-NLTATTIASIDFNGFQLT  114

Query  444  glslnsFVESFNDLVVIHVNSNNFTG--APGIPVQKFPTLFELDLSNNKLAGAFPTAVLE  617
              +L+ F++   DL + H NSN F+G  +P I   KF  L+ELDLSNN  +G FP++V+ 
Sbjct  115  APTLDGFIDQLPDLALFHANSNKFSGTISPKIAGLKF--LYELDLSNNLFSGLFPSSVIN  172

Query  618  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
               L++LD+R+N  TG + PQ+F   LDALFLNNN F   LP+NLG TPV +LT
Sbjct  173  IPTLSFLDIRYNFFTGTLPPQIFMQTLDALFLNNNNFMLTLPNNLGDTPVVYLT  226



>ref|XP_002446758.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
 gb|EES11086.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
Length=455

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 106/181 (59%), Gaps = 11/181 (6%)
 Frame = +3

Query  249  KSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  428
            ++   I+ F+ ++T DP ++T+SW G +LC     Y+GFFC  P     + +     +  
Sbjct  90   RAYLVIQQFRSTVTCDPMDVTRSWSGTDLC---GGYKGFFCERPPNVTDRTI--ASVDFN  144

Query  429  nfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA-FP  602
             +     SL  F+ +  DL + H NSN+F GA P +   ++   +ELDLSNNKLA A FP
Sbjct  145  GYMLRADSLQGFINNLPDLALFHANSNDFGGAVPSLGSLQY--FYELDLSNNKLAPAPFP  202

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVFFL  776
            T VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV +L
Sbjct  203  TDVLGLTNATFIDIRFNSFYGELPAGVFCRFPRVQAIFVNNNQFSGSLPDNIGQSPVNYL  262

Query  777  T  779
            +
Sbjct  263  S  263



>ref|XP_007017156.1| LRR-family protein [Theobroma cacao]
 gb|EOY14381.1| LRR-family protein [Theobroma cacao]
Length=441

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 96/170 (56%), Gaps = 9/170 (5%)
 Frame = +3

Query  276  KKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngngls  452
            K++IT+DPQN T +W GN  C+    ++G+ C  VP   D+   G    +       G  
Sbjct  87   KRNITFDPQNYTGTWVGNNYCL----FKGYICDTVP---DRNITGLAGIDFNGARFGGNL  139

Query  453  l-nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNL  629
                F+ +  D+ + H NSNNF+G     +      +E+DLSNNK  G FP+ VL ATNL
Sbjct  140  NFYRFITNLPDIAIFHANSNNFSGVINQGLNGLRYFYEIDLSNNKFMGGFPSNVLGATNL  199

Query  630  TYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            T++DLRFN   GPV   +F  D D LF+NNN FS  +P N G+TP  +LT
Sbjct  200  TFVDLRFNKYLGPVPRSLFNFDTDVLFINNNVFSRTIPPNFGNTPALYLT  249



>ref|XP_010479447.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=502

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 105/182 (58%), Gaps = 11/182 (6%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +  G    R   + 
Sbjct  135  PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----SYNGLKCAMFPG---TRDLAVA  186

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
               +N    G  L+SF+   + + + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  187  SFQFNGFQLGGKLDSFLGKLDTVSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  244

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FPT VL+ TNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  245  DFPTNVLKGTNLTFLDLRFNTFSGSVPPQVFNLDLDVLFINNNNLVQNLPSNLGSITALY  304

Query  774  LT  779
            LT
Sbjct  305  LT  306



>ref|XP_009132101.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Brassica 
rapa]
Length=749

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D  R+  +
Sbjct  75   NPRLRSAYVALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYC--APAPDNPRIRTV  128

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  129  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  188

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  +L+  +L +LDLRFN   GPV  ++F+ DLDA+F+N+N F   LPDNLG +PV
Sbjct  189  IFPAVILQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPV  246



>ref|XP_010461823.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=490

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 105/182 (58%), Gaps = 10/182 (5%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +    + + +    
Sbjct  122  PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----NYNGLKCAI--FPNSRHLAVAS  174

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  593
                 F   G++L++F+   +   + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  175  VQFNGFQLGGITLDNFLGKLDTFSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  232

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FPT VL+ TNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  233  DFPTNVLKGTNLTFLDLRFNTFSGSVPPQVFNLDLDVLFINNNNLVQNLPSNLGSITALY  292

Query  774  LT  779
            LT
Sbjct  293  LT  294



>ref|XP_007012977.1| Leucine-rich repeat family protein / extensin family protein 
[Theobroma cacao]
 gb|EOY30596.1| Leucine-rich repeat family protein / extensin family protein 
[Theobroma cacao]
Length=412

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 97/176 (55%), Gaps = 5/176 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGG-DKKRVggiyf  419
            +  +  A++ +K +IT DP  I ++W G+++C     Y+G FC  P+G  D      +  
Sbjct  61   LSTAYTALQAWKSAITDDPLGILKTWVGSDVC----SYKGVFCADPQGAMDSASGQFVAG  116

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  599
               N      +L   + +  D+ ++H+NSN F+G      +   +L ELDLSNN  +G F
Sbjct  117  IDLNHANLLGTLVRELSALTDVSILHLNSNRFSGTVPDTFKDLLSLQELDLSNNHFSGPF  176

Query  600  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            PT  L   NL YLDLRFN   GPV   +F   LDA+FLNNN F G LP NLG++P 
Sbjct  177  PTVTLYIPNLVYLDLRFNSFAGPVPEDLFNKRLDAIFLNNNQFEGELPQNLGNSPA  232



>gb|EMT04546.1| hypothetical protein F775_44003 [Aegilops tauschii]
Length=384

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 104/175 (59%), Gaps = 7/175 (4%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK++IT DPQ IT++W G  +C +   Y GFFC  P   +++ +     +   F   
Sbjct  22   IQRFKQTITCDPQGITKTWTGTAIC-SDTSYLGFFCEKPPNVNERAL--ASVDFNGFKLE  78

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG-AFPTAVLEA  620
              ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AFPT VL  
Sbjct  79   APTVEGFVDALPDLALFHANSNDFGGVVPI-LRSLQYFYELDVSNNKLARCAFPTDVLGI  137

Query  621  TNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVFFLT  779
            TN T++D+RFN   G V   +F     ++A+F+NNN FSG +P NLG +PV +L 
Sbjct  138  TNATFVDIRFNQFYGEVPAGLFRSFPIVEAIFVNNNQFSGKIPSNLGDSPVNYLA  192



>ref|XP_004141032.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
 gb|KGN60563.1| hypothetical protein Csa_2G000710 [Cucumis sativus]
Length=409

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 98/178 (55%), Gaps = 8/178 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            L+ V+ ++   ++T+K +I+ DP  +  +W G+++C     YQG FC     G     G 
Sbjct  68   LETVLNRAYTVLQTWKSAISDDPTGMLTTWVGSDVC----SYQGIFCTRLNSGQMSITGI  123

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
             +                +   NDL +IH+NSN F G   +  ++   L ELDLSNN  +
Sbjct  124  DFNGKNLRGTLIKE----LALLNDLTLIHLNSNRFYGIVPVTFRQLVRLQELDLSNNNFS  179

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
            G FP+A L   NL YLDLRFN  TG +   +F + LDA+FLN+N F+G +P NLG++P
Sbjct  180  GGFPSATLYIPNLRYLDLRFNSFTGGIPESLFYMGLDAIFLNDNQFAGEIPQNLGNSP  237



>ref|XP_011093658.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=399

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 96/180 (53%), Gaps = 9/180 (5%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPR---GGDKKRVg  407
            P   ++  A++ +K  IT DP  +T+SW G  +C     Y+G FC   R   G     V 
Sbjct  52   PTASRAYTALQAWKSVITDDPLGVTKSWVGPNVC----SYKGVFCSDSRDFMGNPAGEVV  107

Query  408  giyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKL  587
                  +      L     +    DL + H+NSN F+G+  +  ++  +L ELDLSNN  
Sbjct  108  AAIDLNHANLQGILVKE--LSLLTDLSIFHLNSNRFSGSVPLSFRELSSLTELDLSNNHF  165

Query  588  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            +GAFP  V+   NL YLDLRFN  +GP+   +F   LDA+FLNNN F G LP NLG++P 
Sbjct  166  SGAFPATVVYIPNLVYLDLRFNSFSGPIPDDLFDKKLDAIFLNNNLFDGELPQNLGNSPA  225



>ref|XP_004157952.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=409

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 98/178 (55%), Gaps = 8/178 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            L+ V+ ++   ++T+K +I+ DP  +  +W G+++C     YQG FC     G     G 
Sbjct  68   LETVLNRAYTVLQTWKSAISDDPTGMLTTWVGSDVC----SYQGIFCTRLNSGQMSITGI  123

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
             +                +   NDL +IH+NSN F G   +  ++   L ELDLSNN  +
Sbjct  124  DFNGKNLRGTLIKE----LALLNDLTLIHLNSNRFYGIVPVTFRQLVRLQELDLSNNNFS  179

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
            G FP+A L   NL YLDLRFN  TG +   +F + LDA+FLN+N F+G +P NLG++P
Sbjct  180  GGFPSATLYIPNLRYLDLRFNSFTGGIPESLFYMGLDAIFLNDNQFAGEIPQNLGNSP  237



>tpg|DAA58808.1| TPA: leucine-rich repeat (LRR) family protein, partial [Zea mays]
Length=555

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 101/182 (55%), Gaps = 8/182 (4%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCY-VPRGGDKKRVgg  410
            +P +R +  A++ ++++I  DP N+T SW G ++C     Y G +C   P+  D   V  
Sbjct  72   NPRLRDAYVALQAWRRAILSDPHNVTGSWTGPDVC----AYAGVYCAPSPQDPDLTVVAS  127

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
            +  N  +  G+       +    DL V+H+NSN F G     + K   L ELDLSNN+L 
Sbjct  128  VDLNHADLAGHLPEELGLLA---DLAVLHLNSNRFCGLVPRSLDKLHALHELDLSNNRLV  184

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVF  770
            GAFP  VL   +L YLDLRFN   GPV  ++F   LDA+F+N+N F   +PDN G++P  
Sbjct  185  GAFPDVVLRLPSLRYLDLRFNDFEGPVPSELFDRPLDAIFINSNRFRFQIPDNFGNSPAS  244

Query  771  FL  776
             L
Sbjct  245  VL  246



>ref|NP_001141186.1| leucine-rich repeat (LRR) family protein precursor [Zea mays]
 gb|ACF85658.1| unknown [Zea mays]
 gb|AFW59826.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=431

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 105/187 (56%), Gaps = 13/187 (7%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCIN-------KKKYQGFFCYVPRGGDKKR  401
            +R     I+ FK++IT DP  +T +W G ELC +          Y+GF+C  P   D   
Sbjct  69   LRALYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNNGSTTTYYRGFYCDYPP--DAPG  126

Query  402  Vggiyfngynfngngl-slnsFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLS  575
            V  +    +N  G    SL  F+++F DL + H NSNNF+G  P +   ++   +ELDLS
Sbjct  127  VLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGDVPDLTQLRY--FYELDLS  184

Query  576  NNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLG  755
            NN  +GAFP AV+    L +LDLRFN   G V   VF L ++ALFLNNN F G +PD LG
Sbjct  185  NNNFSGAFPEAVVPLGGLLFLDLRFNRYAGEVPAPVFALTVEALFLNNNGFGGRIPDTLG  244

Query  756  STPVFFL  776
            ST   +L
Sbjct  245  STGAQYL  251



>gb|EMS61305.1| hypothetical protein TRIUR3_11917 [Triticum urartu]
Length=414

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 103/182 (57%), Gaps = 7/182 (4%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            + ++   I+ FK++IT DPQ IT +W G  +C N   Y GFFC  P   + K       +
Sbjct  45   LYRAYLVIQRFKQTITCDPQGITNTWTGTAICSN-TSYLGFFCEAPP--NVKERALASVD  101

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG-AF  599
               F     ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AF
Sbjct  102  FNGFKLEAPTVEGFVDALPDLALFHANSNDFGGVVPI-LRSLQYFYELDVSNNKLARCAF  160

Query  600  PTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnffSGPLPDNLGSTPVFF  773
            P  VL  TN T++D+RFN   G V   +F     ++A+F+NNN FSG +P NLG +PV +
Sbjct  161  PADVLGITNATFVDIRFNQFYGEVPAGLFRSFPIVEAIFVNNNQFSGNIPSNLGDSPVNY  220

Query  774  LT  779
            L 
Sbjct  221  LA  222



>ref|XP_009396708.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 93/173 (54%), Gaps = 8/173 (5%)
 Frame = +3

Query  264  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  443
            I+ FK+SIT DP  +TQ+W G   C     Y+GF+C  P                     
Sbjct  86   IQRFKQSITCDPGGVTQTWVGYRPC----TYEGFYCAAPPDSPDTPTIASVDFNGFGLCA  141

Query  444  glslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  620
               +  FV+   DL + H NSN F+G   IP +   P L+ELD+S+N   GAFPT VL  
Sbjct  142  PTIVG-FVDQLPDLALFHANSNYFSGT--IPDLTGLPYLYELDVSSNLHFGAFPTKVLPL  198

Query  621  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            +NL +LDLRFN   G V   VF  +LD LF NNN F+ PLP  LG +PV +LT
Sbjct  199  SNLIFLDLRFNFFAGAVPASVFAFNLDVLFFNNNNFNEPLPAELGRSPVAYLT  251



>gb|KFK35980.1| hypothetical protein AALP_AA4G062700 [Arabis alpina]
Length=490

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 7/181 (4%)
 Frame = +3

Query  240  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            ++ K+   ++ FK ++  +P+ +  SW+G ++C    KY+G  C +  G ++  V    F
Sbjct  122  LVAKAYPVLQRFK-NLVEEPKGVFDSWKGGDIC---NKYRGLECAILPGKNQTAVVSYQF  177

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA  596
            NG N +G  L L++F++   ++ + H NSNNF G+ P +   K+  L+ELDLSNNKL G 
Sbjct  178  NGLNLSGKNLRLDNFIDKLPEISIFHANSNNFLGSVPKLSHLKY--LYELDLSNNKLTGK  235

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFL  776
            FPT V++A  LT+LDLRFN  +G V P+VF LD+DALF+NNN     +P  LGS    FL
Sbjct  236  FPTTVIDAKQLTFLDLRFNSFSGFVPPRVFNLDVDALFINNNNLVQNIPRTLGSITALFL  295

Query  777  T  779
            T
Sbjct  296  T  296



>gb|ACG42798.1| leucine-rich repeat, plant specific [Zea mays]
Length=431

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 105/187 (56%), Gaps = 13/187 (7%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCIN-------KKKYQGFFCYVPRGGDKKR  401
            +R     I+ FK++IT DP  +T +W G ELC +          Y+GF+C  P   D   
Sbjct  69   LRALYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNNGSTTTYYRGFYCDYPP--DAPG  126

Query  402  Vggiyfngynfngngl-slnsFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLS  575
            V  +    +N  G    SL  F+++F DL + H NSNNF+G  P +   ++   +ELDLS
Sbjct  127  VLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGDVPDLTQLRY--FYELDLS  184

Query  576  NNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLG  755
            NN  +GAFP AV+    L +LDLRFN   G V   VF L ++ALFLNNN F G +PD LG
Sbjct  185  NNNFSGAFPEAVVPLGGLLFLDLRFNRYAGEVPAPVFALTVEALFLNNNGFGGRIPDTLG  244

Query  756  STPVFFL  776
            ST   +L
Sbjct  245  STGAQYL  251



>gb|KCW63737.1| hypothetical protein EUGRSUZ_G01385 [Eucalyptus grandis]
Length=324

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 79/151 (52%), Gaps = 6/151 (4%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  410
            LD  +      I+ FK ++T DP  IT SW G  +C     Y GF+C  P   +      
Sbjct  50   LDQRLAAVYPVIQQFKNTVTADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  104

Query  411  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
               +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  105  AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  164

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  683
            GAFP AV    NL++LD+RFN  TG V PQV
Sbjct  165  GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQV  194



>ref|XP_009795730.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nicotiana 
sylvestris]
Length=408

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 101/177 (57%), Gaps = 10/177 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPR---GGDKKRVggi  413
            I K+  A++T+K +IT DP  I  SW G  +C+    Y+G FC   +   G     V GI
Sbjct  58   INKAYTALQTWKSAITDDPLGILNSWVGTNVCV----YKGIFCSESQDYMGNPTSVVAGI  113

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
              N  N  G  +   SF+    ++ + H+NSN F+G      +   +L ELDLSNN  +G
Sbjct  114  DLNHANLQGILVKELSFLA---EMSIFHLNSNRFSGPIPQNFRDLTSLTELDLSNNHFSG  170

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
             FPTAVL   NL YLDLRFN  +GP+   +F   LDA+FLNNN F G LP NLG++P
Sbjct  171  TFPTAVLLIPNLLYLDLRFNSFSGPIPEDLFNKKLDAIFLNNNQFDGELPQNLGNSP  227



>ref|XP_011078360.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=494

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 95/178 (53%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +KK+I  DP N+T  W G+++C     Y G FC      D   +  +
Sbjct  84   NPRLRSAYVALQAWKKAILSDPHNLTVDWVGSDVC----NYTGVFC--APALDNPSIRTV  137

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G      +    LFELDLSNN+ AG
Sbjct  138  AGIDLNHGDIAGYLPEELGLLTDLGLFHINSNRFCGTVPKKFKNLKILFELDLSNNRFAG  197

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL    L YLDLRFN   GPV  ++F   LDA+F+N+N F+  LPDN G++PV
Sbjct  198  KFPYVVLRLPKLKYLDLRFNEFEGPVPSELFDKPLDAIFINHNRFAFELPDNFGNSPV  255



>ref|XP_002516600.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45941.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=516

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 101/178 (57%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P ++ +  A++++K+++  DP N+T +W G ++C     Y G FC+     D   +  +
Sbjct  77   NPRLKTAYIALQSWKQAMISDPNNLTANWVGCDVC----SYTGIFCWT--APDNSSIQTV  130

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    D+ + H+NSN F G     ++    L+ELDLSNN+ AG
Sbjct  131  AAIDLNHGDIAGHLVEELGLLTDIALFHINSNRFCGRVPKSLKNLNFLYELDLSNNRFAG  190

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+  +L YLDLRFN   G V  ++F  DLDA+F+N+N FS  LPDN+G++PV
Sbjct  191  RFPNVVLDLPDLKYLDLRFNEFEGNVPRELFDKDLDAIFINDNRFSFKLPDNIGNSPV  248



>gb|EYU27248.1| hypothetical protein MIMGU_mgv1a007527mg [Erythranthe guttata]
Length=404

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (56%), Gaps = 9/178 (5%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPR---GGDKKRVggi  413
            + ++  A++ +K +IT DP  +T+SW G  +C     Y+G FC   R   G    +V   
Sbjct  56   MNRAYNALQAWKSAITDDPLGVTKSWVGPNVC----SYRGIFCSDSRDFIGNPAGKVVSA  111

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                +      L     +    DL ++H+NSN F+G     +++  +L ELDLSNN+ +G
Sbjct  112  VDLNHANLQGTLVGE--LSFLTDLSILHLNSNRFSGGVPSSIRELTSLTELDLSNNRFSG  169

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP AVL   NL YLD+R+N  +G +   +F   LDA+FLNNN FSG LP N+G++P 
Sbjct  170  PFPAAVLYIPNLVYLDIRYNSFSGQIPEDLFNRKLDAIFLNNNEFSGELPQNIGNSPA  227



>ref|XP_010228296.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brachypodium 
distachyon]
Length=370

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P ++++  A++  K +IT DP+N+T +W G ++C     Y G FC         R    
Sbjct  39   NPRLQRAYSALQALKHAITDDPRNLTSNWCGPDVC----AYYGVFCAAALDDPCSRAVAG  94

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                +            +    D+ V+H+NSN F G     + K   L ELD+SNN+L+G
Sbjct  95   LDLNHGDIAGTFPDELGL--LTDIAVLHLNSNRFAGTLPETLPKLSLLHELDVSNNRLSG  152

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  +L   N+ Y+D+RFN L GPV P +F  ++DALF+NNN F   LP+NLG++P 
Sbjct  153  GFPQHILCLPNVKYVDIRFNNLCGPVPPAIFDKNIDALFINNNHFEFELPENLGNSPA  210



>gb|KDP43798.1| hypothetical protein JCGZ_23006 [Jatropha curcas]
Length=834

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 117/249 (47%), Gaps = 10/249 (4%)
 Frame = +3

Query  27   MAPSFSFTPFGAAKCLLVFFSLLPTAIPSEIMPGEEESKETSPPVSLVYNVDC-GCYVpp  203
            M       PF     L+ FF+     + +      ++S+    P+     VD    YV  
Sbjct  1    MKRKIDILPFFTTVTLICFFTTQYLFLSTNAATYNKQSRRK--PLHFKDKVDSINDYVTL  58

Query  204  pppppcpppLD-PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVP  380
                      D P I  +  A++ +K+SI  DP+N+T +W G ++C     Y G FC+  
Sbjct  59   SSKSSASLEFDNPRIDSAYIALQKWKRSIISDPKNLTANWVGFDVC----NYTGIFCWA-  113

Query  381  RGGDKKRVggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLF  560
               D   +  +     N      +L   +    D+ ++H+NSN F G      +K   L 
Sbjct  114  -APDDSSIQTVAGIDLNDGDIAGNLVHELGYLTDIALLHLNSNRFCGKIPRSFKKLKLLH  172

Query  561  ELDLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPL  740
            ELDLSNN+ AG FP  VLE   L YLDLRFN   G V  ++F  +LDA+ LN+N F+  L
Sbjct  173  ELDLSNNRFAGRFPNVVLEMPELKYLDLRFNEFEGNVPRELFDKNLDAILLNHNRFAFEL  232

Query  741  PDNLGSTPV  767
            PDN G++P 
Sbjct  233  PDNFGNSPA  241



>gb|KHN30415.1| Hypothetical protein glysoja_033153 [Glycine soja]
Length=384

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 102/186 (55%), Gaps = 12/186 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKK--RVggi  413
            + ++ KA+  F + +  DP   T +W EG + C    +++G  C     G +    +   
Sbjct  13   LERARKALIKFTRLVD-DPNGYTSNWKEGRDTC----EFRGVRCAKYPDGQQAVAGLDLN  67

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                       L L   ++S  +L   HVNSNNF+GA    + K+   FELDLSNNKL G
Sbjct  68   GAGLSGKKCTALMLTGILDSIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEG  127

Query  594  AFPTAVLE----ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGST  761
             FP  VL+       L +LDLRFN L GP+ PQ+F LDLD +F+NNN FSG LPDN GST
Sbjct  128  EFPKEVLQPKPKDQQLVFLDLRFNSLCGPIPPQLFDLDLDVIFINNNKFSGHLPDNFGST  187

Query  762  PVFFLT  779
            P  +LT
Sbjct  188  PARYLT  193



>ref|XP_004503826.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=393

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 97/177 (55%), Gaps = 6/177 (3%)
 Frame = +3

Query  237  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            P    +  A++ +K +IT DP NI  +W G  +C     Y+G FC  P+  D+     + 
Sbjct  49   PNQNNAYSALQGWKSAITDDPLNILDTWVGPNVC----SYKGIFCENPQ--DENSTPFVA  102

Query  417  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  596
                N      +L   +   +D+ + H+NSN F+G      + F  L ELDLSNN+L+G 
Sbjct  103  GIDLNHANLKGTLVKELSLLSDITLFHLNSNRFSGTVPESFKDFTLLQELDLSNNQLSGT  162

Query  597  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
            FPT  L   NL YLDLRFN   G +  Q+F  +LDA+FLNNN FSG +P N G++P 
Sbjct  163  FPTVTLNMPNLIYLDLRFNYFKGSLPEQLFDKNLDAIFLNNNLFSGEIPQNFGNSPA  219



>gb|KJB06895.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=499

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +KK+I  DP N+T  W G+E+C     Y G +C      D KR+  +
Sbjct  80   NPRLRNAYIALQAWKKAILSDPFNLTADWVGSEVC----DYTGVYC--APALDNKRIKTV  133

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G       K   +FELDLSNN+ AG
Sbjct  134  AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFIKLKLMFELDLSNNRFAG  193

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  +L+   L +LDLRFN   G V  ++F  DLDA+F+N+N F   LPDN G++PV
Sbjct  194  KFPEVILKLPLLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFNLPDNFGNSPV  251



>ref|XP_002447298.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
 gb|EES11626.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
Length=449

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 105/188 (56%), Gaps = 10/188 (5%)
 Frame = +3

Query  231  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCIN----KKKYQGFFCYVPRGGDKK  398
            L+  +R     I+ FK++IT DP  +T +W G ELC +       Y+GF+C  P   D  
Sbjct  73   LNEKLRSLYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNGTTYYKGFYCDYPP--DAP  130

Query  399  RVggiyfngynfngngl-slnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDL  572
             V  +    +N  G    SL  F+++F DL + H NSNNF+G   +P +      +ELDL
Sbjct  131  GVLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTHLQYFYELDL  188

Query  573  SNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNL  752
            SNN  +GAFP +V+    L +LDLRFN   G V   VF L ++ALFLNNN F G +PD  
Sbjct  189  SNNNFSGAFPDSVVPLGGLLFLDLRFNRYAGTVPAPVFALTVEALFLNNNGFGGRIPDTF  248

Query  753  GSTPVFFL  776
            GST   +L
Sbjct  249  GSTGAQYL  256



>gb|EPS61338.1| hypothetical protein M569_13456, partial [Genlisea aurea]
Length=387

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 95/175 (54%), Gaps = 6/175 (3%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            +R +  A++ +K++I  DP N+T  W G+++C     Y G FC   +  D   V  +   
Sbjct  34   LRSAYIALQAWKEAILSDPYNLTADWVGSDVC----GYTGVFC--AQAIDDPEVRTVAGI  87

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
              N       L   +    DL + H+NSN F G      +   TLFELDLSNN+ AG FP
Sbjct  88   DLNHGDIAGYLPEELGLLVDLGLFHINSNRFCGKIPTKFRNLKTLFELDLSNNRFAGKFP  147

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
              VL    L YLD+R+N   G V P++F   LDA+F+NNN F+  LPDN G++PV
Sbjct  148  RVVLSLPKLVYLDIRYNEFEGTVPPELFDKPLDAIFINNNRFAFELPDNFGNSPV  202



>ref|XP_008459038.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Cucumis 
melo]
Length=416

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 98/177 (55%), Gaps = 8/177 (5%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            + V+ ++   ++T+K +I+ DP  +  +W G+++C     Y+G FC     G     G  
Sbjct  69   ETVLNRAYSVLQTWKSAISDDPTGMLTTWVGSDVC----SYKGIFCTRLNSGQISITGID  124

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
            +                +   NDL +IH+NSN F+G   I  ++   L ELDLSNN  +G
Sbjct  125  FNGKNLRGTLIKE----LALLNDLTLIHLNSNRFSGIVPITFRQLVRLQELDLSNNNFSG  180

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
             FP+A L   NL YLDLRFN  TG +   +F + LDA+FLNNN F+G +P NLG++P
Sbjct  181  EFPSATLYIPNLRYLDLRFNSFTGAIPESLFYMGLDAIFLNNNQFAGEIPQNLGNSP  237



>ref|XP_009602497.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Nicotiana 
tomentosiformis]
Length=408

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 93/174 (53%), Gaps = 4/174 (2%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  422
            I K+  A++T+K +IT DP  I  SW G  +C     Y+G FC   +         +   
Sbjct  58   INKAYTALQTWKSAITDDPLGILNSWVGTNVC----AYKGVFCSESQDYMGNPTLVVAGI  113

Query  423  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  602
              N       L   +    ++ + H+NSN F+G      +   +L ELDLSNN  +G FP
Sbjct  114  DLNHANLQGILVKELSFLAEMSIFHLNSNRFSGPIPQTFRDLTSLTELDLSNNHFSGTFP  173

Query  603  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTP  764
            TAVL   NL YLDLRFN  +GP+   +F   LDA+FLNNN F G LP NLG++P
Sbjct  174  TAVLLIPNLLYLDLRFNSFSGPIPEDLFNKKLDAIFLNNNQFDGELPQNLGNSP  227



>ref|XP_003516778.2| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=463

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 102/186 (55%), Gaps = 12/186 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKK--RVggi  413
            + ++ KA+  F + +  DP   T +W EG + C    +++G  C     G +    +   
Sbjct  92   LERARKALIKFTRLVD-DPNGYTSNWKEGRDTC----EFRGVRCAKYPDGQQAVAGLDLN  146

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                       L L   ++S  +L   HVNSNNF+GA    + K+   FELDLSNNKL G
Sbjct  147  GAGLSGKKCTALMLTGILDSIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEG  206

Query  594  AFPTAVLE----ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGST  761
             FP  VL+       L +LDLRFN L GP+ PQ+F LDLD +F+NNN FSG LPDN GST
Sbjct  207  EFPKEVLQPKPKDQQLVFLDLRFNSLCGPIPPQLFDLDLDVIFINNNKFSGHLPDNFGST  266

Query  762  PVFFLT  779
            P  +LT
Sbjct  267  PARYLT  272



>gb|EYU25784.1| hypothetical protein MIMGU_mgv1a026389mg, partial [Erythranthe 
guttata]
Length=390

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 97/181 (54%), Gaps = 6/181 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R++  A++ +K+SI  DP N T  W G+++C     Y G FC         +V   
Sbjct  45   NPNLRQAYIALQAWKQSIFSDPFNFTSDWTGSDVC----SYGGVFCAPATTNPSVKVVAG  100

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                +      L     +    DL + H+NSN F G      +K   LFELDLSNN+  G
Sbjct  101  IDLNHADIAGFLPEELGL--LTDLALFHINSNRFCGIVPRSFKKLKLLFELDLSNNRFVG  158

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFF  773
             FPT VL   +L +LDLRFN   G V  QVF  DLDA+FLN+N F   +P+NLG++PV  
Sbjct  159  GFPTVVLSLPSLKFLDLRFNEFEGGVPSQVFDKDLDAIFLNDNRFQFGIPENLGNSPVSV  218

Query  774  L  776
            L
Sbjct  219  L  219



>ref|XP_007227690.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
 gb|EMJ28889.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
Length=413

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K+++  DP   T +W G+ +C     Y G FC   R  D   V  +
Sbjct  40   NPRLRSAYVALQAWKQAMLSDPLGQTSNWVGSNVC----SYTGVFC--SRALDDPSVETV  93

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N  G    L   +   +D+ + H+NSN F G+      K   LFELDLSNN+ AG
Sbjct  94   AGIDLNHGGIAGYLPEELGLLSDIALFHINSNRFCGSVPKSFSKLKLLFELDLSNNRFAG  153

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL    L +LDLRFN   G V  ++F  DLDA+F+N+N FS  LPDNLG++PV
Sbjct  154  KFPLVVLRLPKLKFLDLRFNEFEGKVPKELFDKDLDAIFINHNMFSFELPDNLGNSPV  211



>ref|XP_002308630.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
 gb|EEE92153.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
Length=487

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K +I  DP N+T +W G+++C     Y G FC      D   +  +
Sbjct  10   NPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVC----NYTGVFCATSL--DNSSIQTV  63

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L + +    D+ + HVNSN F G      +K   L+ELDLSNN+ AG
Sbjct  64   AGIDLNHGDMAGHLVAELGLLTDIALFHVNSNRFCGKVPKSFKKLKLLYELDLSNNRFAG  123

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+   L YLDLRFN   G +  ++F  DLDA+F+N+N F+  LPDN G++PV
Sbjct  124  RFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFINHNRFALELPDNFGNSPV  181



>gb|KJB06894.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=568

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +KK+I  DP N+T  W G+E+C     Y G +C      D KR+  +
Sbjct  80   NPRLRNAYIALQAWKKAILSDPFNLTADWVGSEVC----DYTGVYC--APALDNKRIKTV  133

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G       K   +FELDLSNN+ AG
Sbjct  134  AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFIKLKLMFELDLSNNRFAG  193

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  +L+   L +LDLRFN   G V  ++F  DLDA+F+N+N F   LPDN G++PV
Sbjct  194  KFPEVILKLPLLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFNLPDNFGNSPV  251



>ref|XP_011019702.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X4 [Populus euphratica]
Length=469

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K +I  DP N+T +W G+++C     Y G FC      D   +  +
Sbjct  72   NPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVC----SYTGVFCATSL--DNSSIQTV  125

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    D+ + HVNSN F G      +K   L+ELDLSNN+ AG
Sbjct  126  AGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCGKVPRSFKKLKLLYELDLSNNRFAG  185

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+   L YLDLRFN   G +  ++F  DLDA+F+N+N F+  LPDN G++PV
Sbjct  186  RFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFMNHNRFALELPDNFGNSPV  243



>gb|ADN33724.1| LRR-family protein [Cucumis melo subsp. melo]
Length=439

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 100/169 (59%), Gaps = 5/169 (3%)
 Frame = +3

Query  276  KKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  455
            K++ITYDP+  T++W GN  C+    ++GFFC V    +   +  I F+G  F G  L+ 
Sbjct  75   KRNITYDPKGYTKTWVGNNYCL----FKGFFCDVVPDLNITGLSSIDFSGARFGGPFLNF  130

Query  456  nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  635
              F+ +  D+ + H NSNNFTG     + K   L+ELDLSNNK  G FP  +L A  L++
Sbjct  131  YRFIRNLPDIALFHANSNNFTGVINRNINKLRYLYELDLSNNKFLGGFPGYILGANKLSF  190

Query  636  LDLRFNMLTGPVHPQVftldldalflnnnffSGPLPD-NLGSTPVFFLT  779
            +D RFN   G V  ++F +D D LF+NNN F+G +P    G+TP  ++T
Sbjct  191  VDFRFNTYNGSVPYRLFNIDTDVLFINNNGFTGRIPQATFGNTPALYIT  239



>gb|KJB06897.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=591

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +KK+I  DP N+T  W G+E+C     Y G +C      D KR+  +
Sbjct  80   NPRLRNAYIALQAWKKAILSDPFNLTADWVGSEVC----DYTGVYC--APALDNKRIKTV  133

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G       K   +FELDLSNN+ AG
Sbjct  134  AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFIKLKLMFELDLSNNRFAG  193

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  +L+   L +LDLRFN   G V  ++F  DLDA+F+N+N F   LPDN G++PV
Sbjct  194  KFPEVILKLPLLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFNLPDNFGNSPV  251



>ref|XP_003529407.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=449

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 102/186 (55%), Gaps = 13/186 (7%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            + K+ + +  FK +I  DP   TQ+W +  + C    K+ G  C      D++R      
Sbjct  79   LEKAKRVLLKFKTTID-DPNCYTQNWSQDTDAC----KFNGVRC-ANFPDDQQRAVAGLD  132

Query  420  ngynfngngls----lnsFVESFNDLVVIHVNSNNFTGAPGIP--VQKFPTLFELDLSNN  581
                           L   ++S  +L   HVNSNNF+   G P  + +F   FELDLSNN
Sbjct  133  LNGAKLATKNGGNLPLTGLLDSIPELTFFHVNSNNFSFVGGFPNNITRFRFFFELDLSNN  192

Query  582  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGST  761
            K++G FPT  ++   L +LDLRFN LTGP+ P++F  DLD +F+NNN F+G LP+N GST
Sbjct  193  KVSGKFPTQAIQNNQLVFLDLRFNQLTGPIDPKLFERDLDVIFVNNNKFTGYLPENFGST  252

Query  762  PVFFLT  779
            P  +LT
Sbjct  253  PARYLT  258



>emb|CDP03355.1| unnamed protein product [Coffea canephora]
Length=782

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T  W G+++C    KY G FC      D  ++  +
Sbjct  75   NPRLRNAYIALQAWKEAILSDPSNFTGDWVGSDVC----KYTGVFCA--PAPDNPKIRTV  128

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L + +    DL + H+NSN F G      +    LFELDLSNN+ AG
Sbjct  129  AGIDLNHADIAGYLPAELGLLTDLGLFHINSNRFCGTIPGTFKHLEILFELDLSNNRFAG  188

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL    L +LD+RFN   G V PQ+F   LDA+F+N+N F+  LPDN G++PV
Sbjct  189  KFPYVVLSLPKLIFLDIRFNEFEGTVPPQLFDKPLDAIFINHNRFAFELPDNFGNSPV  246



>ref|XP_010532845.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Tarenaya 
hassleriana]
Length=648

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T SW G+ +C     Y G FC      D  R+  +
Sbjct  83   NPRLRSAYIALQAWKQAILSDPFNFTASWVGSNVC----NYTGVFCSP--APDNHRIRTV  136

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G      ++   LFELDLSNN+ AG
Sbjct  137  AGIDLNHADIAGYLPEELGLLTDLALFHINSNRFCGTVPHRFRQLKLLFELDLSNNRFAG  196

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT VL   +L +LDLRFN   G V  ++F  DLDA+F+N+N F   LP+N G++PV
Sbjct  197  KFPTVVLHLPSLKFLDLRFNEFEGSVPKELFNKDLDAIFINHNRFQFELPENFGNSPV  254



>gb|KHN43047.1| Hypothetical protein glysoja_007577 [Glycine soja]
Length=456

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 102/186 (55%), Gaps = 13/186 (7%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  419
            + K+ + +  FK +I  DP   TQ+W +  + C    K+ G  C      D++R      
Sbjct  79   LEKAKRVLLKFKTTID-DPNCYTQNWSQDTDAC----KFNGVRC-ANFPDDQQRAVAGLD  132

Query  420  ngynfngngls----lnsFVESFNDLVVIHVNSNNFTGAPGIP--VQKFPTLFELDLSNN  581
                           L   ++S  +L   HVNSNNF+   G P  + +F   FELDLSNN
Sbjct  133  LNGAKLATKNGGNLPLTGLLDSIPELTFFHVNSNNFSFVGGFPNNITRFRFFFELDLSNN  192

Query  582  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGST  761
            K++G FPT  ++   L +LDLRFN LTGP+ P++F  DLD +F+NNN F+G LP+N GST
Sbjct  193  KVSGKFPTQAIQNNQLVFLDLRFNQLTGPIDPKLFERDLDVIFVNNNKFTGYLPENFGST  252

Query  762  PVFFLT  779
            P  +LT
Sbjct  253  PARYLT  258



>ref|XP_011019700.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
 ref|XP_011019701.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Populus euphratica]
Length=482

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K +I  DP N+T +W G+++C     Y G FC      D   +  +
Sbjct  72   NPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVC----SYTGVFCATSL--DNSSIQTV  125

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    D+ + HVNSN F G      +K   L+ELDLSNN+ AG
Sbjct  126  AGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCGKVPRSFKKLKLLYELDLSNNRFAG  185

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+   L YLDLRFN   G +  ++F  DLDA+F+N+N F+  LPDN G++PV
Sbjct  186  RFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFMNHNRFALELPDNFGNSPV  243



>gb|KJB77660.1| hypothetical protein B456_012G149500 [Gossypium raimondii]
Length=449

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 98/185 (53%), Gaps = 11/185 (6%)
 Frame = +3

Query  243  IRKSIKAIRTFKKSITYDP--QNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  416
            + K+   I+ FK+ I  D   +   ++W G ++C    KY+G +C +     +K V G+ 
Sbjct  77   LAKAYDVIQRFKEKIKVDANSEKYLKTWCGTDVC----KYRGIYCDIRPDVKEKAVAGVD  132

Query  417  fngynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  590
            FNG  F G   +L  + F +  +DL + H NSNNFTG       K   L+ELDLSNNK+A
Sbjct  133  FNGAKFAGCDGTLPLDGFFDELDDLAIFHANSNNFTGTVPFKASKIKYLYELDLSNNKIA  192

Query  591  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGP--LPDNLGSTP  764
            G FP   L   NLT+LDLR+N L G V PQ        +F  NN    P  LP NLG T 
Sbjct  193  GGFPMKTLSTMNLTFLDLRYNSLKGTV-PQQAFDLTLDVFFINNNNFAPQMLPTNLGDTT  251

Query  765  VFFLT  779
              +LT
Sbjct  252  AVYLT  256



>gb|KFK28537.1| hypothetical protein AALP_AA7G009800 [Arabis alpina]
Length=738

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 98/178 (55%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G +C      D  R+  +
Sbjct  56   NPRLRNAYIALQAWKQAILSDPNNFTTNWFGSNVC----SYTGVYC--SPALDNNRIRTV  109

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  110  AGIDLNHADIAGYLPRDLGLLTDLALFHVNSNRFCGTVPNRFSRLKLLFELDLSNNRFAG  169

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FPT +L+  +L +LDLRFN   G V  ++F+ DLDA+FLN+N F   +PDNLG +PV
Sbjct  170  IFPTVILDLPSLKFLDLRFNEFEGSVPRELFSKDLDAIFLNHNRFRFEIPDNLGDSPV  227



>ref|XP_011019699.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Populus euphratica]
Length=492

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +K +I  DP N+T +W G+++C     Y G FC      D   +  +
Sbjct  72   NPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVC----SYTGVFCATSL--DNSSIQTV  125

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    D+ + HVNSN F G      +K   L+ELDLSNN+ AG
Sbjct  126  AGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCGKVPRSFKKLKLLYELDLSNNRFAG  185

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  VL+   L YLDLRFN   G +  ++F  DLDA+F+N+N F+  LPDN G++PV
Sbjct  186  RFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFMNHNRFALELPDNFGNSPV  243



>gb|KJB14611.1| hypothetical protein B456_002G133900 [Gossypium raimondii]
Length=441

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 98/180 (54%), Gaps = 8/180 (4%)
 Frame = +3

Query  246  RKSIKAI-RTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyf  419
            R  I AI +  K++IT+DPQN T +W GN  C+    ++GF C  VP             
Sbjct  76   RARILAITQELKRNITFDPQNYTPTWVGNNYCL----FKGFICDTVPDLNITG--LAGID  129

Query  420  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  599
                  G  L+   F+++  D+ + H NSNNF+G     +      +E+DLSNNK  G F
Sbjct  130  FNGARFGGNLNFYRFIQNLPDIAIFHANSNNFSGVINQGLGGLRYFYEIDLSNNKFIGGF  189

Query  600  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPVFFLT  779
            P+ VL A NLT++DLRFN   G +   +F  D D LF+NNN F   +P NLG+TP  +LT
Sbjct  190  PSNVLSAKNLTFVDLRFNNYLGTIPRSLFNFDTDVLFINNNVFGQGIPRNLGNTPALYLT  249



>gb|KJB06896.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=690

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 97/178 (54%), Gaps = 6/178 (3%)
 Frame = +3

Query  234  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  413
            +P +R +  A++ +KK+I  DP N+T  W G+E+C     Y G +C      D KR+  +
Sbjct  80   NPRLRNAYIALQAWKKAILSDPFNLTADWVGSEVC----DYTGVYC--APALDNKRIKTV  133

Query  414  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  593
                 N       L   +    DL + H+NSN F G       K   +FELDLSNN+ AG
Sbjct  134  AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFIKLKLMFELDLSNNRFAG  193

Query  594  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLPDNLGSTPV  767
             FP  +L+   L +LDLRFN   G V  ++F  DLDA+F+N+N F   LPDN G++PV
Sbjct  194  KFPEVILKLPLLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFNLPDNFGNSPV  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940