BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF042E19

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603333.1|  PREDICTED: uncharacterized serine-rich prote...    175   2e-47   Nicotiana tomentosiformis
ref|XP_002274030.1|  PREDICTED: mucin-17                                175   5e-47   Vitis vinifera
ref|XP_009603328.1|  PREDICTED: uncharacterized serine-rich prote...    174   5e-47   Nicotiana tomentosiformis
ref|XP_009603323.1|  PREDICTED: mucin-5B-like isoform X1                175   5e-47   Nicotiana tomentosiformis
ref|XP_010262830.1|  PREDICTED: nascent polypeptide-associated co...    168   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010256565.1|  PREDICTED: mucin-5AC-like                          166   6e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004239930.1|  PREDICTED: uncharacterized protein DDB_G0274915    166   1e-43   Solanum lycopersicum
ref|XP_006355666.1|  PREDICTED: mucin-5AC-like                          165   2e-43   Solanum tuberosum [potatoes]
ref|XP_009791262.1|  PREDICTED: mucin-5AC-like isoform X1               164   6e-43   Nicotiana sylvestris
ref|XP_009605096.1|  PREDICTED: mucin-5AC-like isoform X1               163   1e-42   Nicotiana tomentosiformis
ref|XP_002315162.1|  hypothetical protein POPTR_0010s19760g             162   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011035974.1|  PREDICTED: mucin-5AC-like                          162   3e-42   Populus euphratica
ref|XP_009776738.1|  PREDICTED: mucin-5AC-like                          160   7e-42   Nicotiana sylvestris
ref|XP_011076682.1|  PREDICTED: cell wall protein RBR3 isoform X1       160   7e-42   Sesamum indicum [beniseed]
ref|XP_011076684.1|  PREDICTED: cell wall protein RBR3 isoform X2       160   8e-42   Sesamum indicum [beniseed]
ref|XP_003552436.1|  PREDICTED: flocculation protein FLO11-like         159   2e-41   Glycine max [soybeans]
ref|XP_010262831.1|  PREDICTED: nascent polypeptide-associated co...    157   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008369241.1|  PREDICTED: flocculation protein FLO11-like         157   1e-40   Malus domestica [apple tree]
ref|XP_002312151.1|  hypothetical protein POPTR_0008s06680g             156   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007218953.1|  hypothetical protein PRUPE_ppa003504mg             156   2e-40   Prunus persica
ref|XP_008233740.1|  PREDICTED: flocculation protein FLO11              156   3e-40   Prunus mume [ume]
ref|XP_009369152.1|  PREDICTED: proteoglycan 4-like                     155   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_010095095.1|  hypothetical protein L484_026404                   155   6e-40   Morus notabilis
ref|XP_009600813.1|  PREDICTED: putative GPI-anchored protein PB1...    155   7e-40   
ref|XP_010262832.1|  PREDICTED: nascent polypeptide-associated co...    154   9e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008441454.1|  PREDICTED: probable serine/threonine-protein...    154   1e-39   Cucumis melo [Oriental melon]
ref|XP_009605097.1|  PREDICTED: mucin-5AC-like isoform X2               154   1e-39   Nicotiana tomentosiformis
ref|XP_008373857.1|  PREDICTED: LOW QUALITY PROTEIN: flocculation...    154   1e-39   
ref|XP_009344718.1|  PREDICTED: serine/arginine repetitive matrix...    154   1e-39   Pyrus x bretschneideri [bai li]
emb|CDP14035.1|  unnamed protein product                                154   1e-39   Coffea canephora [robusta coffee]
ref|XP_004307632.1|  PREDICTED: flocculation protein FLO11 isofor...    153   3e-39   Fragaria vesca subsp. vesca
gb|KGN45784.1|  hypothetical protein Csa_6G011590                       153   3e-39   Cucumis sativus [cucumbers]
ref|XP_004138425.1|  PREDICTED: uncharacterized protein LOC101204600    153   3e-39   
ref|XP_011469903.1|  PREDICTED: flocculation protein FLO11 isofor...    153   3e-39   Fragaria vesca subsp. vesca
ref|XP_004500676.1|  PREDICTED: flocculation protein FLO11-like         153   3e-39   Cicer arietinum [garbanzo]
ref|XP_009782013.1|  PREDICTED: cell wall protein RBR3-like             152   5e-39   Nicotiana sylvestris
ref|XP_009791269.1|  PREDICTED: mucin-5AC-like isoform X2               152   7e-39   Nicotiana sylvestris
gb|KDO69020.1|  hypothetical protein CISIN_1g040479mg                   144   9e-39   Citrus sinensis [apfelsine]
ref|XP_010923060.1|  PREDICTED: endochitinase A-like                    152   9e-39   Elaeis guineensis
ref|XP_003538456.1|  PREDICTED: flocculation protein FLO11-like         152   1e-38   Glycine max [soybeans]
ref|XP_007009023.1|  Uncharacterized protein TCM_042539                 152   1e-38   
gb|KHN34732.1|  hypothetical protein glysoja_039028                     152   1e-38   Glycine soja [wild soybean]
ref|NP_181536.3|  uncharacterized protein                               152   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|EYU20023.1|  hypothetical protein MIMGU_mgv1a003450mg                151   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_010067518.1|  PREDICTED: serine/arginine repetitive matrix...    151   2e-38   Eucalyptus grandis [rose gum]
ref|XP_011016321.1|  PREDICTED: zonadhesin-like isoform X2              150   3e-38   Populus euphratica
ref|XP_008362728.1|  PREDICTED: flocculation protein FLO11-like i...    150   4e-38   
ref|XP_009344713.1|  PREDICTED: mucin-5AC-like isoform X1               150   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_009143258.1|  PREDICTED: endochitinase A-like                    149   6e-38   Brassica rapa
ref|XP_007163529.1|  hypothetical protein PHAVU_001G241800g             149   7e-38   Phaseolus vulgaris [French bean]
gb|KEH34783.1|  ATP-binding protein, putative                           149   2e-37   Medicago truncatula
ref|XP_006411252.1|  hypothetical protein EUTSA_v10016404mg             148   3e-37   Eutrema salsugineum [saltwater cress]
emb|CDY20509.1|  BnaC04g05350D                                          148   3e-37   Brassica napus [oilseed rape]
ref|XP_010517399.1|  PREDICTED: flocculation protein FLO11-like         148   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010508921.1|  PREDICTED: flocculation protein FLO11-like i...    147   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008785362.1|  PREDICTED: nascent polypeptide-associated co...    147   4e-37   Phoenix dactylifera
ref|XP_008795443.1|  PREDICTED: nascent polypeptide-associated co...    147   5e-37   Phoenix dactylifera
ref|XP_010910088.1|  PREDICTED: endochitinase A-like                    146   6e-37   Elaeis guineensis
ref|XP_011016320.1|  PREDICTED: serine/arginine repetitive matrix...    145   2e-36   Populus euphratica
ref|XP_006435712.1|  hypothetical protein CICLE_v10030993mg             145   2e-36   Citrus clementina [clementine]
ref|XP_010535052.1|  PREDICTED: mucin-17                                145   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_006435713.1|  hypothetical protein CICLE_v10030993mg             145   2e-36   Citrus clementina [clementine]
gb|KJB76178.1|  hypothetical protein B456_012G076400                    144   2e-36   Gossypium raimondii
ref|XP_010505709.1|  PREDICTED: flocculation protein FLO11-like         145   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010689824.1|  PREDICTED: cell wall protein RBR3                  144   6e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB76173.1|  hypothetical protein B456_012G076400                    144   7e-36   Gossypium raimondii
gb|KHG16426.1|  hypothetical protein F383_23799                         142   2e-35   Gossypium arboreum [tree cotton]
ref|XP_006575535.1|  PREDICTED: flocculation protein FLO11-like i...    143   2e-35   Glycine max [soybeans]
ref|XP_009133405.1|  PREDICTED: uncharacterized serine-rich prote...    142   2e-35   Brassica rapa
emb|CDY07628.1|  BnaA03g18830D                                          142   3e-35   Brassica napus [oilseed rape]
gb|KDP44785.1|  hypothetical protein JCGZ_01285                         141   5e-35   Jatropha curcas
emb|CDY60338.1|  BnaC03g72310D                                          140   1e-34   Brassica napus [oilseed rape]
ref|XP_002526897.1|  ATP binding protein, putative                      140   1e-34   Ricinus communis
ref|XP_006293855.1|  hypothetical protein CARUB_v10022840mg             140   1e-34   Capsella rubella
ref|XP_007141776.1|  hypothetical protein PHAVU_008G224800g             139   4e-34   Phaseolus vulgaris [French bean]
ref|XP_006595867.1|  PREDICTED: flocculation protein FLO11-like i...    139   6e-34   Glycine max [soybeans]
gb|KFK36895.1|  hypothetical protein AALP_AA4G186400                    138   8e-34   Arabis alpina [alpine rockcress]
gb|KHN20852.1|  hypothetical protein glysoja_009160                     137   3e-33   Glycine soja [wild soybean]
ref|XP_010534575.1|  PREDICTED: mucin-17-like                           132   6e-32   Tarenaya hassleriana [spider flower]
gb|AAB95292.1|  En/Spm-like transposon protein                          131   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006575536.1|  PREDICTED: flocculation protein FLO11-like i...    133   1e-31   Glycine max [soybeans]
gb|KHF99477.1|  Low-density lipoprotein receptor-related                131   1e-31   Gossypium arboreum [tree cotton]
gb|KJB74298.1|  hypothetical protein B456_011G285700                    131   2e-31   Gossypium raimondii
ref|XP_006356484.1|  PREDICTED: flocculation protein FLO11-like         130   4e-31   Solanum tuberosum [potatoes]
ref|XP_006595866.1|  PREDICTED: flocculation protein FLO11-like i...    130   6e-31   
ref|XP_004235247.1|  PREDICTED: putative GPI-anchored protein PB1...    129   9e-31   Solanum lycopersicum
ref|XP_009412575.1|  PREDICTED: vegetative cell wall protein gp1-...    127   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006848188.1|  hypothetical protein AMTR_s00029p00238480          127   7e-30   Amborella trichopoda
ref|XP_009419731.1|  PREDICTED: nascent polypeptide-associated co...    126   9e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76179.1|  hypothetical protein B456_012G076400                    126   9e-30   Gossypium raimondii
ref|XP_006495301.1|  PREDICTED: flocculation protein FLO11-like         125   1e-29   Citrus sinensis [apfelsine]
gb|EPS71355.1|  hypothetical protein M569_03402                         125   3e-29   Genlisea aurea
gb|KDO47715.1|  hypothetical protein CISIN_1g008537mg                   125   3e-29   Citrus sinensis [apfelsine]
ref|XP_006429352.1|  hypothetical protein CICLE_v10011390mg             125   4e-29   Citrus clementina [clementine]
ref|XP_009407548.1|  PREDICTED: mucin-1 isoform X1                      122   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407549.1|  PREDICTED: mucin-1 isoform X2                      122   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH57264.1|  AT2G40070                                              120   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490980.1|  PREDICTED: flocculation protein FLO11-like         120   2e-27   Cicer arietinum [garbanzo]
emb|CDX74811.1|  BnaA05g05570D                                          119   4e-27   
ref|XP_009402293.1|  PREDICTED: nascent polypeptide-associated co...    117   9e-27   
ref|XP_010654168.1|  PREDICTED: zonadhesin-like isoform X1              117   1e-26   Vitis vinifera
gb|KHG09845.1|  Maturase K                                              115   7e-26   Gossypium arboreum [tree cotton]
emb|CAN77490.1|  hypothetical protein VITISV_010725                     115   1e-25   Vitis vinifera
ref|XP_007026736.1|  Uncharacterized protein TCM_021711                 114   2e-25   
ref|XP_003623288.1|  hypothetical protein MTR_7g068220                  111   1e-24   Medicago truncatula
ref|XP_010654169.1|  PREDICTED: mucin-12-like isoform X2                111   2e-24   Vitis vinifera
ref|NP_001078028.1|  uncharacterized protein                            111   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHN48560.1|  hypothetical protein glysoja_034183                     111   4e-24   Glycine soja [wild soybean]
ref|XP_004492428.1|  PREDICTED: mucin-5AC-like                          107   4e-23   Cicer arietinum [garbanzo]
ref|XP_009412573.1|  PREDICTED: endochitinase A-like isoform X1         106   2e-22   
gb|KJB76928.1|  hypothetical protein B456_012G113200                    105   2e-22   Gossypium raimondii
gb|KDP24464.1|  hypothetical protein JCGZ_25028                         104   4e-22   Jatropha curcas
gb|KJB76927.1|  hypothetical protein B456_012G113200                    105   4e-22   Gossypium raimondii
gb|KHN07485.1|  hypothetical protein glysoja_034966                     103   9e-22   Glycine soja [wild soybean]
ref|XP_006602654.1|  PREDICTED: flocculation protein FLO11 isofor...    103   9e-22   
ref|XP_007140357.1|  hypothetical protein PHAVU_008G105200g             103   1e-21   Phaseolus vulgaris [French bean]
ref|XP_002528111.1|  conserved hypothetical protein                     101   7e-21   Ricinus communis
emb|CBI30399.3|  unnamed protein product                              95.9    6e-20   Vitis vinifera
ref|XP_006583646.1|  PREDICTED: flocculation protein FLO11-like       96.3    4e-19   Glycine max [soybeans]
gb|KEH28283.1|  ATP-binding protein, putative                         96.3    5e-19   Medicago truncatula
ref|XP_008388204.1|  PREDICTED: uncharacterized protein DDB_G0271...  92.8    7e-18   
ref|XP_007208455.1|  hypothetical protein PRUPE_ppa003864mg           91.7    2e-17   Prunus persica
ref|XP_010109621.1|  hypothetical protein L484_015576                 91.3    2e-17   Morus notabilis
ref|XP_009344715.1|  PREDICTED: flocculation protein FLO11-like       89.7    7e-17   Pyrus x bretschneideri [bai li]
ref|XP_008243876.1|  PREDICTED: flocculation protein FLO11-like       89.7    7e-17   Prunus mume [ume]
gb|KEH28284.1|  ATP-binding protein, putative                         89.7    8e-17   Medicago truncatula
ref|XP_009377788.1|  PREDICTED: mucin-2-like                          86.3    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_006366352.1|  PREDICTED: flocculation protein FLO11-like       85.9    1e-15   Solanum tuberosum [potatoes]
ref|XP_011044062.1|  PREDICTED: LOW QUALITY PROTEIN: nascent poly...  85.1    3e-15   Populus euphratica
emb|CDY53090.1|  BnaCnng24200D                                        84.0    5e-15   Brassica napus [oilseed rape]
ref|XP_008370081.1|  PREDICTED: flocculation protein FLO11-like       83.6    8e-15   
emb|CDY07050.1|  BnaA04g22650D                                        79.3    1e-14   
ref|XP_008807272.1|  PREDICTED: uncharacterized protein LOC103719688  78.6    4e-14   
ref|XP_009588557.1|  PREDICTED: uncharacterized protein DDB_G0274...  81.3    5e-14   Nicotiana tomentosiformis
ref|XP_009588559.1|  PREDICTED: uncharacterized protein DDB_G0274...  81.3    5e-14   Nicotiana tomentosiformis
ref|XP_004968162.1|  PREDICTED: mucin-5AC-like isoform X1             80.9    8e-14   Setaria italica
ref|XP_004968163.1|  PREDICTED: mucin-5AC-like isoform X2             80.5    8e-14   
ref|XP_011047445.1|  PREDICTED: mucin-2-like                          80.5    8e-14   Populus euphratica
ref|XP_009123519.1|  PREDICTED: sialidase-like                        80.5    9e-14   Brassica rapa
ref|XP_006407721.1|  hypothetical protein EUTSA_v10020521mg           80.1    1e-13   Eutrema salsugineum [saltwater cress]
gb|KFK38285.1|  hypothetical protein AALP_AA3G094600                  79.7    1e-13   Arabis alpina [alpine rockcress]
ref|XP_004302638.1|  PREDICTED: endochitinase A-like                  79.3    2e-13   Fragaria vesca subsp. vesca
emb|CDY22176.1|  BnaC01g39250D                                        79.0    3e-13   Brassica napus [oilseed rape]
ref|XP_010486449.1|  PREDICTED: flocculation protein FLO11-like       78.6    3e-13   
ref|NP_566340.1|  proline-rich uncharacterized protein                78.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464524.1|  PREDICTED: cell wall protein DAN4-like           78.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009146960.1|  PREDICTED: flocculation protein FLO11-like       78.6    4e-13   Brassica rapa
ref|XP_002323572.2|  hypothetical protein POPTR_0016s12230g           78.6    4e-13   
ref|XP_010248888.1|  PREDICTED: uncharacterized protein LOC104591651  79.0    5e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009804551.1|  PREDICTED: endochitinase A-like isoform X1       78.2    5e-13   Nicotiana sylvestris
ref|XP_010467544.1|  PREDICTED: mucin-5AC-like                        78.2    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009804552.1|  PREDICTED: endochitinase A-like isoform X2       77.8    6e-13   Nicotiana sylvestris
ref|XP_004246841.1|  PREDICTED: endochitinase A-like                  77.8    6e-13   Solanum lycopersicum
emb|CDY44674.1|  BnaA05g29320D                                        77.8    7e-13   Brassica napus [oilseed rape]
ref|NP_001143501.1|  uncharacterized protein LOC100276180             73.9    8e-13   
ref|XP_006299014.1|  hypothetical protein CARUB_v10015141mg           77.4    9e-13   Capsella rubella
ref|XP_010250822.1|  PREDICTED: uncharacterized protein LOC104592946  77.8    9e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010543220.1|  PREDICTED: mucin-1-like                          76.3    2e-12   Tarenaya hassleriana [spider flower]
gb|EEC69917.1|  hypothetical protein OsI_00338                        75.5    3e-12   Oryza sativa Indica Group [Indian rice]
gb|ACG46765.1|  hypothetical protein                                  72.0    4e-12   Zea mays [maize]
ref|XP_008654702.1|  PREDICTED: uncharacterized protein LOC100276...  73.6    9e-12   
ref|NP_001041987.1|  Os01g0141900                                     74.3    9e-12   
dbj|BAD61066.1|  putative proteophosphoglycan                         74.3    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457389.1|  hypothetical protein SORBIDRAFT_03g006540        74.3    1e-11   Sorghum bicolor [broomcorn]
ref|XP_010103184.1|  hypothetical protein L484_006735                 73.2    3e-11   Morus notabilis
ref|XP_008672699.1|  PREDICTED: hypothetical protein isoform X1       72.8    3e-11   Zea mays [maize]
ref|XP_008672700.1|  PREDICTED: hypothetical protein isoform X2       72.8    3e-11   Zea mays [maize]
ref|XP_008449265.1|  PREDICTED: uncharacterized protein DDB_G0271...  72.4    3e-11   Cucumis melo [Oriental melon]
ref|XP_008449274.1|  PREDICTED: uncharacterized protein DDB_G0271...  72.4    3e-11   Cucumis melo [Oriental melon]
emb|CDP12663.1|  unnamed protein product                              72.4    3e-11   Coffea canephora [robusta coffee]
ref|XP_004165110.1|  PREDICTED: uncharacterized protein LOC101231484  72.0    4e-11   
ref|XP_004147920.1|  PREDICTED: uncharacterized protein LOC101217147  72.0    5e-11   Cucumis sativus [cucumbers]
ref|XP_004502320.1|  PREDICTED: serine-rich adhesin for platelets...  71.6    9e-11   Cicer arietinum [garbanzo]
ref|XP_009589500.1|  PREDICTED: uncharacterized protein LOC104086863  71.6    1e-10   Nicotiana tomentosiformis
ref|XP_009797708.1|  PREDICTED: uncharacterized protein LOC104244098  71.2    1e-10   Nicotiana sylvestris
ref|XP_002275753.3|  PREDICTED: uncharacterized protein LOC100263...  70.5    1e-10   
ref|XP_002514993.1|  conserved hypothetical protein                   71.2    1e-10   Ricinus communis
ref|XP_010659787.1|  PREDICTED: uncharacterized protein LOC100263...  70.5    1e-10   Vitis vinifera
ref|XP_010682859.1|  PREDICTED: uncharacterized protein LOC104897629  70.9    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011086742.1|  PREDICTED: uncharacterized protein LOC105168379  70.9    2e-10   
ref|XP_008800364.1|  PREDICTED: uncharacterized protein LOC103714...  70.9    2e-10   
gb|KDO76877.1|  hypothetical protein CISIN_1g038796mg                 70.1    2e-10   Citrus sinensis [apfelsine]
gb|KHN12409.1|  hypothetical protein glysoja_018539                   70.9    2e-10   Glycine soja [wild soybean]
ref|XP_008800363.1|  PREDICTED: uncharacterized protein LOC103714...  70.9    2e-10   Phoenix dactylifera
ref|XP_010320975.1|  PREDICTED: uncharacterized protein LOC101256...  70.5    2e-10   Solanum lycopersicum
ref|XP_008222046.1|  PREDICTED: probable GPI-anchored adhesin-lik...  70.5    2e-10   Prunus mume [ume]
ref|XP_004239504.1|  PREDICTED: uncharacterized protein LOC101256...  70.5    2e-10   Solanum lycopersicum
ref|XP_007225438.1|  hypothetical protein PRUPE_ppa000426mg           70.1    3e-10   Prunus persica
emb|CAN77579.1|  hypothetical protein VITISV_015345                   70.1    3e-10   Vitis vinifera
ref|XP_007133648.1|  hypothetical protein PHAVU_011G197200g           68.9    3e-10   Phaseolus vulgaris [French bean]
gb|KHN34801.1|  hypothetical protein glysoja_036794                   69.7    4e-10   Glycine soja [wild soybean]
ref|XP_004310048.1|  PREDICTED: mucin-12                              69.7    4e-10   Fragaria vesca subsp. vesca
ref|XP_006341750.1|  PREDICTED: dentin sialophosphoprotein-like i...  69.3    5e-10   Solanum tuberosum [potatoes]
ref|XP_006341749.1|  PREDICTED: dentin sialophosphoprotein-like i...  69.3    5e-10   Solanum tuberosum [potatoes]
ref|NP_001066471.1|  Os12g0239000                                     69.3    6e-10   
ref|XP_002266100.1|  PREDICTED: microtubule-associated protein fu...  68.9    6e-10   Vitis vinifera
ref|XP_008218545.1|  PREDICTED: uncharacterized protein DDB_G0271...  68.6    7e-10   Prunus mume [ume]
ref|XP_003532717.1|  PREDICTED: dentin sialophosphoprotein-like i...  68.6    8e-10   
ref|XP_006448387.1|  hypothetical protein CICLE_v10017970mg           67.8    1e-09   
ref|XP_007158713.1|  hypothetical protein PHAVU_002G176100g           68.2    1e-09   Phaseolus vulgaris [French bean]
gb|KDP26761.1|  hypothetical protein JCGZ_17919                       68.2    1e-09   Jatropha curcas
ref|XP_006484045.1|  PREDICTED: dentin sialophosphoprotein-like       68.2    1e-09   Citrus sinensis [apfelsine]
ref|XP_003601815.1|  hypothetical protein MTR_3g085680                68.2    1e-09   
ref|XP_011041562.1|  PREDICTED: uncharacterized protein LOC105137...  68.2    1e-09   Populus euphratica
ref|XP_010025346.1|  PREDICTED: uncharacterized protein LOC104415705  67.8    1e-09   Eucalyptus grandis [rose gum]
ref|XP_002315628.1|  hypothetical protein POPTR_0010s06630g           67.4    2e-09   
ref|XP_007207838.1|  hypothetical protein PRUPE_ppa023307mg           64.7    2e-09   
emb|CDP13309.1|  unnamed protein product                              67.0    2e-09   Coffea canephora [robusta coffee]
ref|XP_008801868.1|  PREDICTED: uncharacterized protein LOC103715870  67.0    3e-09   Phoenix dactylifera
ref|XP_011015874.1|  PREDICTED: uncharacterized protein LOC105119429  66.2    3e-09   Populus euphratica
ref|XP_006438105.1|  hypothetical protein CICLE_v10030548mg           66.6    3e-09   Citrus clementina [clementine]
ref|XP_002315099.2|  hypothetical protein POPTR_0010s18450g           66.2    4e-09   
ref|XP_011041561.1|  PREDICTED: uncharacterized protein LOC105137...  66.6    4e-09   Populus euphratica
ref|XP_010930074.1|  PREDICTED: uncharacterized protein LOC105051...  66.6    4e-09   Elaeis guineensis
ref|XP_010930072.1|  PREDICTED: uncharacterized protein LOC105051...  66.6    4e-09   Elaeis guineensis
gb|KHG04576.1|  RUN and FYVE domain-containing protein 2              66.2    4e-09   Gossypium arboreum [tree cotton]
gb|KDO82006.1|  hypothetical protein CISIN_1g000989mg                 66.2    4e-09   Citrus sinensis [apfelsine]
ref|XP_011041563.1|  PREDICTED: uncharacterized protein LOC105137...  66.2    5e-09   Populus euphratica
gb|KDO82004.1|  hypothetical protein CISIN_1g000989mg                 66.2    5e-09   Citrus sinensis [apfelsine]
ref|XP_006591470.1|  PREDICTED: dentin sialophosphoprotein-like i...  65.9    6e-09   Glycine max [soybeans]
emb|CDY48118.1|  BnaC02g03750D                                        65.5    7e-09   Brassica napus [oilseed rape]
ref|XP_010045976.1|  PREDICTED: uncharacterized protein LOC104434810  65.1    7e-09   Eucalyptus grandis [rose gum]
gb|KJB30996.1|  hypothetical protein B456_005G171400                  65.5    8e-09   Gossypium raimondii
ref|XP_002986701.1|  hypothetical protein SELMODRAFT_446681           65.1    9e-09   
ref|XP_008367047.1|  PREDICTED: dentin sialophosphoprotein-like       65.5    9e-09   
ref|XP_006850316.1|  hypothetical protein AMTR_s00020p00207770        65.1    1e-08   
gb|ADK60792.1|  hypothetical protein                                  60.5    1e-08   Arachis diogoi
emb|CDY55901.1|  BnaAnng13940D                                        64.7    1e-08   Brassica napus [oilseed rape]
ref|XP_008662601.1|  PREDICTED: probable GPI-anchored adhesin-lik...  65.1    1e-08   Zea mays [maize]
ref|XP_008662602.1|  PREDICTED: probable GPI-anchored adhesin-lik...  65.1    1e-08   Zea mays [maize]
ref|XP_009125427.1|  PREDICTED: uncharacterized protein DDB_G0271670  64.7    1e-08   
ref|XP_003551686.2|  PREDICTED: dentin sialophosphoprotein-like       64.7    1e-08   Glycine max [soybeans]
ref|XP_006842565.1|  hypothetical protein AMTR_s00077p00146340        64.7    1e-08   Amborella trichopoda
ref|XP_007045001.1|  Uncharacterized protein TCM_010765               64.7    2e-08   
ref|XP_004304828.1|  PREDICTED: uncharacterized protein LOC101311...  63.9    2e-08   Fragaria vesca subsp. vesca
ref|XP_007163731.1|  hypothetical protein PHAVU_001G259600g           64.3    2e-08   Phaseolus vulgaris [French bean]
ref|XP_011029646.1|  PREDICTED: uncharacterized protein LOC105129...  64.3    2e-08   Populus euphratica
ref|XP_011029647.1|  PREDICTED: uncharacterized protein LOC105129...  64.3    2e-08   Populus euphratica
ref|XP_008444430.1|  PREDICTED: signaling mucin MSB2 isoform X2       63.9    3e-08   Cucumis melo [Oriental melon]
ref|XP_008444428.1|  PREDICTED: signaling mucin MSB2 isoform X1       63.9    3e-08   Cucumis melo [Oriental melon]
ref|XP_004159580.1|  PREDICTED: uncharacterized protein LOC101229973  63.5    4e-08   
ref|XP_004143045.1|  PREDICTED: uncharacterized protein LOC101205907  63.5    4e-08   
ref|XP_010478134.1|  PREDICTED: uncharacterized protein LOC104757115  63.5    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010499276.1|  PREDICTED: uncharacterized protein LOC104776836  63.5    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010460547.1|  PREDICTED: uncharacterized protein LOC104741389  63.5    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006415723.1|  hypothetical protein EUTSA_v10006616mg           63.5    4e-08   Eutrema salsugineum [saltwater cress]
gb|KHN24087.1|  hypothetical protein glysoja_025260                   63.5    4e-08   Glycine soja [wild soybean]
ref|XP_006303891.1|  hypothetical protein CARUB_v10008135mg           63.2    5e-08   Capsella rubella
ref|XP_006663925.1|  PREDICTED: dentin sialophosphoprotein-like       63.2    5e-08   Oryza brachyantha
ref|XP_010927925.1|  PREDICTED: uncharacterized protein LOC105049853  62.4    6e-08   Elaeis guineensis
ref|XP_009359317.1|  PREDICTED: uncharacterized protein LOC103949902  63.2    6e-08   
ref|NP_174106.1|  uncharacterized protein                             62.8    7e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84901.1|  BnaC05g21540D                                        62.4    8e-08   
emb|CDY11763.1|  BnaC03g58150D                                        62.4    8e-08   Brassica napus [oilseed rape]
gb|KFK21994.1|  hypothetical protein AALP_AAs74555U000100             58.5    9e-08   Arabis alpina [alpine rockcress]
ref|XP_009113729.1|  PREDICTED: serine/arginine repetitive matrix...  62.4    9e-08   Brassica rapa
emb|CDY27635.1|  BnaA09g27720D                                        62.4    9e-08   Brassica napus [oilseed rape]
ref|XP_009404264.1|  PREDICTED: uncharacterized protein LOC103987635  62.4    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB53694.1|  hypothetical protein B456_009G001400                  61.2    1e-07   Gossypium raimondii
ref|XP_009392610.1|  PREDICTED: uncharacterized protein LOC103978514  61.6    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007014558.1|  Uncharacterized protein TCM_039765               60.8    2e-07   
gb|EYU41062.1|  hypothetical protein MIMGU_mgv1a020583mg              60.8    2e-07   Erythranthe guttata [common monkey flower]
emb|CDP04135.1|  unnamed protein product                              60.5    3e-07   Coffea canephora [robusta coffee]
gb|ABG21939.1|  expressed protein                                     60.8    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066472.1|  Os12g0239200                                     60.8    3e-07   
gb|KHN33364.1|  hypothetical protein glysoja_005406                   56.2    3e-07   Glycine soja [wild soybean]
gb|EAY82705.1|  hypothetical protein OsI_37921                        60.8    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_009109772.1|  PREDICTED: uncharacterized protein LOC103835368  60.5    4e-07   Brassica rapa
emb|CDX90111.1|  BnaA08g18730D                                        60.5    4e-07   
ref|NP_181351.5|  uncharacterized protein                             59.3    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437498.1|  PREDICTED: uncharacterized protein DDB_G0284...  59.3    7e-07   Cucumis melo [Oriental melon]
gb|KDP32494.1|  hypothetical protein JCGZ_13419                       59.3    7e-07   Jatropha curcas
gb|KHN38976.1|  hypothetical protein glysoja_035104                   57.0    7e-07   Glycine soja [wild soybean]
ref|XP_008437499.1|  PREDICTED: uncharacterized protein DDB_G0284...  59.3    7e-07   Cucumis melo [Oriental melon]
ref|XP_008787709.1|  PREDICTED: uncharacterized protein LOC103705682  59.7    8e-07   Phoenix dactylifera
gb|AAC27165.1|  hypothetical protein                                  58.9    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556164.1|  PREDICTED: flocculation protein FLO11-like i...  59.7    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_010556166.1|  PREDICTED: flocculation protein FLO11-like i...  59.3    9e-07   Tarenaya hassleriana [spider flower]
ref|XP_010556165.1|  PREDICTED: flocculation protein FLO11-like i...  59.3    9e-07   Tarenaya hassleriana [spider flower]
gb|KFK21993.1|  hypothetical protein AALP_AAs74555U000100             55.5    9e-07   
ref|XP_006663927.1|  PREDICTED: uncharacterized protein LOC102712...  59.3    9e-07   
ref|XP_006663926.1|  PREDICTED: uncharacterized protein LOC102712...  59.3    9e-07   
ref|XP_009803817.1|  PREDICTED: uncharacterized protein LOC104249141  58.9    1e-06   
ref|XP_008662603.1|  PREDICTED: probable GPI-anchored adhesin-lik...  59.3    1e-06   
ref|XP_004960713.1|  PREDICTED: dentin sialophosphoprotein-like i...  58.9    1e-06   
gb|EYU41085.1|  hypothetical protein MIMGU_mgv1a019551mg              58.5    1e-06   
ref|XP_010318372.1|  PREDICTED: protein yippee-like                   56.2    1e-06   
ref|XP_006295953.1|  hypothetical protein CARUB_v10025095mg           58.2    1e-06   
ref|XP_006660852.1|  PREDICTED: eukaryotic translation initiation...  57.8    2e-06   
gb|EYU22568.1|  hypothetical protein MIMGU_mgv1a019123mg              58.5    2e-06   
gb|EAZ09776.1|  hypothetical protein OsI_32063                        57.8    2e-06   
ref|XP_004960710.1|  PREDICTED: uncharacterized protein YMR317W-l...  58.2    2e-06   
ref|XP_004960709.1|  PREDICTED: uncharacterized protein YMR317W-l...  58.2    2e-06   
ref|NP_001063688.1|  Os09g0518600                                     57.8    2e-06   
ref|XP_003578738.1|  PREDICTED: uncharacterized protein LOC100845738  58.2    3e-06   
ref|XP_010926591.1|  PREDICTED: uncharacterized protein LOC105048...  58.2    3e-06   
ref|XP_002444649.1|  hypothetical protein SORBIDRAFT_07g025370        57.0    4e-06   
ref|XP_008674170.1|  PREDICTED: probable GPI-anchored adhesin-lik...  57.4    4e-06   
ref|XP_011071311.1|  PREDICTED: serine/arginine repetitive matrix...  57.0    4e-06   
ref|XP_010312896.1|  PREDICTED: uncharacterized serine-rich prote...  56.6    6e-06   
gb|KFK36712.1|  hypothetical protein AALP_AA4G159900                  55.8    9e-06   
ref|XP_010538147.1|  PREDICTED: uncharacterized protein LOC104812594  56.6    9e-06   
ref|XP_004145969.1|  PREDICTED: uncharacterized protein LOC101212726  55.5    1e-05   
ref|XP_006411019.1|  hypothetical protein EUTSA_v10017516mg           55.5    1e-05   
ref|XP_004974100.1|  PREDICTED: uncharacterized protein LOC101769...  55.5    1e-05   
gb|KGN49945.1|  hypothetical protein Csa_5G141190                     55.5    1e-05   
ref|XP_008664473.1|  PREDICTED: nucleolar and coiled-body phospho...  55.1    1e-05   
gb|EYU24268.1|  hypothetical protein MIMGU_mgv1a025170mg              55.1    2e-05   
ref|XP_006643736.1|  PREDICTED: flocculation protein FLO11-like       55.5    2e-05   
ref|XP_004511085.1|  PREDICTED: probable serine/threonine-protein...  55.1    2e-05   
ref|XP_008674231.1|  PREDICTED: probable GPI-anchored adhesin-lik...  55.8    2e-05   
ref|XP_008674226.1|  PREDICTED: probable GPI-anchored adhesin-lik...  55.8    2e-05   
ref|XP_008674230.1|  PREDICTED: probable GPI-anchored adhesin-lik...  55.5    2e-05   
ref|XP_002514765.1|  conserved hypothetical protein                   55.1    2e-05   
ref|XP_002312640.1|  hypothetical protein POPTR_0008s17870g           55.5    2e-05   
ref|NP_001131704.1|  hypothetical protein                             54.7    2e-05   
gb|EYU41089.1|  hypothetical protein MIMGU_mgv1a017630mg              54.7    2e-05   
gb|EYU41058.1|  hypothetical protein MIMGU_mgv1a018183mg              54.3    2e-05   
gb|EPS68148.1|  hypothetical protein M569_06625                       54.7    3e-05   
ref|XP_010505431.1|  PREDICTED: uncharacterized protein LOC104782251  54.3    3e-05   
ref|XP_002462677.1|  hypothetical protein SORBIDRAFT_02g030080        54.3    3e-05   
ref|XP_008654038.1|  PREDICTED: uncharacterized protein LOC103634243  54.3    4e-05   
ref|NP_001145568.1|  uncharacterized protein LOC100279031             51.2    5e-05   
ref|XP_003576741.1|  PREDICTED: uncharacterized protein LOC100828226  53.5    5e-05   
ref|XP_009390109.1|  PREDICTED: uncharacterized protein LOC103976...  53.9    7e-05   
ref|XP_009390105.1|  PREDICTED: uncharacterized protein LOC103976...  53.9    7e-05   
ref|XP_008463284.1|  PREDICTED: uncharacterized protein DDB_G0271670  53.5    8e-05   
ref|XP_011091749.1|  PREDICTED: uncharacterized protein LOC105172109  53.1    8e-05   
ref|XP_004962899.1|  PREDICTED: uncharacterized protein LOC101756195  53.5    1e-04   
gb|EAY82704.1|  hypothetical protein OsI_37920                        53.1    1e-04   
ref|XP_009772872.1|  PREDICTED: mucin-17 isoform X1                   53.1    1e-04   
gb|EAZ20086.1|  hypothetical protein OsJ_35684                        53.1    1e-04   
ref|XP_010423932.1|  PREDICTED: putative protein TPRXL isoform X2     52.8    1e-04   
ref|XP_010423931.1|  PREDICTED: uncharacterized serine-rich prote...  52.8    1e-04   
gb|ACL54464.1|  unknown                                               52.8    1e-04   
gb|EMT20769.1|  hypothetical protein F775_03721                       52.4    1e-04   
ref|XP_010463237.1|  PREDICTED: serine/arginine repetitive matrix...  52.8    1e-04   
ref|XP_010464476.1|  PREDICTED: serine/arginine repetitive matrix...  52.4    2e-04   
ref|XP_004957375.1|  PREDICTED: flocculation protein FLO11-like       52.0    2e-04   
ref|XP_006407753.1|  hypothetical protein EUTSA_v10020404mg           52.4    2e-04   
gb|EYU37333.1|  hypothetical protein MIMGU_mgv1a024303mg              52.0    2e-04   
ref|XP_010486409.1|  PREDICTED: serine/arginine repetitive matrix...  52.4    2e-04   
ref|XP_002266425.1|  PREDICTED: putative GPI-anchored protein PB1...  52.0    2e-04   
ref|NP_001145904.1|  hypothetical protein                             52.0    2e-04   
ref|XP_010452004.1|  PREDICTED: uncharacterized serine-rich prote...  52.0    3e-04   
ref|XP_009772873.1|  PREDICTED: cell wall protein RBR3 isoform X2     51.6    3e-04   
ref|XP_009594511.1|  PREDICTED: cell wall protein RBR3 isoform X1     51.6    4e-04   
ref|XP_008782693.1|  PREDICTED: flocculation protein FLO11 isofor...  51.2    4e-04   
ref|XP_004142729.1|  PREDICTED: uncharacterized protein LOC101206216  51.2    4e-04   
ref|XP_011001659.1|  PREDICTED: flocculation protein FLO11-like       51.2    4e-04   
emb|CDY35995.1|  BnaA05g29550D                                        51.2    4e-04   
ref|XP_006286667.1|  hypothetical protein CARUB_v10002586mg           51.2    4e-04   
ref|XP_006297329.1|  hypothetical protein CARUB_v10013349mg           51.2    5e-04   
gb|EYU41101.1|  hypothetical protein MIMGU_mgv1a025898mg              50.8    5e-04   
gb|EMS68078.1|  Inositol-tetrakisphosphate 1-kinase 4                 51.2    5e-04   
emb|CDY27987.1|  BnaC05g43890D                                        50.8    6e-04   
ref|XP_006374055.1|  hypothetical protein POPTR_0016s14630g           50.8    6e-04   
ref|XP_009594520.1|  PREDICTED: sialidase isoform X2                  50.1    0.001   
gb|EPS72146.1|  hypothetical protein M569_02611                       50.1    0.001   



>ref|XP_009603333.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X3 [Nicotiana tomentosiformis]
Length=500

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = +1

Query  430  MNRSFRAEESLTKQR----MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRAEES  +QR    MG+LRSS +KEKDEEL LFLEMRRREKERNDLLL QNSDEF
Sbjct  1    MNRSFRAEESALRQRQQQQMGTLRSSGMKEKDEELTLFLEMRRREKERNDLLL-QNSDEF  59

Query  598  DAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLG+  GSSP+F+I S  P RKT ADDFLN++NDKNDYDWLLTPPGTPLF
Sbjct  60   DAPLGATRGSSPIFDIASETPVRKTGADDFLNADNDKNDYDWLLTPPGTPLF  111



>ref|XP_002274030.1| PREDICTED: mucin-17 [Vitis vinifera]
 emb|CBI25498.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 7/115 (6%)
 Frame = +1

Query  430  MNRSFRAEESLT-------KQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA+ES         +Q++GSLRSS++KEKDEEL LFLEMR+REKER+ LLLLQ+S
Sbjct  1    MNRSFRAQESQMSATVRQRQQQVGSLRSSVMKEKDEELALFLEMRKREKERSHLLLLQDS  60

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDAPLG+  GSSP+FNI  + P RKTVADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  61   EEFDAPLGAKPGSSPIFNIAPSPPPRKTVADDFLNSDNDKNDYDWLLTPPGTPLF  115



>ref|XP_009603328.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X2 [Nicotiana tomentosiformis]
Length=524

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = +1

Query  430  MNRSFRAEESLTKQR----MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRAEES  +QR    MG+LRSS +KEKDEEL LFLEMRRREKERNDLLL QNSDEF
Sbjct  1    MNRSFRAEESALRQRQQQQMGTLRSSGMKEKDEELTLFLEMRRREKERNDLLL-QNSDEF  59

Query  598  DAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLG+  GSSP+F+I S  P RKT ADDFLN++NDKNDYDWLLTPPGTPLF
Sbjct  60   DAPLGATRGSSPIFDIASETPVRKTGADDFLNADNDKNDYDWLLTPPGTPLF  111



>ref|XP_009603323.1| PREDICTED: mucin-5B-like isoform X1 [Nicotiana tomentosiformis]
Length=574

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 96/112 (86%), Gaps = 5/112 (4%)
 Frame = +1

Query  430  MNRSFRAEESLTKQR----MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRAEES  +QR    MG+LRSS +KEKDEEL LFLEMRRREKERNDLLL QNSDEF
Sbjct  1    MNRSFRAEESALRQRQQQQMGTLRSSGMKEKDEELTLFLEMRRREKERNDLLL-QNSDEF  59

Query  598  DAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLG+  GSSP+F+I S  P RKT ADDFLN++NDKNDYDWLLTPPGTPLF
Sbjct  60   DAPLGATRGSSPIFDIASETPVRKTGADDFLNADNDKNDYDWLLTPPGTPLF  111



>ref|XP_010262830.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X1 [Nelumbo nucifera]
Length=546

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 5/113 (4%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ES     + +++ G    +++KEKDEEL LFLEMR+REKERN+LLLLQN++E
Sbjct  1    MNRSFRAQESQMQASVQQRQHGRSLGTVMKEKDEELALFLEMRKREKERNNLLLLQNTEE  60

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPLGS TGSSP+F I S+ PARKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  61   FDAPLGSKTGSSPIFKIVSSTPARKTGADDFLNSDNDKNDYDWLLTPPGTPLF  113



>ref|XP_010256565.1| PREDICTED: mucin-5AC-like [Nelumbo nucifera]
Length=569

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 5/113 (4%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ES     + +++ G    S++KEK+EEL LFLEMR+REKERN+LLLLQNS+E
Sbjct  1    MNRSFRAQESQMQASIQQRQQGRNLGSVMKEKEEELALFLEMRKREKERNNLLLLQNSEE  60

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPLGS  GSSP+F I S+ PARKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  61   FDAPLGSKPGSSPIFKIVSSTPARKTGADDFLNSDNDKNDYDWLLTPPGTPLF  113



>ref|XP_004239930.1| PREDICTED: uncharacterized protein DDB_G0274915 [Solanum lycopersicum]
Length=578

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 3/111 (3%)
 Frame = +1

Query  430  MNRSFRAEESLTK---QRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MNRSFRAEES  +   Q+MGS R+S++KEK+EELGLFLEMRRREKERNDLLL QN DEFD
Sbjct  1    MNRSFRAEESALRELQQQMGSFRNSVVKEKEEELGLFLEMRRREKERNDLLLFQNGDEFD  60

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            APL S  GSSP+FNI S    RK   DDFLN++NDKNDY+WLLTPP TPLF
Sbjct  61   APLESRAGSSPIFNIGSTTNVRKNGTDDFLNADNDKNDYEWLLTPPSTPLF  111



>ref|XP_006355666.1| PREDICTED: mucin-5AC-like [Solanum tuberosum]
Length=578

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 3/111 (3%)
 Frame = +1

Query  430  MNRSFRAEESLTK---QRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MNRSFRAEES  +   Q+MGS R+S++KEK+EELGLFLEMRRREKERNDLLL QN DEFD
Sbjct  1    MNRSFRAEESALRELQQQMGSFRNSVMKEKEEELGLFLEMRRREKERNDLLLFQNGDEFD  60

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            APL S  GSSP+FNI S    RK   DDFLN++NDKNDY+WLLTPP TPLF
Sbjct  61   APLESRAGSSPIFNIGSTTNVRKNGTDDFLNADNDKNDYEWLLTPPSTPLF  111



>ref|XP_009791262.1| PREDICTED: mucin-5AC-like isoform X1 [Nicotiana sylvestris]
Length=579

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 3/111 (3%)
 Frame = +1

Query  430  MNRSFRAEESLTKQ---RMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MN SFRAEES  +Q   +MGS R+S++KEK+EEL LFLEMRRREK+RNDLLL QN DEFD
Sbjct  1    MNGSFRAEESAMRQLQQQMGSFRNSVMKEKEEELALFLEMRRREKDRNDLLLFQNGDEFD  60

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            A LGSN G SP+FNI SA   RK  ADDFLN+ENDKNDY+WLLTPP TPLF
Sbjct  61   AQLGSNAGGSPLFNIGSATTVRKNGADDFLNAENDKNDYEWLLTPPSTPLF  111



>ref|XP_009605096.1| PREDICTED: mucin-5AC-like isoform X1 [Nicotiana tomentosiformis]
Length=579

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 3/111 (3%)
 Frame = +1

Query  430  MNRSFRAEESLTKQ---RMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MN SFRAEE+  +Q   +MGS R+S++KEK+EEL LFLEMRRREK+RNDLLL QN DEFD
Sbjct  1    MNGSFRAEETAMRQLQQQMGSFRNSVMKEKEEELALFLEMRRREKDRNDLLLFQNGDEFD  60

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            APLG N G SP+FNI SA   RK  ADDFLN+ENDKNDY+WLLTPP TPLF
Sbjct  61   APLGLNAGGSPLFNIGSATTVRKNGADDFLNAENDKNDYEWLLTPPSTPLF  111



>ref|XP_002315162.1| hypothetical protein POPTR_0010s19760g [Populus trichocarpa]
 gb|EEF01333.1| hypothetical protein POPTR_0010s19760g [Populus trichocarpa]
Length=567

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEES-------LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA++S       + KQR   LR++M+KEK+EEL LFLEM++REKE+N+LLL+ N+
Sbjct  1    MNRSFRAQDSQMQMQAAVVKQRQ-QLRATMMKEKEEELALFLEMKKREKEQNNLLLINNT  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDAPLGS  G+ P+FNI S+ P RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   EEFDAPLGSKHGTLPIFNISSSTPVRKTGADDFLNSENDKNDYDWLLTPPGTPLF  114



>ref|XP_011035974.1| PREDICTED: mucin-5AC-like [Populus euphratica]
Length=567

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEES-------LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA++S       + KQR   LR++M+KEK+EEL LFLEM++REKE+N+LLL+ N+
Sbjct  1    MNRSFRAQDSQMQMQAAVVKQRQ-QLRATMMKEKEEELALFLEMKKREKEQNNLLLINNT  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDAPLGS  G+ P+FNI S+ P RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   EEFDAPLGSKHGTLPIFNISSSTPVRKTGADDFLNSENDKNDYDWLLTPPGTPLF  114



>ref|XP_009776738.1| PREDICTED: mucin-5AC-like [Nicotiana sylvestris]
Length=570

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 9/112 (8%)
 Frame = +1

Query  430  MNRSFRAEESL----TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRAEES      +Q+MGSLRSS +KEKDEEL LFLEMRRREK+    LLLQNSDEF
Sbjct  1    MNRSFRAEESALRHRQQQQMGSLRSSGMKEKDEELTLFLEMRRREKD----LLLQNSDEF  56

Query  598  DAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLG+  GSSP+F+I   +P RKT ADDFLN++NDKNDYDWLLTPPGTPLF
Sbjct  57   DAPLGATRGSSPIFDI-GELPVRKTGADDFLNADNDKNDYDWLLTPPGTPLF  107



>ref|XP_011076682.1| PREDICTED: cell wall protein RBR3 isoform X1 [Sesamum indicum]
 ref|XP_011076683.1| PREDICTED: cell wall protein RBR3 isoform X1 [Sesamum indicum]
Length=573

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 90/110 (82%), Gaps = 7/110 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRSFRA E   + +MGSLR  +   KDE+L LF EMR+REKERNDLLLLQNSDEFDAPL
Sbjct  1    MNRSFRAPE---RGQMGSLR--LKDNKDEDLALFREMRKREKERNDLLLLQNSDEFDAPL  55

Query  610  GSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            G  TGSSP+FNI +  PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  56   GPKTGSSPIFNITTGTPAPVRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  105



>ref|XP_011076684.1| PREDICTED: cell wall protein RBR3 isoform X2 [Sesamum indicum]
Length=569

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 90/110 (82%), Gaps = 7/110 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRSFRA E   + +MGSLR  +   KDE+L LF EMR+REKERNDLLLLQNSDEFDAPL
Sbjct  1    MNRSFRAPE---RGQMGSLR--LKDNKDEDLALFREMRKREKERNDLLLLQNSDEFDAPL  55

Query  610  GSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            G  TGSSP+FNI +  PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  56   GPKTGSSPIFNITTGTPAPVRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  105



>ref|XP_003552436.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
 gb|KHN36386.1| hypothetical protein glysoja_041416 [Glycine soja]
Length=601

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 10/117 (9%)
 Frame = +1

Query  430  MNRSFRAEESLT-------KQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA+ES         +Q+ G LR+S++KEK+EEL LFLEM++REKERNDLLL  +S
Sbjct  1    MNRSFRAQESQMLAALKQREQQFGGLRASVMKEKEEELALFLEMKKREKERNDLLL-NSS  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDAPLGSN G++P+FNI S+ PA  RKT  DDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   EEFDAPLGSNGGANPIFNISSSTPAPVRKTGVDDFLNSENDKNDYDWLLTPPGTPLF  116



>ref|XP_010262831.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X2 [Nelumbo nucifera]
Length=535

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +1

Query  451  EESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSS  630
            + S+ +++ G    +++KEKDEEL LFLEMR+REKERN+LLLLQN++EFDAPLGS TGSS
Sbjct  2    QASVQQRQHGRSLGTVMKEKDEELALFLEMRKREKERNNLLLLQNTEEFDAPLGSKTGSS  61

Query  631  PVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P+F I S+ PARKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  62   PIFKIVSSTPARKTGADDFLNSDNDKNDYDWLLTPPGTPLF  102



>ref|XP_008369241.1| PREDICTED: flocculation protein FLO11-like [Malus domestica]
Length=575

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  427  AMNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            AMNRSFRA++S    + KQR   LR+S+ KEK+EEL LFLEM++REKERNDLLL  +S+E
Sbjct  2    AMNRSFRAQDSQMQAMIKQRQ-QLRASVRKEKEEELALFLEMKKREKERNDLLL-NSSEE  59

Query  595  FDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPLG+  G+SP+FNI S+ PA  RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   FDAPLGTKPGTSPIFNISSSTPAPPRKTGADDFLNSENDKNDYDWLLTPPGTPLF  114



>ref|XP_002312151.1| hypothetical protein POPTR_0008s06680g [Populus trichocarpa]
 gb|EEE89518.1| hypothetical protein POPTR_0008s06680g [Populus trichocarpa]
Length=565

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEES-------LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA++S       + KQR   LR+ M+KEK+EEL LFLEM++REKE+N+L L+ N+
Sbjct  1    MNRSFRAQDSQMQMQAAVVKQRQ-QLRAKMMKEKEEELALFLEMKKREKEQNNLFLINNT  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            ++F+AP GS  G+SP+FNI S+ PARKT ADDFLNSENDK+DYDWLLTPPGTPLF
Sbjct  60   EDFEAPFGSRHGTSPIFNISSSTPARKTGADDFLNSENDKHDYDWLLTPPGTPLF  114



>ref|XP_007218953.1| hypothetical protein PRUPE_ppa003504mg [Prunus persica]
 gb|EMJ20152.1| hypothetical protein PRUPE_ppa003504mg [Prunus persica]
Length=569

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA+ES    + KQR   LR+S+ KEK+EEL LFLEM++REKERNDLLL  +S+EF
Sbjct  1    MNRSFRAQESQMQAMMKQRQ-QLRASVRKEKEEELALFLEMKKREKERNDLLL-NSSEEF  58

Query  598  DAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLGS  G+SP+FNI S+ PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  59   DAPLGSKPGTSPIFNISSSTPAPQRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  112



>ref|XP_008233740.1| PREDICTED: flocculation protein FLO11 [Prunus mume]
Length=569

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA+ES    + KQR   LR+S+ KEK+EEL LFLEM++REKERNDLLL  +S+EF
Sbjct  1    MNRSFRAQESQMQAMMKQRQ-QLRASVRKEKEEELALFLEMKKREKERNDLLL-NSSEEF  58

Query  598  DAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLGS  G+SP+FNI S+ PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  59   DAPLGSKPGTSPIFNISSSTPAPLRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  112



>ref|XP_009369152.1| PREDICTED: proteoglycan 4-like [Pyrus x bretschneideri]
Length=569

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 8/115 (7%)
 Frame = +1

Query  427  AMNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            AMNRSFRA++S    + KQR   LR+S+ KEK+EEL LFLEM++REKERNDLLL  +S+E
Sbjct  2    AMNRSFRAQDSQMQAMIKQRQ-QLRASVRKEKEEELALFLEMKKREKERNDLLL-NSSEE  59

Query  595  FDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPLG+  G+SP+FNI S+ PA  RKT ADDFLNSENDKNDY+WLLTPPGTPLF
Sbjct  60   FDAPLGTKPGTSPIFNISSSTPAPPRKTGADDFLNSENDKNDYNWLLTPPGTPLF  114



>ref|XP_010095095.1| hypothetical protein L484_026404 [Morus notabilis]
 gb|EXB58201.1| hypothetical protein L484_026404 [Morus notabilis]
Length=578

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 93/114 (82%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA ES      KQR   LR+SM+KEK+EEL LFLEM++REKERNDLLL  +S+EF
Sbjct  1    MNRSFRAPESQMLAAMKQRQ-QLRASMMKEKEEELALFLEMKKREKERNDLLL-NSSEEF  58

Query  598  DAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLG   G+SP+FNI S+ PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  59   DAPLGLKPGTSPIFNISSSTPAPPRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  112



>ref|XP_009600813.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Nicotiana 
tomentosiformis]
 ref|XP_009600821.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Nicotiana 
tomentosiformis]
Length=571

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 88/111 (79%), Gaps = 9/111 (8%)
 Frame = +1

Query  430  MNRSFRAEESLTKQR---MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MNRSFRAEES  +QR   MGS+RSS     DEEL LFLEMRRREKERN+ L LQ  DEFD
Sbjct  1    MNRSFRAEESGQRQRQPLMGSIRSS-----DEELSLFLEMRRREKERNNNLFLQKPDEFD  55

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             PLGS  GSSP FNI SA P R+T ADDFLN++NDK+DYDWLLTPPGTPLF
Sbjct  56   -PLGSKNGSSPAFNIASAAPVRRTRADDFLNADNDKSDYDWLLTPPGTPLF  105



>ref|XP_010262832.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like isoform X3 [Nelumbo nucifera]
Length=518

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVA  678
            +KEKDEEL LFLEMR+REKERN+LLLLQN++EFDAPLGS TGSSP+F I S+ PARKT A
Sbjct  1    MKEKDEELALFLEMRKREKERNNLLLLQNTEEFDAPLGSKTGSSPIFKIVSSTPARKTGA  60

Query  679  DDFLNSENDKNDYDWLLTPPGTPLF  753
            DDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  61   DDFLNSDNDKNDYDWLLTPPGTPLF  85



>ref|XP_008441454.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
 ref|XP_008441455.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
 ref|XP_008441456.1| PREDICTED: probable serine/threonine-protein kinase nek3 isoform 
X1 [Cucumis melo]
Length=577

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 9/116 (8%)
 Frame = +1

Query  430  MNRSFRAEESL------TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA ES        +Q++G LR+S++K+K+EEL LFLEMR+REKERNDLL   N++
Sbjct  1    MNRSFRALESQMQAPVKQRQQVGGLRASVMKDKEEELALFLEMRKREKERNDLLS-NNAE  59

Query  592  EFDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            EFDAPL +  G+SP+FNI SA PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  60   EFDAPLATKPGTSPIFNISSATPAPTRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  115



>ref|XP_009605097.1| PREDICTED: mucin-5AC-like isoform X2 [Nicotiana tomentosiformis]
Length=575

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 89/111 (80%), Gaps = 7/111 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQ---RMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MN SFRAEE+  +Q   +MGS R+S++KEK+EEL LFLEMRRREK+RNDLLL QN DEFD
Sbjct  1    MNGSFRAEETAMRQLQQQMGSFRNSVMKEKEEELALFLEMRRREKDRNDLLLFQNGDEFD  60

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            APL    G SP+FNI SA   RK  ADDFLN+ENDKNDY+WLLTPP TPLF
Sbjct  61   APL----GGSPLFNIGSATTVRKNGADDFLNAENDKNDYEWLLTPPSTPLF  107



>ref|XP_008373857.1| PREDICTED: LOW QUALITY PROTEIN: flocculation protein FLO11-like 
[Malus domestica]
 ref|XP_008362729.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Malus 
domestica]
Length=594

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA++S    + KQR   LR+S++KEK+EEL LFLEM++REKERNDLLL  +S+EF
Sbjct  1    MNRSFRAQDSQMQAMIKQRQ-QLRASVMKEKEEELALFLEMKKREKERNDLLL-NSSEEF  58

Query  598  DAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            D+PLG+  G+SP+F+I S+ PA  RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  59   DSPLGAKPGTSPIFSISSSTPAPPRKTGADDFLNSENDKNDYDWLLTPPGTPLF  112



>ref|XP_009344718.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=588

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 94/114 (82%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA++S    + KQR   LR S+ KEK+EEL LFLEM++REKERNDLLL  +S+EF
Sbjct  1    MNRSFRAQDSQMQAMIKQRQ-QLRVSVRKEKEEELALFLEMKKREKERNDLLL-NSSEEF  58

Query  598  DAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            D+PLG+  G+SPVFNI S+ PA  RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  59   DSPLGAKPGTSPVFNISSSTPAPPRKTGADDFLNSENDKNDYDWLLTPPGTPLF  112



>emb|CDP14035.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 6/114 (5%)
 Frame = +1

Query  430  MNRSFRAEESLTKQR----MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRAEE+  KQR    MGSL++SM+KEKDEEL LF EM++REKERN+LLLL NSD+F
Sbjct  1    MNRSFRAEETGLKQRQQLQMGSLKTSMMKEKDEELALFFEMQKREKERNNLLLLNNSDDF  60

Query  598  DAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DA LG+ +GSSP+FNI S  PA  RKT  DDFLNS+ DKNDYDWLLTPPGTPLF
Sbjct  61   DASLGTKSGSSPIFNIASTTPAPVRKTATDDFLNSDTDKNDYDWLLTPPGTPLF  114



>ref|XP_004307632.1| PREDICTED: flocculation protein FLO11 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=566

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 9/115 (8%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA+ES    + KQR   LR+SM KEK+EEL LFLEM++REKERNDLLL   S+EF
Sbjct  1    MNRSFRAQESQMQAVMKQRQ-QLRASMRKEKEEELALFLEMKKREKERNDLLL-NTSEEF  58

Query  598  DAPLGSNTGSSPVFNIPSAMPA---RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLG+  G+SP+FNI S+ PA   RK+  D+FLNSENDKNDYDWLLTPPGTPLF
Sbjct  59   DAPLGAKPGTSPIFNISSSTPAPPTRKSGTDEFLNSENDKNDYDWLLTPPGTPLF  113



>gb|KGN45784.1| hypothetical protein Csa_6G011590 [Cucumis sativus]
Length=576

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 9/115 (8%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA ES     + +Q++G LR+S++K+K+EEL LFLEMR+REKERNDLL   N++E
Sbjct  2    MNRSFRALESQMQAPVKRQQVGGLRASVMKDKEEELALFLEMRKREKERNDLLS-NNAEE  60

Query  595  FDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPL +  G+SP+FNI SA PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  61   FDAPLATKPGTSPIFNI-SATPAPTRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  114



>ref|XP_004138425.1| PREDICTED: uncharacterized protein LOC101204600 [Cucumis sativus]
Length=575

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 9/115 (8%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA ES     + +Q++G LR+S++K+K+EEL LFLEMR+REKERNDLL   N++E
Sbjct  1    MNRSFRALESQMQAPVKRQQVGGLRASVMKDKEEELALFLEMRKREKERNDLLS-NNAEE  59

Query  595  FDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPL +  G+SP+FNI SA PA  RKT ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  60   FDAPLATKPGTSPIFNI-SATPAPTRKTGADDFLNSDNDKNDYDWLLTPPGTPLF  113



>ref|XP_011469903.1| PREDICTED: flocculation protein FLO11 isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011469904.1| PREDICTED: flocculation protein FLO11 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=566

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 9/115 (8%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA+ES    + KQR   LR+SM KEK+EEL LFLEM++REKERNDLLL   S+EF
Sbjct  1    MNRSFRAQESQMQAVMKQRQ-QLRASMRKEKEEELALFLEMKKREKERNDLLL-NTSEEF  58

Query  598  DAPLGSNTGSSPVFNIPSAMPA---RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DAPLG+  G+SP+FNI S+ PA   RK+  D+FLNSENDKNDYDWLLTPPGTPLF
Sbjct  59   DAPLGAKPGTSPIFNISSSTPAPPTRKSGTDEFLNSENDKNDYDWLLTPPGTPLF  113



>ref|XP_004500676.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=613

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 93/118 (79%), Gaps = 11/118 (9%)
 Frame = +1

Query  430  MNRSFRAEE----SLTKQR---MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA+E    +  KQR    G L +S+  EKDEEL LFLEMR+REKERNDLLL   S
Sbjct  1    MNRSFRAQELQMQAALKQREQQFGGLTASLTTEKDEELALFLEMRKREKERNDLLL-HTS  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPA---RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDA LGSN G+SP+FNI S+MPA   RK+ ADDFLNSEN+KNDYDWLLTPPGTPLF
Sbjct  60   EEFDAALGSNPGNSPLFNISSSMPAAPVRKSGADDFLNSENNKNDYDWLLTPPGTPLF  117



>ref|XP_009782013.1| PREDICTED: cell wall protein RBR3-like [Nicotiana sylvestris]
Length=570

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 88/111 (79%), Gaps = 9/111 (8%)
 Frame = +1

Query  430  MNRSFRAEESLTKQR---MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MNRSFRAEES  +QR   MGS+RSS     DEEL LFLEMRRREKERN+ L LQ  DEFD
Sbjct  1    MNRSFRAEESGQRQRQQLMGSIRSS-----DEELSLFLEMRRREKERNNNLFLQKPDEFD  55

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             PLGS  G+SP FNI SA P R++ ADDFLN++NDK+DYDWLLTPPGTPLF
Sbjct  56   -PLGSKNGTSPAFNIASAAPVRRSRADDFLNADNDKSDYDWLLTPPGTPLF  105



>ref|XP_009791269.1| PREDICTED: mucin-5AC-like isoform X2 [Nicotiana sylvestris]
Length=575

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 88/111 (79%), Gaps = 7/111 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQ---RMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            MN SFRAEES  +Q   +MGS R+S++KEK+EEL LFLEMRRREK+RNDLLL QN DEFD
Sbjct  1    MNGSFRAEESAMRQLQQQMGSFRNSVMKEKEEELALFLEMRRREKDRNDLLLFQNGDEFD  60

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            A L    G SP+FNI SA   RK  ADDFLN+ENDKNDY+WLLTPP TPLF
Sbjct  61   AQL----GGSPLFNIGSATTVRKNGADDFLNAENDKNDYEWLLTPPSTPLF  107



>gb|KDO69020.1| hypothetical protein CISIN_1g040479mg [Citrus sinensis]
Length=185

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 91/114 (80%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEE-----SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRS R++E     +  KQR   LR+SM+KEKDEEL LFLEMR+REKE+  +LLL NS+E
Sbjct  1    MNRSLRSQEMQMQAAALKQRQ-QLRASMMKEKDEELSLFLEMRKREKEQG-ILLLNNSEE  58

Query  595  FDAPLGSNTGSSPVFNIPSAMPA-RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPLGS  G+SP+FNI S+  A RK  ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  59   FDAPLGSRPGTSPIFNISSSNAATRKIGADDFLNSDNDKNDYDWLLTPPGTPLF  112



>ref|XP_010923060.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010923061.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010923062.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
Length=542

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 85/113 (75%), Gaps = 5/113 (4%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRM-----GSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA E+   Q       G    +++K+KDE+L LFLEMR+REKERNDLLLL NSDE
Sbjct  1    MNRSFRAPEAPQTQAATTMTRGRTLGAVMKDKDEDLALFLEMRKREKERNDLLLLHNSDE  60

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             D PLGS  GS+P+F I  + PARK   DDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  61   LDPPLGSKPGSAPIFKIVPSAPARKAGVDDFLNSDNDKNDYDWLLTPPGTPLF  113



>ref|XP_003538456.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
Length=614

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 10/117 (9%)
 Frame = +1

Query  430  MNRSFRAEESLT-------KQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA+ES         +Q+ G LR+S++KEK+EEL LFLEM++REKERNDLLL  +S
Sbjct  1    MNRSFRAQESQMHAALKQREQQFGGLRTSVMKEKEEELALFLEMKKREKERNDLLL-NSS  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDA L SN G++P+FNI S+ PA  RKT  DDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   EEFDAALVSNGGANPIFNISSSTPAPVRKTGVDDFLNSENDKNDYDWLLTPPGTPLF  116



>ref|XP_007009023.1| Uncharacterized protein TCM_042539 [Theobroma cacao]
 gb|EOY17833.1| Uncharacterized protein TCM_042539 [Theobroma cacao]
Length=591

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 11/118 (9%)
 Frame = +1

Query  430  MNRSFRAEE------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA++      +  KQR   LR+SM+KEK+EEL LFLEMR+REKE+++LLL  +S+
Sbjct  1    MNRSFRAQQETAMQAAALKQRQ-QLRASMMKEKEEELALFLEMRKREKEQSNLLLNHSSE  59

Query  592  EFDAPLGSNTGSSPVFNI--PSAMPARKTV--ADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FDAPLGS  G+SP+FN+   +A PARKTV  ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  60   DFDAPLGSKPGTSPIFNLSASTATPARKTVAAADDFLNSDNDKNDYDWLLTPPGTPLF  117



>gb|KHN34732.1| hypothetical protein glysoja_039028 [Glycine soja]
Length=619

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 10/117 (9%)
 Frame = +1

Query  430  MNRSFRAEESLT-------KQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA+ES         +Q+ G LR+S++KEK+EEL LFLEM++REKERNDLLL  +S
Sbjct  1    MNRSFRAQESQMHAALKQREQQFGGLRTSVMKEKEEELALFLEMKKREKERNDLLL-NSS  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDA L SN G++P+FNI S+ PA  RKT  DDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   EEFDAALVSNGGANPIFNISSSTPAPVRKTGVDDFLNSENDKNDYDWLLTPPGTPLF  116



>ref|NP_181536.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AAZ23924.1| At2g40070 [Arabidopsis thaliana]
 dbj|BAE98974.1| En/Spm-like transposon protein [Arabidopsis thaliana]
 gb|AEC09771.1| uncharacterized protein AT2G40070 [Arabidopsis thaliana]
Length=607

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +1

Query  430  MNRSFRAEESL-----TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ESL      +QR   LR+SM+ EKDEEL LFLEMRRREKE+++LLL  N DE
Sbjct  1    MNRSFRAKESLLLDSAERQRQ-QLRASMMAEKDEELSLFLEMRRREKEQDNLLLNNNPDE  59

Query  595  FDAPLGSNTGSSPVFNIPS-AMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            F+ PLGS  G+SPVFNI S A P+RK   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   FETPLGSKHGTSPVFNISSGAPPSRKAAPDDFLNSEGDKNDYEWLLTPPGTPLF  113



>gb|EYU20023.1| hypothetical protein MIMGU_mgv1a003450mg [Erythranthe guttata]
Length=584

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 87/110 (79%), Gaps = 7/110 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRSFRA E   + +MGSLR      KDE+L LF EMR+REKERN+LLLLQ SDEFDAPL
Sbjct  1    MNRSFRAPE---RGQMGSLR--FKDNKDEDLALFREMRKREKERNNLLLLQTSDEFDAPL  55

Query  610  GSNTGSSPVFNIPSAM--PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            G  TGSSP+FNI +    PARKT  D+FLNS+NDKNDYDWLLTPPGTPLF
Sbjct  56   GQRTGSSPIFNITAGTPAPARKTGTDEFLNSDNDKNDYDWLLTPPGTPLF  105



>ref|XP_010067518.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Eucalyptus 
grandis]
 gb|KCW65668.1| hypothetical protein EUGRSUZ_G03055 [Eucalyptus grandis]
Length=557

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 6/109 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRSFRA+ES     +G  +  M++EK+E+L LFLEMR+REKERNDLLL  N++EFDAPL
Sbjct  1    MNRSFRAQES---HMLGHRQQQMMREKEEDLALFLEMRKREKERNDLLL-NNAEEFDAPL  56

Query  610  GSNTGSSPVFNI-PSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            GS  G+SP+FNI PSA P RKT  DDFLNS++DKNDYDWLLTPPGTPLF
Sbjct  57   GSKPGTSPIFNIAPSAAP-RKTATDDFLNSDSDKNDYDWLLTPPGTPLF  104



>ref|XP_011016321.1| PREDICTED: zonadhesin-like isoform X2 [Populus euphratica]
Length=563

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA++S     + KQR   LR++M+KEK+EEL LFLEM++REKE+N+L L+ N+ +
Sbjct  1    MNRSFRAQDSQMQAAVVKQRQ-QLRATMMKEKEEELALFLEMKKREKEQNNLFLINNTAD  59

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             +AP GS  G+SP+ NI S+ PARKT ADDFLNSENDK+DYDWLLTPPGTPLF
Sbjct  60   SEAPFGSRHGNSPMLNISSSTPARKTGADDFLNSENDKHDYDWLLTPPGTPLF  112



>ref|XP_008362728.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Malus 
domestica]
Length=595

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 96/115 (83%), Gaps = 9/115 (8%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA++S    + KQR   LR+S++KEK+EEL LFLEM++REKERNDLLL  +S+EF
Sbjct  1    MNRSFRAQDSQMQAMIKQRQ-QLRASVMKEKEEELALFLEMKKREKERNDLLL-NSSEEF  58

Query  598  DAPL-GSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            D+PL G+  G+SP+F+I S+ PA  RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  59   DSPLAGAKPGTSPIFSISSSTPAPPRKTGADDFLNSENDKNDYDWLLTPPGTPLF  113



>ref|XP_009344713.1| PREDICTED: mucin-5AC-like isoform X1 [Pyrus x bretschneideri]
Length=589

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 9/115 (8%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA++S    + KQR   LR S+ KEK+EEL LFLEM++REKERNDLLL  +S+EF
Sbjct  1    MNRSFRAQDSQMQAMIKQRQ-QLRVSVRKEKEEELALFLEMKKREKERNDLLL-NSSEEF  58

Query  598  DAPL-GSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            D+PL G+  G+SPVFNI S+ PA  RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  59   DSPLAGAKPGTSPVFNISSSTPAPPRKTGADDFLNSENDKNDYDWLLTPPGTPLF  113



>ref|XP_009143258.1| PREDICTED: endochitinase A-like [Brassica rapa]
Length=604

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 90/115 (78%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ES       +QR   LR+SM+ EKDEEL LFLEMRRREKE++ LLL  N DE
Sbjct  1    MNRSFRAQESRLLDSAARQRQ-QLRASMMAEKDEELSLFLEMRRREKEQDSLLLNNNPDE  59

Query  595  FDAPLGSNTGSSPVFNIPS-AMPARKT-VADDFLNSENDKNDYDWLLTPPGTPLF  753
            F++PLGS  G+SPVFNI S A PARKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   FESPLGSKPGTSPVFNISSGAAPARKTGPPDDFLNSEGDKNDYEWLLTPPGTPLF  114



>ref|XP_007163529.1| hypothetical protein PHAVU_001G241800g [Phaseolus vulgaris]
 gb|ESW35523.1| hypothetical protein PHAVU_001G241800g [Phaseolus vulgaris]
Length=595

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 93/117 (79%), Gaps = 10/117 (9%)
 Frame = +1

Query  430  MNRSFRAEESLT-------KQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA+ES         +Q+ G  R+S++KEK+EEL LFLEM++REKER+DLLL   S
Sbjct  1    MNRSFRAQESQMHSALKRREQQFGGFRASVMKEKEEELALFLEMKKREKERSDLLL-NGS  59

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EFDAPLGSN  ++P+F+I S+ PA  RKT  D+FLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   EEFDAPLGSNASANPIFSISSSTPAPVRKTGVDEFLNSENDKNDYDWLLTPPGTPLF  116



>gb|KEH34783.1| ATP-binding protein, putative [Medicago truncatula]
Length=628

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 90/117 (77%), Gaps = 10/117 (9%)
 Frame = +1

Query  430  MNRSFRAEESLTK------QRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA+ES  +      Q+ G L  S   EKDEEL LFLEMR+REKERNDLLL   S+
Sbjct  1    MNRSFRAQESSMQGGFKREQQFGGLMGSGTTEKDEELALFLEMRKREKERNDLLL-HTSE  59

Query  592  EFDAPLGSNTGSSPVFNIPSAMP---ARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            EFD+ LGSN G+SP+FNI S+MP    RK+ AD+FLNSEN+KNDYDWLLTPPGTPLF
Sbjct  60   EFDSALGSNPGTSPLFNISSSMPTAPVRKSGADEFLNSENNKNDYDWLLTPPGTPLF  116



>ref|XP_006411252.1| hypothetical protein EUTSA_v10016404mg [Eutrema salsugineum]
 gb|ESQ52705.1| hypothetical protein EUTSA_v10016404mg [Eutrema salsugineum]
Length=603

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 88/114 (77%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEESL-----TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ESL      +QR   LR+SM+ EKDEEL LFLEMRRREKE+ D LLL N DE
Sbjct  1    MNRSFRAQESLLLDSAERQRQ-QLRASMMAEKDEELSLFLEMRRREKEQ-DNLLLNNPDE  58

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVA-DDFLNSENDKNDYDWLLTPPGTPLF  753
            F+ P GS  G+SPVFN+ S  PARKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  59   FETPSGSKPGTSPVFNLSSGAPARKTAPPDDFLNSEGDKNDYEWLLTPPGTPLF  112



>emb|CDY20509.1| BnaC04g05350D [Brassica napus]
Length=601

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 89/116 (77%), Gaps = 9/116 (8%)
 Frame = +1

Query  430  MNRSFRAEES------LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA+ES        +QR   LR+SM+ EKDEEL LFLEMRRREKE++ LLL  N D
Sbjct  1    MNRSFRAQESSLLLDSAARQRQ-QLRASMMAEKDEELSLFLEMRRREKEQDSLLLNNNPD  59

Query  592  EFDAPLGSNTGSSPVFNIPSA-MPARKT-VADDFLNSENDKNDYDWLLTPPGTPLF  753
            EF++PLGS  G+SPVFNI S   PARKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   EFESPLGSKPGTSPVFNISSGPAPARKTGPPDDFLNSEGDKNDYEWLLTPPGTPLF  115



>ref|XP_010517399.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=607

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEESL-----TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ESL      +QR   LR+S++ EKDEEL +FLEMRRREKE+ +LLL  N DE
Sbjct  1    MNRSFRAKESLLLDSAERQRQ-QLRASLMAEKDEELSMFLEMRRREKEQENLLLNNNPDE  59

Query  595  FDAPLGSNTGSSPVFNIPS-AMPARKTVA-DDFLNSENDKNDYDWLLTPPGTPLF  753
            FD+PLGS  G+SPVFNI S A P RKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   FDSPLGSKPGTSPVFNISSGAPPPRKTATPDDFLNSEGDKNDYEWLLTPPGTPLF  114



>ref|XP_010508921.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Camelina 
sativa]
 ref|XP_010508922.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Camelina 
sativa]
Length=607

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEESL-----TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ESL      +QR   LR+S++ EKDEEL +FLEMRRREKE+ +LLL  N DE
Sbjct  1    MNRSFRAKESLLLDSAERQRQ-QLRASLMAEKDEELSMFLEMRRREKEQENLLLNNNPDE  59

Query  595  FDAPLGSNTGSSPVFNIP-SAMPARKTVA-DDFLNSENDKNDYDWLLTPPGTPLF  753
            FD+PLGS  G+SPVFNI   A P RKT A DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   FDSPLGSKPGTSPVFNISGGAPPPRKTAAPDDFLNSEGDKNDYEWLLTPPGTPLF  114



>ref|XP_008785362.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
 ref|XP_008785363.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
Length=542

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLR----SSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            M+RSFRA E+   Q   + R    ++++K+KD++L LFLEMR+REKERNDLLLL NSDE 
Sbjct  1    MHRSFRAPEAPRTQAATTTRGRTLAAVMKDKDDDLALFLEMRKREKERNDLLLLYNSDEL  60

Query  598  DAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            D PLGS  GS+P+F I  + PARK   DDFLNS+ DKNDYDWLLTPPGTPLF
Sbjct  61   DPPLGSKPGSAPIFKIVPSAPARKAGVDDFLNSDGDKNDYDWLLTPPGTPLF  112



>ref|XP_008795443.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Phoenix dactylifera]
Length=529

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +1

Query  430  MNRSFRAEES----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA E+      +   G    +++K+KDE+L LFLEMR+REKERNDLLLL NS+E 
Sbjct  1    MNRSFRAPEAPQPKAARTTRGRTLGAVMKDKDEDLALFLEMRKREKERNDLLLLHNSEEL  60

Query  598  DAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            D PLGS  GS+P+F I  + PARK   DDFLNS++DKNDYDWLLTPPGTPLF
Sbjct  61   DLPLGSKPGSAPIFKIVPSAPARKAGVDDFLNSDSDKNDYDWLLTPPGTPLF  112



>ref|XP_010910088.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
 ref|XP_010910089.1| PREDICTED: endochitinase A-like [Elaeis guineensis]
Length=529

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRS----SMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEF  597
            MNRSFRA E+   Q   + R     +++K++DE+L LFLEMR+REKERNDLLLL NS+E 
Sbjct  1    MNRSFRAPEAPQPQATMTTRGRTLGAVMKDRDEDLALFLEMRKREKERNDLLLLHNSEEL  60

Query  598  DAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            D P+GS  GS+P+F I  + PARK   DDFLNS++DKNDYDWLLTPPGTPLF
Sbjct  61   DPPIGSKPGSAPIFKIVPSAPARKAGVDDFLNSDSDKNDYDWLLTPPGTPLF  112



>ref|XP_011016320.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Populus euphratica]
Length=564

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 92/114 (81%), Gaps = 7/114 (6%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA++S     + KQR   LR++M+KEK+EEL LFLEM++REKE+N+L L+ N+ +
Sbjct  1    MNRSFRAQDSQMQAAVVKQRQ-QLRATMMKEKEEELALFLEMKKREKEQNNLFLINNTAD  59

Query  595  FDAPLG-SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             +AP G S  G+SP+ NI S+ PARKT ADDFLNSENDK+DYDWLLTPPGTPLF
Sbjct  60   SEAPFGRSRHGNSPMLNISSSTPARKTGADDFLNSENDKHDYDWLLTPPGTPLF  113



>ref|XP_006435712.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
 ref|XP_006486333.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Citrus 
sinensis]
 gb|ESR48952.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
Length=600

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +1

Query  430  MNRSFRAEE-----SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRS R++E     +  KQR   LR+SM+KEKDEEL LFLEMR+REKE+ +LLL  + +E
Sbjct  1    MNRSLRSQEMQMQAAALKQRQ-QLRASMMKEKDEELSLFLEMRKREKEQGNLLLNNSEEE  59

Query  595  FDAPLGSNTGSSPVFNIPSAMPA-RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPLGS  G+SP+FNI S+  A RK  ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  60   FDAPLGSRPGTSPIFNISSSNAATRKIGADDFLNSDNDKNDYDWLLTPPGTPLF  113



>ref|XP_010535052.1| PREDICTED: mucin-17 [Tarenaya hassleriana]
Length=581

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ES     + +QR   LR+SM+ EK+EEL LFLEMRRREKE+ D LLL N +E
Sbjct  1    MNRSFRAQESPMFDSVERQRQ-QLRASMMAEKEEELALFLEMRRREKEQ-DNLLLNNPEE  58

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVA-DDFLNSENDKNDYDWLLTPPGTPLF  753
            F+ PLGS  G+SPVFNI  A PARK  A DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  59   FETPLGSKPGTSPVFNISMAKPARKMAAPDDFLNSEGDKNDYEWLLTPPGTPLF  112



>ref|XP_006435713.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
 ref|XP_006486332.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Citrus 
sinensis]
 gb|ESR48953.1| hypothetical protein CICLE_v10030993mg [Citrus clementina]
Length=609

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +1

Query  430  MNRSFRAEE-----SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRS R++E     +  KQR   LR+SM+KEKDEEL LFLEMR+REKE+ +LLL  + +E
Sbjct  1    MNRSLRSQEMQMQAAALKQRQ-QLRASMMKEKDEELSLFLEMRKREKEQGNLLLNNSEEE  59

Query  595  FDAPLGSNTGSSPVFNIPSAMPA-RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            FDAPLGS  G+SP+FNI S+  A RK  ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  60   FDAPLGSRPGTSPIFNISSSNAATRKIGADDFLNSDNDKNDYDWLLTPPGTPLF  113



>gb|KJB76178.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=492

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 11/118 (9%)
 Frame = +1

Query  430  MNRSFRAEE------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA++      ++ KQR   LR+SM+KEK+EEL LFLEMR+REKE++DLLL  + +
Sbjct  1    MNRSFRAQQETAMQAAVLKQRQ-QLRASMMKEKEEELALFLEMRKREKEQSDLLLNHSYE  59

Query  592  EFDAPLGSNTGSSPVFNI--PSAMPARK--TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FDAPLGS  G+SP+FN+   +A P RK    ADDFLNS+ DKNDYDWLLTPPGTPLF
Sbjct  60   DFDAPLGSKPGTSPIFNLSASTATPPRKAAAAADDFLNSDGDKNDYDWLLTPPGTPLF  117



>ref|XP_010505709.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=607

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEESL-----TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSF A+ESL      +QR   LR+S++ EKDEEL +FLEMRRREKE+ +LLL  N DE
Sbjct  1    MNRSFSAKESLLLDSAERQRQ-QLRASLMAEKDEELSMFLEMRRREKEQENLLLNNNPDE  59

Query  595  FDAPLGSNTGSSPVFNIPS-AMPARKTVA-DDFLNSENDKNDYDWLLTPPGTPLF  753
            FD+PLGS  G+SPVFNI S A P RKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   FDSPLGSKPGTSPVFNISSGAPPPRKTATPDDFLNSEGDKNDYEWLLTPPGTPLF  114



>ref|XP_010689824.1| PREDICTED: cell wall protein RBR3 [Beta vulgaris subsp. vulgaris]
Length=612

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 88/114 (77%), Gaps = 8/114 (7%)
 Frame = +1

Query  430  MNRSFRAEESLTKQ------RMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFR  E+L         ++ SL SS ++EK+++L LFLEMR+REK++NDLLLLQ++D
Sbjct  1    MNRSFRGPETLMPSIRPRVPQLKSLHSSTMREKEDDLALFLEMRKREKDKNDLLLLQDAD  60

Query  592  EFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            E D  L S  GSSP+FNIPSA PARKT  DDFLN E +KNDYDWLLTPPGTPLF
Sbjct  61   ELDDSLVSQPGSSPLFNIPSATPARKT--DDFLNGEGEKNDYDWLLTPPGTPLF  112



>gb|KJB76173.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=573

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 11/118 (9%)
 Frame = +1

Query  430  MNRSFRAEE------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA++      ++ KQR   LR+SM+KEK+EEL LFLEMR+REKE++DLLL  + +
Sbjct  1    MNRSFRAQQETAMQAAVLKQRQ-QLRASMMKEKEEELALFLEMRKREKEQSDLLLNHSYE  59

Query  592  EFDAPLGSNTGSSPVFNI--PSAMPARK--TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FDAPLGS  G+SP+FN+   +A P RK    ADDFLNS+ DKNDYDWLLTPPGTPLF
Sbjct  60   DFDAPLGSKPGTSPIFNLSASTATPPRKAAAAADDFLNSDGDKNDYDWLLTPPGTPLF  117



>gb|KHG16426.1| hypothetical protein F383_23799 [Gossypium arboreum]
Length=574

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 11/118 (9%)
 Frame = +1

Query  430  MNRSFRAEE------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA++      ++ KQR   LR+SM+KEK+EEL LFLEMR+REKE++DLLL  + +
Sbjct  1    MNRSFRAQQETAMQAAVLKQRQ-QLRASMMKEKEEELALFLEMRKREKEQSDLLLNHSYE  59

Query  592  EFDAPLGSNTGSSPVFNIPSA--MPARK--TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FDAPLGS  G+SP+FN+ ++   P RK    ADDFLNS+ DKNDYDWLLTPPGTPLF
Sbjct  60   DFDAPLGSKPGTSPIFNLSASTTTPPRKAAAAADDFLNSDGDKNDYDWLLTPPGTPLF  117



>ref|XP_006575535.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Glycine 
max]
Length=692

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 94/121 (78%), Gaps = 14/121 (12%)
 Frame = +1

Query  430  MNRSFRAEESLT----KQR---MGSLRSSM--IKEKDEELGLFLEMRRREKERNDLLLLQ  582
            MNRSFRA ES      KQR   +G+LRSS   + ++D+EL LFLEMR REKERNDLL  +
Sbjct  1    MNRSFRAPESQMQDAFKQRQHQLGTLRSSSPRVMDRDDELALFLEMRNREKERNDLLR-R  59

Query  583  NSDEFDA--PLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPL  750
             +++FDA  PLGSN G+S +FN+PSA PA  RKT ADDFLNSENDKNDYDWLLTPPGTPL
Sbjct  60   AAEDFDAAAPLGSNPGNSTLFNVPSAAPAQARKTGADDFLNSENDKNDYDWLLTPPGTPL  119

Query  751  F  753
            F
Sbjct  120  F  120



>ref|XP_009133405.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Brassica 
rapa]
Length=609

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 11/119 (9%)
 Frame = +1

Query  430  MNRSFRAEESLT--------KQRMGSLRSSMIKEKDEELGLFLEMRRREKER-NDLLLLQ  582
            MNRSFRA+ES +        +Q+   LR+SM+ EKDEEL LFLEMRRREKE+ N LLL  
Sbjct  1    MNRSFRAQESSSSLLMDSAERQQRQQLRASMMAEKDEELSLFLEMRRREKEQDNSLLLNN  60

Query  583  NSDEFDAPLGSNTGSSPVFNIPSAM-PARKT-VADDFLNSENDKNDYDWLLTPPGTPLF  753
            N  EFD PLGS  G+SPVFN+ S   PARKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  61   NPHEFDTPLGSKPGTSPVFNLSSGGGPARKTGPPDDFLNSEGDKNDYEWLLTPPGTPLF  119



>emb|CDY07628.1| BnaA03g18830D [Brassica napus]
Length=609

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 11/119 (9%)
 Frame = +1

Query  430  MNRSFRAEESLT--------KQRMGSLRSSMIKEKDEELGLFLEMRRREKER-NDLLLLQ  582
            MNRSFRA+ES +        +Q+   LR+SM+ EKDEEL LFLEMRRREKE+ N LLL  
Sbjct  1    MNRSFRAQESSSSLLMDSAERQQRQQLRASMMAEKDEELSLFLEMRRREKEQDNSLLLNN  60

Query  583  NSDEFDAPLGSNTGSSPVFNIPSAM-PARKT-VADDFLNSENDKNDYDWLLTPPGTPLF  753
            N  EFD PLGS  G+SPVFN+ S   PARKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  61   NPHEFDTPLGSKPGTSPVFNLSSGGGPARKTGPPDDFLNSEGDKNDYEWLLTPPGTPLF  119



>gb|KDP44785.1| hypothetical protein JCGZ_01285 [Jatropha curcas]
Length=547

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 4/98 (4%)
 Frame = +1

Query  466  KQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNI  645
            KQR   LR+SM+KEK+EEL LFLEM++REKE+N+LLL  NS+EFDAPLGS  G+SP+FNI
Sbjct  7    KQRQ-QLRASMMKEKEEELALFLEMKKREKEQNNLLL-NNSEEFDAPLGSKPGTSPIFNI  64

Query  646  PS-AMPARKTV-ADDFLNSENDKNDYDWLLTPPGTPLF  753
             S A PARK   ADDFLNS+NDKNDYDWLLTPPGTPLF
Sbjct  65   SSTATPARKASGADDFLNSDNDKNDYDWLLTPPGTPLF  102



>emb|CDY60338.1| BnaC03g72310D [Brassica napus]
Length=610

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 11/119 (9%)
 Frame = +1

Query  430  MNRSFRAEESLT--------KQRMGSLRSSMIKEKDEELGLFLEMRRREKER-NDLLLLQ  582
            MNRSFRA+ES +        +Q+   LR+SM+ EKDEEL LFLEMRRREKE+ N LLL  
Sbjct  1    MNRSFRAQESSSSLLLDSAERQQRQQLRASMMAEKDEELSLFLEMRRREKEQDNSLLLNN  60

Query  583  NSDEFDAPLGSNTGSSPVFNIPSAM-PARKT-VADDFLNSENDKNDYDWLLTPPGTPLF  753
            N  EFD PLGS  G+SPVFN+ S   PARKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  61   NPHEFDTPLGSKPGTSPVFNLSSGGGPARKTGPPDDFLNSEGDKNDYEWLLTPPGTPLF  119



>ref|XP_002526897.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35528.1| ATP binding protein, putative [Ricinus communis]
Length=568

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 92/120 (77%), Gaps = 13/120 (11%)
 Frame = +1

Query  430  MNRSFRAEE--------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKER-NDLLLLQ  582
            MNRSFR+ +        +  KQR   LR+SM+KEK+EEL LFLEM++REKE+ N LLL  
Sbjct  1    MNRSFRSSQESQMKMAAAAVKQRQ-QLRASMMKEKEEELALFLEMKKREKEQQNHLLLFN  59

Query  583  NS-DEFDAPLGSNTGSSPVFNIPSAM-PARK-TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            N+ D+FDAPLGS  G+SP+FNI S   PARK + ADDFLNSENDKNDY+WLLTPPGTPLF
Sbjct  60   NTEDDFDAPLGSKPGTSPIFNISSTTTPARKVSGADDFLNSENDKNDYEWLLTPPGTPLF  119



>ref|XP_006293855.1| hypothetical protein CARUB_v10022840mg [Capsella rubella]
 gb|EOA26753.1| hypothetical protein CARUB_v10022840mg [Capsella rubella]
Length=607

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 87/115 (76%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEESL-----TKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA+ESL      +QR   LR+SM+ EKDEEL LFLEMRRREKE+++LLL  N DE
Sbjct  1    MNRSFRAKESLLLDSAERQRQ-QLRASMMAEKDEELSLFLEMRRREKEQDNLLLNNNPDE  59

Query  595  FDAPLGSNTGSSPVFNIPSA--MPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            F+ PLGS  G+SPVFNI S    P +    DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   FETPLGSKHGTSPVFNISSGAPPPRKAAAPDDFLNSEGDKNDYEWLLTPPGTPLF  114



>ref|XP_007141776.1| hypothetical protein PHAVU_008G224800g [Phaseolus vulgaris]
 gb|ESW13770.1| hypothetical protein PHAVU_008G224800g [Phaseolus vulgaris]
Length=627

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 94/120 (78%), Gaps = 13/120 (11%)
 Frame = +1

Query  430  MNRSFRAEES-------LTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQN  585
            MNRSF A ES         +Q++G+LRSS+  K++D+EL LFLEMR REKER DL+L + 
Sbjct  1    MNRSFIAPESKMQDAFKQRQQQLGALRSSVRAKDRDDELALFLEMRNREKERGDLVL-RA  59

Query  586  SDEFD--APLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +++FD  A LGSN G+SP+FN+PS+M A  RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  60   AEDFDGAAALGSNLGNSPLFNVPSSMAALVRKTGADDFLNSENDKNDYDWLLTPPGTPLF  119



>ref|XP_006595867.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Glycine 
max]
Length=668

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 14/121 (12%)
 Frame = +1

Query  430  MNRSFRAEE-------SLTKQRMGSLRSSM--IKEKDEELGLFLEMRRREKERNDLLLLQ  582
            MNRSFRA E       +  + ++ +LRSS   + ++D+EL LFLEMR REKERNDLLL +
Sbjct  1    MNRSFRAVELQMQDAFNQRRHQLAALRSSSPRVMDRDDELALFLEMRNREKERNDLLL-R  59

Query  583  NSDEFDA--PLGSNTGSSPVFNIPSAM--PARKTVADDFLNSENDKNDYDWLLTPPGTPL  750
             +++FDA  PLGS+ G+SP+FN+P A   PARKT ADDFLNSENDKNDYDWLLTPPGTPL
Sbjct  60   AAEDFDAAAPLGSDPGNSPLFNVPPAASAPARKTGADDFLNSENDKNDYDWLLTPPGTPL  119

Query  751  F  753
            F
Sbjct  120  F  120



>gb|KFK36895.1| hypothetical protein AALP_AA4G186400 [Arabis alpina]
Length=607

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 88/115 (77%), Gaps = 8/115 (7%)
 Frame = +1

Query  430  MNRSFRAEESL----TKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFR +ESL     +++   LR+SM+  +KDEEL LFLEMRRREKE+ D LLL N DE
Sbjct  1    MNRSFRGKESLLLDSAERQRKQLRASMMMADKDEELSLFLEMRRREKEQ-DNLLLNNPDE  59

Query  595  FDAPLGSNTGSSPVFNIPS-AMPARKTVA-DDFLNSENDKNDYDWLLTPPGTPLF  753
            F+ PLGS  G+SPVFNI S   PARK  A DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  60   FETPLGSKPGTSPVFNISSDGAPARKAAAPDDFLNSEGDKNDYEWLLTPPGTPLF  114



>gb|KHN20852.1| hypothetical protein glysoja_009160 [Glycine soja]
Length=668

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 93/121 (77%), Gaps = 14/121 (12%)
 Frame = +1

Query  430  MNRSFRAEE-------SLTKQRMGSLRSSM--IKEKDEELGLFLEMRRREKERNDLLLLQ  582
            MNRSFRA E       +  + ++ +LRSS   + ++D+EL LFLEMR REKERN+LLL +
Sbjct  1    MNRSFRAVELQMQDAFNQRRHQLAALRSSSPRVMDRDDELALFLEMRNREKERNNLLL-R  59

Query  583  NSDEFDA--PLGSNTGSSPVFNIPSAM--PARKTVADDFLNSENDKNDYDWLLTPPGTPL  750
             +++FDA  PLGS+ G+SP+FN+P A   PARKT ADDFLNSENDKNDYDWLLTPPGTPL
Sbjct  60   AAEDFDAAAPLGSDPGNSPLFNVPPAASAPARKTGADDFLNSENDKNDYDWLLTPPGTPL  119

Query  751  F  753
            F
Sbjct  120  F  120



>ref|XP_010534575.1| PREDICTED: mucin-17-like [Tarenaya hassleriana]
Length=586

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 9/114 (8%)
 Frame = +1

Query  430  MNRSFRAEESLT-----KQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA++SL      +QR   LR+SM+ EK+EEL LFLEMRRREK+ ++LL   N +E
Sbjct  1    MNRSFRAQDSLMLDSVERQRQ-HLRASMMAEKEEELALFLEMRRREKDHDNLL--NNPEE  57

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVA-DDFLNSENDKNDYDWLLTPPGTPLF  753
            F+ PLGS  G+SP+F+I  A PA K  A DDFL SE DKNDY+WLLTPPGTPLF
Sbjct  58   FETPLGSKPGTSPMFHISMAKPAHKKAAPDDFLESEGDKNDYEWLLTPPGTPLF  111



>gb|AAB95292.1| En/Spm-like transposon protein [Arabidopsis thaliana]
Length=510

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPS-AMPARKTV  675
            + EKDEEL LFLEMRRREKE+++LLL  N DEF+ PLGS  G+SPVFNI S A P+RK  
Sbjct  1    MAEKDEELSLFLEMRRREKEQDNLLLNNNPDEFETPLGSKHGTSPVFNISSGAPPSRKAA  60

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
             DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  61   PDDFLNSEGDKNDYEWLLTPPGTPLF  86



>ref|XP_006575536.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Glycine 
max]
Length=681

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 7/102 (7%)
 Frame = +1

Query  466  KQRMGSLRSSM--IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDA--PLGSNTGSSP  633
            + ++G+LRSS   + ++D+EL LFLEMR REKERNDLL  + +++FDA  PLGSN G+S 
Sbjct  9    QHQLGTLRSSSPRVMDRDDELALFLEMRNREKERNDLLR-RAAEDFDAAAPLGSNPGNST  67

Query  634  VFNIPSAMPA--RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FN+PSA PA  RKT ADDFLNSENDKNDYDWLLTPPGTPLF
Sbjct  68   LFNVPSAAPAQARKTGADDFLNSENDKNDYDWLLTPPGTPLF  109



>gb|KHF99477.1| Low-density lipoprotein receptor-related [Gossypium arboreum]
 gb|KHG03855.1| Low-density lipoprotein receptor-related [Gossypium arboreum]
Length=584

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 12/118 (10%)
 Frame = +1

Query  430  MNRSFRAEE------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA++      +  KQR   LR+SM+K+K+EEL LFLEMR+REKE++  L    S+
Sbjct  1    MNRSFRAQQETAMQTAALKQRQ-QLRASMMKDKEEELALFLEMRKREKEQSSFLN-HCSE  58

Query  592  EFDAPLGSNTGSSPVFNIPSAM--PARK--TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FDAPLGS  G+SP+FN+ ++   PARK    ADDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  59   DFDAPLGSKPGTSPIFNLSASATAPARKMGGAADDFLNSECDKNDYEWLLTPPGTPLF  116



>gb|KJB74298.1| hypothetical protein B456_011G285700 [Gossypium raimondii]
Length=583

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 90/118 (76%), Gaps = 12/118 (10%)
 Frame = +1

Query  430  MNRSFRAEE------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA++      +  KQR   LR+SM+K+K+EEL LFLEMR+REKE++  L    S+
Sbjct  1    MNRSFRAQQETAMQTAALKQRQ-QLRASMMKDKEEELALFLEMRKREKEQSSFLN-HCSE  58

Query  592  EFDAPLGSNTGSSPVFNIPSAM--PARK--TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FDAPLGS  G+SP+FN+ ++   PARK    ADDFLNSE+DKNDY+WLLTPPGTPLF
Sbjct  59   DFDAPLGSIPGTSPIFNLSASATAPARKMGGAADDFLNSESDKNDYEWLLTPPGTPLF  116



>ref|XP_006356484.1| PREDICTED: flocculation protein FLO11-like [Solanum tuberosum]
Length=498

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 13/115 (11%)
 Frame = +1

Query  430  MNRSFRAEESLT----KQR---MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRAEESLT    +QR   MGS+RSS     DEEL LFLEMRRRE +RN+   LQ S
Sbjct  1    MNRSFRAEESLTGPGQRQRQPLMGSIRSS-----DEELSLFLEMRRRENDRNNNRFLQKS  55

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DEFD PLGS +GSSP F+I SA P R+T  D+FLN++NDK DYDWLLTPPGTPLF
Sbjct  56   DEFD-PLGSKSGSSPAFDIASAAPMRRTRTDEFLNADNDKTDYDWLLTPPGTPLF  109



>ref|XP_006595866.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Glycine 
max]
Length=678

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 24/131 (18%)
 Frame = +1

Query  430  MNRSFRAEE-------SLTKQRMGSLRSSM--IKEKDEELGLFLEMRRREKERNDLLLLQ  582
            MNRSFRA E       +  + ++ +LRSS   + ++D+EL LFLEMR REKERNDLLL +
Sbjct  1    MNRSFRAVELQMQDAFNQRRHQLAALRSSSPRVMDRDDELALFLEMRNREKERNDLLL-R  59

Query  583  NSDEFDA--PLGSNTGSSPVFNIPSAM--PARKTVADDFLNSENDKNDYDW---------  723
             +++FDA  PLGS+ G+SP+FN+P A   PARKT ADDFLNSENDKNDYDW         
Sbjct  60   AAEDFDAAAPLGSDPGNSPLFNVPPAASAPARKTGADDFLNSENDKNDYDWYYVALFVIG  119

Query  724  -LLTPPGTPLF  753
             LLTPPGTPLF
Sbjct  120  LLLTPPGTPLF  130



>ref|XP_004235247.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Solanum 
lycopersicum]
Length=584

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 86/115 (75%), Gaps = 13/115 (11%)
 Frame = +1

Query  430  MNRSFRAEESL--TKQR-----MGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRAEESL  T QR     MGS+RSS     DEEL LFLEMRRRE +RN+   LQ S
Sbjct  1    MNRSFRAEESLSGTGQRQRQPLMGSIRSS-----DEELSLFLEMRRRENDRNNNRFLQKS  55

Query  589  DEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            DEFD PLGS +GSSP FNI  A P RKT  D+FLN++NDK DYDWLLTPPGTPLF
Sbjct  56   DEFD-PLGSKSGSSPAFNIAPAAPLRKTRTDEFLNADNDKTDYDWLLTPPGTPLF  109



>ref|XP_009412575.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 9/108 (8%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRSFRA  +  +        ++ KE DEEL LFLEMR+ EKERN+LLL   + E D PL
Sbjct  1    MNRSFRAGAATGR--------TVTKEADEELALFLEMRKLEKERNNLLL-HGAGELDPPL  51

Query  610  GSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            G+  G++P+F I S+ PARK   DDFLNS+++KNDYDWLLTPPGTPLF
Sbjct  52   GAKPGTAPIFKIASSAPARKAGIDDFLNSDSEKNDYDWLLTPPGTPLF  99



>ref|XP_006848188.1| hypothetical protein AMTR_s00029p00238480 [Amborella trichopoda]
 gb|ERN09769.1| hypothetical protein AMTR_s00029p00238480 [Amborella trichopoda]
Length=631

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            +NRSFR+ ES   QR G    S++KEKD++L LFLE+R+ EKERN+LLL  NSD+ +  L
Sbjct  2    LNRSFRSSESQL-QRKGRTLGSVMKEKDDDLALFLEVRKHEKERNNLLL-NNSDDLEPLL  59

Query  610  GSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            GS  GSSP+F I S+   RK   DDFLN+++DKNDYDWLLTPPGTPLF
Sbjct  60   GSKPGSSPIFKITSSTTTRKGGPDDFLNADSDKNDYDWLLTPPGTPLF  107



>ref|XP_009419731.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form [Musa acuminata subsp. malaccensis]
Length=519

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 9/108 (8%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNR FR  ++   +R+      + KE DEEL LFLEMR+ EK+RN+LLL  N+ E D P 
Sbjct  1    MNRGFR--DAAAPRRV------VTKEADEELALFLEMRKLEKQRNNLLL-HNAGELDPPF  51

Query  610  GSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            GS  G++P+F + S+ P+RKT  DDFLNS++DKNDYDWLLTPPGTPLF
Sbjct  52   GSKPGTAPIFKVTSSAPSRKTGIDDFLNSDSDKNDYDWLLTPPGTPLF  99



>gb|KJB76179.1| hypothetical protein B456_012G076400 [Gossypium raimondii]
Length=560

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 83/116 (72%), Gaps = 20/116 (17%)
 Frame = +1

Query  430  MNRSFRAEE------SLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSD  591
            MNRSFRA++      ++ KQR   LR+SM+KEK+EEL LFLEMR+REKE++DLLL  + +
Sbjct  1    MNRSFRAQQETAMQAAVLKQRQ-QLRASMMKEKEEELALFLEMRKREKEQSDLLLNHSYE  59

Query  592  EFDAPLGSNTGSSPVFNIPSAMPARK--TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +FDAPL S           +A P RK    ADDFLNS+ DKNDYDWLLTPPGTPLF
Sbjct  60   DFDAPLAS-----------TATPPRKAAAAADDFLNSDGDKNDYDWLLTPPGTPLF  104



>ref|XP_006495301.1| PREDICTED: flocculation protein FLO11-like [Citrus sinensis]
Length=482

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KE+DEEL LFLEMRRREKE+ +LLL  NSD  +AP G+N G SP+  I S++P RKT 
Sbjct  2    VMKERDEELALFLEMRRREKEKTNLLLPLNSDNHNAPSGTNDGGSPISKIVSSVPIRKTA  61

Query  676  ADDFLN--SENDKNDYDWLLTPPGTPLF  753
            A++FLN  SENDK+DYDWLLTPPGTPLF
Sbjct  62   AENFLNSESENDKSDYDWLLTPPGTPLF  89



>gb|EPS71355.1| hypothetical protein M569_03402 [Genlisea aurea]
Length=566

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 8/110 (7%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNR  R  E   + + GSLR      KD++L LF EMR  EKERN +LLLQNSDE DAPL
Sbjct  1    MNRISRVPE---RGKTGSLR--FTDNKDDDLALFREMRNSEKERN-ILLLQNSDELDAPL  54

Query  610  GSNTGSSPVFNIPSAMP--ARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            G+ TGSSP+FN+ +  P    K+V  DF NS+NDKNDYDWLLTPPGTPLF
Sbjct  55   GTKTGSSPIFNLAAEAPPPVPKSVTADFFNSDNDKNDYDWLLTPPGTPLF  104



>gb|KDO47715.1| hypothetical protein CISIN_1g008537mg [Citrus sinensis]
 gb|KDO47716.1| hypothetical protein CISIN_1g008537mg [Citrus sinensis]
Length=562

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KE+DEEL LFLEMRRREKE+ +LLL  NSD  +AP G+N G SP+  I S++P RKT 
Sbjct  2    VMKERDEELALFLEMRRREKEKTNLLLPLNSDNHNAPSGTNDGGSPISKIVSSVPIRKTA  61

Query  676  ADDFLN--SENDKNDYDWLLTPPGTPLF  753
            A++FLN  SENDK+DYDWLLTPPGTPLF
Sbjct  62   AENFLNSESENDKSDYDWLLTPPGTPLF  89



>ref|XP_006429352.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 ref|XP_006429353.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 gb|ESR42592.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
 gb|ESR42593.1| hypothetical protein CICLE_v10011390mg [Citrus clementina]
Length=562

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KE+DEEL LFLEMRRREKE+ +LLL  NSD  +AP G+N G SP+  I S++P RKT 
Sbjct  2    VMKERDEELALFLEMRRREKEKTNLLLPLNSDNHNAPSGTNDGGSPISKIVSSVPIRKTA  61

Query  676  ADDFLN--SENDKNDYDWLLTPPGTPLF  753
            A++FLN  SENDK+DYDWLLTPPGTPLF
Sbjct  62   AENFLNSESENDKSDYDWLLTPPGTPLF  89



>ref|XP_009407548.1| PREDICTED: mucin-1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=528

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRS RA  + +  R      +M K+ DEEL LFLEMR+ EKE+N+LLL  ++ E D PL
Sbjct  1    MNRSLRAAVAPSPGR------TMTKQADEELALFLEMRKLEKEQNNLLL-HSTAELDPPL  53

Query  610  GSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            GS  G++P+F I S+ PAR+    DFLNS+++KNDYDWLLTPPGTPLF
Sbjct  54   GSKPGTAPIFKIASSAPAREAGIGDFLNSDSEKNDYDWLLTPPGTPLF  101



>ref|XP_009407549.1| PREDICTED: mucin-1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=522

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRS RA  + +  R      +M K+ DEEL LFLEMR+ EKE+N+LLL  ++ E D PL
Sbjct  1    MNRSLRAAVAPSPGR------TMTKQADEELALFLEMRKLEKEQNNLLL-HSTAELDPPL  53

Query  610  GSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            GS  G++P+F I S+ PAR+    DFLNS+++KNDYDWLLTPPGTPLF
Sbjct  54   GSKPGTAPIFKIASSAPAREAGIGDFLNSDSEKNDYDWLLTPPGTPLF  101



>dbj|BAH57264.1| AT2G40070 [Arabidopsis thaliana]
Length=575

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +1

Query  520  LGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPS-AMPARKTVADDFLNS  696
            + LFLEMRRREKE+++LLL  N DEF+ PLGS  G+SPVFNI S A P+RK   DDFLNS
Sbjct  3    VSLFLEMRRREKEQDNLLLNNNPDEFETPLGSKHGTSPVFNISSGAPPSRKAAPDDFLNS  62

Query  697  ENDKNDYDWLLTPPGTPLF  753
            E DKNDY+WLLTPPGTPLF
Sbjct  63   EGDKNDYEWLLTPPGTPLF  81



>ref|XP_004490980.1| PREDICTED: flocculation protein FLO11-like [Cicer arietinum]
Length=586

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 83/116 (72%), Gaps = 8/116 (7%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA ES     L ++    L SS + +KD+EL LFL M+  E + +DLLL  +++E
Sbjct  1    MNRSFRATESKMQTALRQRNHQLLPSSFVMDKDDELALFLHMKNCENDCDDLLLRPSTEE  60

Query  595  F-DAPLGSNTGSSPVFNIPSAM--PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            F DA LGSN  +SP+FNI S+   P RKT  DDFLNSE+DKNDYDWLLTPPGTPLF
Sbjct  61   FVDAALGSNPRNSPLFNISSSTHGPVRKTGVDDFLNSESDKNDYDWLLTPPGTPLF  116



>emb|CDX74811.1| BnaA05g05570D [Brassica napus]
Length=588

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 77/115 (67%), Gaps = 23/115 (20%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA ES       +QR   LR+SM+ EKDEEL LFLEMRRREKE++          
Sbjct  1    MNRSFRAHESRLLDSAARQRQ-QLRASMMAEKDEELSLFLEMRRREKEQDS---------  50

Query  595  FDAPLGSNTGSSPVFNIPS-AMPARKT-VADDFLNSENDKNDYDWLLTPPGTPLF  753
                  S  G+SPVFNI S A PARKT   DDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  51   ------SKPGTSPVFNISSGAAPARKTGPPDDFLNSEGDKNDYEWLLTPPGTPLF  99



>ref|XP_009402293.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Musa acuminata subsp. malaccensis]
 ref|XP_009402294.1| PREDICTED: nascent polypeptide-associated complex subunit alpha, 
muscle-specific form-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +1

Query  451  EESLTKQ-RMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGS  627
            EES+ +  R  +  S++ KE DEEL LF+EMR+ EKER DL L  ++ E D PLGS  GS
Sbjct  2    EESMNRSLRRPAPGSTLTKETDEELALFIEMRKLEKERRDLRL-HSTGELDPPLGSKPGS  60

Query  628  SPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +P F I ++ PARK   DDFLNS N KNDYDWLLTPPGTPLF
Sbjct  61   APKFRIGASAPARKAGIDDFLNSNNGKNDYDWLLTPPGTPLF  102



>ref|XP_010654168.1| PREDICTED: zonadhesin-like isoform X1 [Vitis vinifera]
Length=548

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KEKDEEL LFLEMRRREKE+ND LLL++ D   AP GS    SP+  I S+MP RKT 
Sbjct  17   VMKEKDEELLLFLEMRRREKEKNDSLLLESPD---APFGSKPDVSPISKIVSSMPVRKTG  73

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
             D+FL+SEND+ DYDWLLTPPGTPLF
Sbjct  74   PDEFLDSENDRTDYDWLLTPPGTPLF  99



>gb|KHG09845.1| Maturase K [Gossypium arboreum]
Length=568

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 73/100 (73%), Gaps = 14/100 (14%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKER---NDLLLLQNSDE-FDAPLGSNTGS----------SP  633
            ++KE+DEEL LFLEMRRREKE+   N+LL + NS++  + PLGSN             SP
Sbjct  2    VMKERDEELALFLEMRRREKEKEKSNNLLSIHNSEQQLNVPLGSNVKVNGNGNVGGGGSP  61

Query  634  VFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            V  I SA+P RKT AD+FLNSEN+K+DYDWLLTPPGTPLF
Sbjct  62   VSKIVSALPVRKTAADNFLNSENEKSDYDWLLTPPGTPLF  101



>emb|CAN77490.1| hypothetical protein VITISV_010725 [Vitis vinifera]
Length=569

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KEKDEEL LFLEMRRREKE+ND LLL++ D   AP GS    SP+  I S+MP RKT 
Sbjct  17   VMKEKDEELLLFLEMRRREKEKNDSLLLESPD---APFGSKPDVSPISKIVSSMPVRKTG  73

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
             D+ L+SEND+ DYDWLLTPPGTPLF
Sbjct  74   PDELLDSENDRTDYDWLLTPPGTPLF  99



>ref|XP_007026736.1| Uncharacterized protein TCM_021711 [Theobroma cacao]
 gb|EOY07238.1| Uncharacterized protein TCM_021711 [Theobroma cacao]
Length=556

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 73/96 (76%), Gaps = 10/96 (10%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKER---NDLLLLQNSDEFDAPLGSNTGSS-------PVFNI  645
            ++KE+DEEL LFLEMRRREKE+   N+LL L NS++ +APLGSN   +       P+  I
Sbjct  2    VMKERDEELALFLEMRRREKEKEKNNNLLSLHNSEQLNAPLGSNVNVNGNGGGGSPISKI  61

Query  646  PSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             SA+P RKT AD FLNSEN+K+DYDWLLTPPGTPLF
Sbjct  62   VSAVPVRKTAADIFLNSENEKSDYDWLLTPPGTPLF  97



>ref|XP_003623288.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
 gb|AES79506.1| hypothetical protein MTR_7g068220 [Medicago truncatula]
Length=503

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 3/89 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFD-APLGSNTGSSPVFNIPSAMPAR  666
            ++KE+DEEL LFLEMRRREKE  +NDLLLLQNS+E D + L SN  +S +  + S++P +
Sbjct  2    VMKERDEELALFLEMRRREKENEKNDLLLLQNSEELDLSNLESNHENSMISKMVSSVPPK  61

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            KTV ++FLNSENDK+DY+WLLTPP TPLF
Sbjct  62   KTVVEEFLNSENDKSDYEWLLTPPDTPLF  90



>ref|XP_010654169.1| PREDICTED: mucin-12-like isoform X2 [Vitis vinifera]
Length=544

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 9/87 (10%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDE-FDAPLGSNTGSSPVFNIPSAMPARKT  672
            ++KEKDEEL LFLEMRRREKE+ND LLL++ D  FD         SP+  I S+MP RKT
Sbjct  17   VMKEKDEELLLFLEMRRREKEKNDSLLLESPDAPFDV--------SPISKIVSSMPVRKT  68

Query  673  VADDFLNSENDKNDYDWLLTPPGTPLF  753
              D+FL+SEND+ DYDWLLTPPGTPLF
Sbjct  69   GPDEFLDSENDRTDYDWLLTPPGTPLF  95



>ref|NP_001078028.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09772.1| uncharacterized protein AT2G40070 [Arabidopsis thaliana]
Length=567

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  538  MRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPS-AMPARKTVADDFLNSENDKND  714
            MRRREKE+++LLL  N DEF+ PLGS  G+SPVFNI S A P+RK   DDFLNSE DKND
Sbjct  1    MRRREKEQDNLLLNNNPDEFETPLGSKHGTSPVFNISSGAPPSRKAAPDDFLNSEGDKND  60

Query  715  YDWLLTPPGTPLF  753
            Y+WLLTPPGTPLF
Sbjct  61   YEWLLTPPGTPLF  73



>gb|KHN48560.1| hypothetical protein glysoja_034183 [Glycine soja]
Length=635

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 5/76 (7%)
 Frame = +1

Query  538  MRRREKERNDLLLLQNSDEFDA--PLGSNTGSSPVFNIPSAMPA--RKTVADDFLNSEND  705
            MR REKERNDLL  + +++FDA  PLGSN G+S +FN+PSA PA  RKT ADDFLNSEND
Sbjct  1    MRNREKERNDLLR-RAAEDFDAAAPLGSNPGNSTLFNVPSAAPAQARKTGADDFLNSEND  59

Query  706  KNDYDWLLTPPGTPLF  753
            KNDYDWLLTPPGTPLF
Sbjct  60   KNDYDWLLTPPGTPLF  75



>ref|XP_004492428.1| PREDICTED: mucin-5AC-like [Cicer arietinum]
Length=511

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFD-APLGSNTGSSPVFNIPSAMPAR  666
            ++KE+DEEL LFLEMRRREKE  +N+LLLLQNS+E D + L SN  +S +  + S++  R
Sbjct  2    VMKERDEELALFLEMRRREKENEKNNLLLLQNSEELDLSNLESNHENSMISKMVSSVQPR  61

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            KTV ++FLNSENDK+DY+WLLTPP TPLF
Sbjct  62   KTVVEEFLNSENDKSDYEWLLTPPDTPLF  90



>ref|XP_009412573.1| PREDICTED: endochitinase A-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=569

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 80/155 (52%), Gaps = 56/155 (36%)
 Frame = +1

Query  430  MNRSFRAEESLTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL  609
            MNRSFRA  +  +        ++ KE DEEL LFLEMR+ EKERN+LLL   + E D PL
Sbjct  1    MNRSFRAGAATGR--------TVTKEADEELALFLEMRKLEKERNNLLL-HGAGELDPPL  51

Query  610  G------------------------------SNT-----------------GSSPVFNIP  648
            G                              SNT                 G++P+F I 
Sbjct  52   GNVVIRFSFLEEMTSFCSFYPLSAVSCRFLASNTFTLAALFYVSCIVGAKPGTAPIFKIA  111

Query  649  SAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            S+ PARK   DDFLNS+++KNDYDWLLTPPGTPLF
Sbjct  112  SSAPARKAGIDDFLNSDSEKNDYDWLLTPPGTPLF  146



>gb|KJB76928.1| hypothetical protein B456_012G113200 [Gossypium raimondii]
Length=504

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 14/100 (14%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKER---NDLLLLQNSDE-FDAPLGSNTGSS----------P  633
            ++KE+DEEL LFLEMRRREKE+   N+LL +  S++  + PLGSN   +          P
Sbjct  2    VMKERDEELALFLEMRRREKEKEKSNNLLSVHKSEQQLNVPLGSNVNVNGNGNVGGGGSP  61

Query  634  VFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            V  I SA+P RKT AD+FLNSEN+K+DYDWLLTPPGTPLF
Sbjct  62   VSKIFSALPVRKTAADNFLNSENEKSDYDWLLTPPGTPLF  101



>gb|KDP24464.1| hypothetical protein JCGZ_25028 [Jatropha curcas]
Length=512

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 10/96 (10%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLL---------QNSDEFDAPLGSNTG-SSPVFNI  645
            + KEKDEEL LFLEMRRREK++ +L LL          NS+  DA  G+N    SP+  I
Sbjct  2    VTKEKDEELALFLEMRRREKDKTNLFLLYNDNNNNSSSNSNGVDASSGTNNRLGSPISKI  61

Query  646  PSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             +++PARKT A+ FL+SENDK+DYDWLLTPPGTPLF
Sbjct  62   VASVPARKTAAEKFLDSENDKSDYDWLLTPPGTPLF  97



>gb|KJB76927.1| hypothetical protein B456_012G113200 [Gossypium raimondii]
Length=570

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 14/100 (14%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKER---NDLLLLQNSDE-FDAPLGSNTGSS----------P  633
            ++KE+DEEL LFLEMRRREKE+   N+LL +  S++  + PLGSN   +          P
Sbjct  2    VMKERDEELALFLEMRRREKEKEKSNNLLSVHKSEQQLNVPLGSNVNVNGNGNVGGGGSP  61

Query  634  VFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            V  I SA+P RKT AD+FLNSEN+K+DYDWLLTPPGTPLF
Sbjct  62   VSKIFSALPVRKTAADNFLNSENEKSDYDWLLTPPGTPLF  101



>gb|KHN07485.1| hypothetical protein glysoja_034966 [Glycine soja]
Length=515

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 70/89 (79%), Gaps = 3/89 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFD-APLGSNTGSSPVFNIPSAMPAR  666
            ++K++DEEL LFLEMRRREKE  +N+LLLLQNS+E D + L SN G+S +  + S++P R
Sbjct  2    VMKQRDEELSLFLEMRRREKENEKNNLLLLQNSEELDLSNLESNHGASMISKMVSSVPPR  61

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            K   ++FLNSENDK+DY+WLL PP  PLF
Sbjct  62   KNGIEEFLNSENDKSDYEWLLAPPDAPLF  90



>ref|XP_006602654.1| PREDICTED: flocculation protein FLO11 isoform X1 [Glycine max]
 ref|XP_006602655.1| PREDICTED: flocculation protein FLO11 isoform X2 [Glycine max]
 ref|XP_006602656.1| PREDICTED: flocculation protein FLO11 isoform X3 [Glycine max]
Length=515

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 70/89 (79%), Gaps = 3/89 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFD-APLGSNTGSSPVFNIPSAMPAR  666
            ++K++DEEL LFLEMRRREKE  +N+LLLLQNS+E D + L SN G+S +  + S++P R
Sbjct  2    VMKQRDEELSLFLEMRRREKENEKNNLLLLQNSEELDLSNLESNHGASMISKMVSSVPPR  61

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            K   ++FLNSENDK+DY+WLL PP  PLF
Sbjct  62   KNGIEEFLNSENDKSDYEWLLAPPDAPLF  90



>ref|XP_007140357.1| hypothetical protein PHAVU_008G105200g [Phaseolus vulgaris]
 gb|ESW12351.1| hypothetical protein PHAVU_008G105200g [Phaseolus vulgaris]
Length=509

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFD-APLGSNTGSSPVFNIPSAMPAR  666
            ++KE+DEEL LFLEMRRREKE  +N LLLLQNS+E D + L SN G S    I S++P R
Sbjct  2    VMKERDEELSLFLEMRRREKENEKNSLLLLQNSEELDLSNLESNHGGSMNSKIVSSVPPR  61

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            K   ++FLNSENDK+DY+WLL PP  PLF
Sbjct  62   KNGVEEFLNSENDKSDYEWLLAPPDAPLF  90



>ref|XP_002528111.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34290.1| conserved hypothetical protein [Ricinus communis]
Length=513

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 65/89 (73%), Gaps = 12/89 (13%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTG--SSPVFNIPSAMP-AR  666
            + KEKDEEL LFLEMRRREK+ N LL        D PLG+N    +SP+  I S++P  R
Sbjct  2    VTKEKDEELALFLEMRRREKD-NALL--------DPPLGTNNALVASPISKIVSSVPMIR  52

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            KT AD FL+SENDK+DYDWLLTPPGTPLF
Sbjct  53   KTAADKFLDSENDKSDYDWLLTPPGTPLF  81



>emb|CBI30399.3| unnamed protein product [Vitis vinifera]
Length=256

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = +1

Query  538  MRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDY  717
            MRRREKE+ND LLL++ D   AP GS    SP+  I S+MP RKT  D+FL+SEND+ DY
Sbjct  1    MRRREKEKNDSLLLESPD---APFGSKPDVSPISKIVSSMPVRKTGPDEFLDSENDRTDY  57

Query  718  DWLLTPPGTPLF  753
            DWLLTPPGTPLF
Sbjct  58   DWLLTPPGTPLF  69



>ref|XP_006583646.1| PREDICTED: flocculation protein FLO11-like [Glycine max]
 gb|KHN22748.1| hypothetical protein glysoja_031333 [Glycine soja]
Length=515

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFD-APLGSNTGSSPVFNIPSAMPAR  666
            ++K++DEEL LFLE+RRREKE  +N+L+LLQNS+E   + L SN G S +  I S++P R
Sbjct  2    VMKQRDEELSLFLELRRREKENEKNNLVLLQNSEELHLSNLESNDGGSMISKIVSSVPPR  61

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            K   ++FLNSE DK+DY+WLL PP  PLF
Sbjct  62   KNEVEEFLNSEIDKSDYEWLLAPPDAPLF  90



>gb|KEH28283.1| ATP-binding protein, putative [Medicago truncatula]
Length=616

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 13/119 (11%)
 Frame = +1

Query  430  MNRSFRAEESLTK-------QRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNS  588
            MNRSFRA E   +        ++ + RSS  +  D+EL LF +M+  E E +DLLL  ++
Sbjct  1    MNRSFRATEPKMQSALWQRNHQLENFRSSSFR--DDELALFHQMKNCEIENDDLLLRDST  58

Query  589  DEF-DAPLGSNTGSSPVFNIPSAM--PARKT-VADDFLNSENDKNDYDWLLTPPGTPLF  753
            +EF D+P   N   S +FNI S+   P R+T  ADDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  59   EEFVDSPFDLNPKDSHLFNISSSTEAPVRRTGAADDFLNSETDKNDYEWLLTPPGTPLF  117



>ref|XP_008388204.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
 ref|XP_008359786.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=546

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 62/93 (67%), Gaps = 11/93 (12%)
 Frame = +1

Query  505  EKDEELGLFLEMRRREKERNDLLLL----QNSDEFDA------PLGSNTGSSPVFNIPSA  654
            ++DEEL LFLEMRRR+KE+N   LL    +N+DE DA      P   N G + V     A
Sbjct  22   DRDEELALFLEMRRRDKEKNTGFLLLPPSKNADELDAIAAAAPPESVNRGGAAVSRTVGA  81

Query  655  MPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             P RK+  D+FLNSEN+K+DYDWLLTPP TPLF
Sbjct  82   -PPRKSRVDEFLNSENEKSDYDWLLTPPATPLF  113



>ref|XP_007208455.1| hypothetical protein PRUPE_ppa003864mg [Prunus persica]
 gb|EMJ09654.1| hypothetical protein PRUPE_ppa003864mg [Prunus persica]
Length=543

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (71%), Gaps = 12/96 (13%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKER---NDLLLL--QNSDEFDA---PLGSNT-GSSPVFNI--  645
            + ++DEEL LFLEMRRREK++    + LL+  +N+DE DA   PL SN  G S V  I  
Sbjct  20   VNDRDEELALFLEMRRREKDKEKITNFLLIPNKNADELDAIAAPLDSNNRGGSEVSRIVG  79

Query  646  PSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P A P RK+  D+FLNSEN+K+DYDWLLTPP TPLF
Sbjct  80   PVA-PQRKSRMDEFLNSENEKSDYDWLLTPPATPLF  114



>ref|XP_010109621.1| hypothetical protein L484_015576 [Morus notabilis]
 gb|EXC23666.1| hypothetical protein L484_015576 [Morus notabilis]
Length=518

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 68/100 (68%), Gaps = 9/100 (9%)
 Frame = +1

Query  469  QRMGSLRSSMIKEKDEELGLFLEMRRREKER---NDLLLLQNSDEFDAPLGSNTG-SSPV  636
            Q  G  RS  + EKDEEL LF EMRRREKE    N+LLL  +S+E   P  +N   +SP+
Sbjct  2    QAKGRERS--LSEKDEELSLFFEMRRREKENESNNNLLL--SSEELPPPQETNNNENSPI  57

Query  637  FNIPSAMP-ARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                 ++P  RK+  D+FLNSEN+K+DYDWLLTPPGTPLF
Sbjct  58   SRSAPSLPLQRKSRVDEFLNSENEKSDYDWLLTPPGTPLF  97



>ref|XP_009344715.1| PREDICTED: flocculation protein FLO11-like [Pyrus x bretschneideri]
Length=550

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 11/93 (12%)
 Frame = +1

Query  505  EKDEELGLFLEMRRREKERNDLLLL----QNSDEFDA------PLGSNTGSSPVFNIPSA  654
            ++DEEL LFLEMRRR+KE++   LL    +N DE DA      P   N G + V     A
Sbjct  22   DRDEELALFLEMRRRDKEKSTGFLLLPPSKNVDELDAIAAAAPPESDNRGGAAVSRTVGA  81

Query  655  MPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             P RK+  D+FLNSEN+K+DYDWLLTPP TPLF
Sbjct  82   -PPRKSRVDEFLNSENEKSDYDWLLTPPATPLF  113



>ref|XP_008243876.1| PREDICTED: flocculation protein FLO11-like [Prunus mume]
Length=543

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREK--ERNDLLLL---QNSDEFDA---PLG-SNTGSSPVFNIPS  651
            + ++DEEL LFLEMRRREK  E+N   L    +N+DE DA   PL   N G S V  I  
Sbjct  20   VNDRDEELALFLEMRRREKDKEKNTNFLRLPNKNADELDAIAAPLDFDNRGGSEVSRIVG  79

Query  652  -AMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             A P RK+  D+FLNSEN+K+DYDWLLTPP TPLF
Sbjct  80   PAAPQRKSRVDEFLNSENEKSDYDWLLTPPATPLF  114



>gb|KEH28284.1| ATP-binding protein, putative [Medicago truncatula]
Length=601

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 4/86 (5%)
 Frame = +1

Query  508  KDEELGLFLEMRRREKERNDLLLLQNSDEF-DAPLGSNTGSSPVFNIPSAM--PARKT-V  675
            +D+EL LF +M+  E E +DLLL  +++EF D+P   N   S +FNI S+   P R+T  
Sbjct  21   RDDELALFHQMKNCEIENDDLLLRDSTEEFVDSPFDLNPKDSHLFNISSSTEAPVRRTGA  80

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            ADDFLNSE DKNDY+WLLTPPGTPLF
Sbjct  81   ADDFLNSETDKNDYEWLLTPPGTPLF  106



>ref|XP_009377788.1| PREDICTED: mucin-2-like [Pyrus x bretschneideri]
Length=549

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 61/100 (61%), Gaps = 15/100 (15%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREK--ERNDLLLL----QNSDEFDA-------PLGSNTGSSPVF  639
            + ++DEEL LFLEMRRREK  E+N   LL    +N+DE DA       P   N G + V 
Sbjct  20   VNDRDEELALFLEMRRREKDKEKNGGFLLLPPNKNADELDAIGAAAAPPESDNCGGAAVS  79

Query  640  NIPS--AMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                  A P  K   D+FLNSEN+K+DYDWLLTPP TPLF
Sbjct  80   RTVGTVAPPQPKNRVDEFLNSENEKSDYDWLLTPPATPLF  119



>ref|XP_006366352.1| PREDICTED: flocculation protein FLO11-like [Solanum tuberosum]
Length=535

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KE DE+L +FLEMRR EK+ ND L   NS+E D  LGS    S + N  S  PA +  
Sbjct  17   VMKEVDEDLAMFLEMRRSEKDMNDQLAKCNSEELDQQLGSEVDFSSLSNGTSTKPANQ--  74

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
             D  LNSENDKNDYDWLL+PP TP
Sbjct  75   -DYLLNSENDKNDYDWLLSPPQTP  97



>ref|XP_011044062.1| PREDICTED: LOW QUALITY PROTEIN: nascent polypeptide-associated 
complex subunit alpha, muscle-specific form [Populus euphratica]
Length=560

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 9/113 (8%)
 Frame = +1

Query  430  MNRSFRAEES-----LTKQRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDE  594
            MNRSFRA++S     + KQR   LR++M+KEK+EEL LFLEM++REKE+N+L L+ N+ +
Sbjct  1    MNRSFRAQDSQMQAAVVKQRQ-QLRATMMKEKEEELALFLEMKKREKEQNNLFLINNTAD  59

Query  595  FDAPLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             +AP GSN   S  F   S +    +  D +L     +  + WLLTPPGTPLF
Sbjct  60   SEAPFGSNAFYSYFFFFLSWI---XSGEDVYLVQIFIRFFFFWLLTPPGTPLF  109



>emb|CDY53090.1| BnaCnng24200D [Brassica napus]
Length=510

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAM--PARK  669
            +  ++DEEL +FLEMRRR+KER    LL  SD         T  S V  + S+   P R+
Sbjct  2    LTHDRDEELSMFLEMRRRDKERRGESLLTGSDSTSINGALTTALSGVSEMVSSQRYPLRR  61

Query  670  TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   TAAENFLYSENEKSDYDWLLTPPGTPQF  89



>ref|XP_008370081.1| PREDICTED: flocculation protein FLO11-like [Malus domestica]
Length=552

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 60/100 (60%), Gaps = 15/100 (15%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREK--ERNDLLLL----QNSDEFDA-------PLGSNTGSSPVF  639
            + ++DEEL LFLEMRRREK  E+N   LL    +N+DE D        P   N G + V 
Sbjct  20   VNDRDEELALFLEMRRREKDKEKNAGFLLLPPNKNADELDPIAAAVAPPESDNRGGAAVS  79

Query  640  NIPSAMPAR--KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                A P    K   D+FLNSEN+K+DYDWLLTPP TPLF
Sbjct  80   RTVGAAPPPQPKIRVDEFLNSENEKSDYDWLLTPPATPLF  119



>emb|CDY07050.1| BnaA04g22650D [Brassica napus]
Length=189

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 11/80 (14%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKT--  672
            + EKDEEL LFLEMR+RE+E +D  L+ N  EF        G+SP+FNIPS  P+RKT  
Sbjct  1    MAEKDEELSLFLEMRQREEE-HDSFLVNNPHEFP-------GTSPMFNIPSGAPSRKTGP  52

Query  673  VADDFLNSENDKNDYD-WLL  729
            + DDFL+SE DKNDY+ W +
Sbjct  53   LPDDFLSSEGDKNDYECWRV  72



>ref|XP_008807272.1| PREDICTED: uncharacterized protein LOC103719688 [Phoenix dactylifera]
Length=220

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 58/95 (61%), Gaps = 11/95 (12%)
 Frame = +1

Query  469  QRMGSLRSSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIP  648
            +R+  L  +  KE+DE+L LF EM +REKER   LL   SDEF+       G+ P++ IP
Sbjct  6    RRINKLPKNPRKEQDEDLLLFREMFKREKERTMSLLQPVSDEFEP----GHGNYPLYRIP  61

Query  649  SAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            S          DFL +EN+KNDYDWL TPP TPLF
Sbjct  62   SG-------KKDFLATENEKNDYDWLKTPPATPLF  89



>ref|XP_009588557.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X1 [Nicotiana tomentosiformis]
Length=550

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            +++E DE+L +FLEMRR EKE ND +   NS+E D  LGS    S + N  S  PA +  
Sbjct  17   VMREVDEDLAMFLEMRRSEKEMNDQIPTHNSEELDQQLGSEVDFSLLSNGASTEPANQ--  74

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
             D  LNSENDKNDYDWLL+ P TP
Sbjct  75   -DYLLNSENDKNDYDWLLSLPHTP  97



>ref|XP_009588559.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X2 [Nicotiana tomentosiformis]
Length=535

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            +++E DE+L +FLEMRR EKE ND +   NS+E D  LGS    S + N  S  PA +  
Sbjct  2    VMREVDEDLAMFLEMRRSEKEMNDQIPTHNSEELDQQLGSEVDFSLLSNGASTEPANQ--  59

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
             D  LNSENDKNDYDWLL+ P TP
Sbjct  60   -DYLLNSENDKNDYDWLLSLPHTP  82



>ref|XP_004968162.1| PREDICTED: mucin-5AC-like isoform X1 [Setaria italica]
Length=591

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 61/105 (58%), Gaps = 25/105 (24%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKER----NDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMP  660
            ++IKEKDEEL LFLEMRRREKER    + LLL   +   D  L        +  +P A P
Sbjct  19   AVIKEKDEELALFLEMRRREKERGAAADQLLLSGGAAAGDGVLQ-------LDALPPAEP  71

Query  661  ---ARKTV----------ADDFLNSE-NDKNDYDWLLTPPGTPLF  753
               A K            ADDFLN++  DKNDYDWLLTPPGTPLF
Sbjct  72   KPAAYKVAGVGFRRAPGGADDFLNADAGDKNDYDWLLTPPGTPLF  116



>ref|XP_004968163.1| PREDICTED: mucin-5AC-like isoform X2 [Setaria italica]
Length=568

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 61/105 (58%), Gaps = 25/105 (24%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKER----NDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMP  660
            ++IKEKDEEL LFLEMRRREKER    + LLL   +   D  L        +  +P A P
Sbjct  19   AVIKEKDEELALFLEMRRREKERGAAADQLLLSGGAAAGDGVLQ-------LDALPPAEP  71

Query  661  ---ARKTV----------ADDFLNSE-NDKNDYDWLLTPPGTPLF  753
               A K            ADDFLN++  DKNDYDWLLTPPGTPLF
Sbjct  72   KPAAYKVAGVGFRRAPGGADDFLNADAGDKNDYDWLLTPPGTPLF  116



>ref|XP_011047445.1| PREDICTED: mucin-2-like [Populus euphratica]
Length=563

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 7/93 (8%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFDAPLG--SNTGS--SPVFNIPSAM  657
            ++KEKDEEL LFLEMRRRE E  +N+LLL  ++DE  APLG  SN  S  S    + S +
Sbjct  2    VMKEKDEELTLFLEMRRREIEREKNNLLLNSSADEPQAPLGLGSNDLSLVSNKITVSSIV  61

Query  658  PA-RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P  RKT  + FL+SENDK+DYDWLLTPPGTPLF
Sbjct  62   PPPRKTATEKFLDSENDKSDYDWLLTPPGTPLF  94



>ref|XP_009123519.1| PREDICTED: sialidase-like [Brassica rapa]
Length=515

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 53/89 (60%), Gaps = 6/89 (7%)
 Frame = +1

Query  505  EKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAM------PAR  666
            ++DEEL +FLEMRRREKE     LL  SD         T  S   +  S        P R
Sbjct  5    DRDEELSMFLEMRRREKEHRGESLLTGSDNVSINGALTTAVSAALSGISETVSSQRYPLR  64

Query  667  KTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  65   RTAAENFLYSENEKSDYDWLLTPPGTPQF  93



>ref|XP_006407721.1| hypothetical protein EUTSA_v10020521mg [Eutrema salsugineum]
 gb|ESQ49174.1| hypothetical protein EUTSA_v10020521mg [Eutrema salsugineum]
Length=518

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSD--EFDAPLGSNTGS--SPVFNIPSAM--  657
            +  ++DEEL LFLEMRRREKE     LL  SD    +  L ++  +  S V    S+   
Sbjct  2    LSHDRDEELSLFLEMRRREKEHRGESLLAGSDNISINGALTTSVAAALSGVSETVSSQRF  61

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  93



>gb|KFK38285.1| hypothetical protein AALP_AA3G094600 [Arabis alpina]
Length=524

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 58/99 (59%), Gaps = 19/99 (19%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG-------------SNTGSSPV  636
            +  ++DEEL +FLEMRRREKE     LL  SD   +  G             S+T SS  
Sbjct  2    LTHDRDEELSMFLEMRRREKEHRGDSLLTGSDNVSSINGMLRTAAATALAGVSDTMSSQR  61

Query  637  FNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +      P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   Y------PPRRTAAENFLYSENEKSDYDWLLTPPGTPQF  94



>ref|XP_004302638.1| PREDICTED: endochitinase A-like [Fragaria vesca subsp. vesca]
Length=530

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 11/91 (12%)
 Frame = +1

Query  505  EKDEELGLFLEMRRREK--ERNDLLLLQNS----DEFDA-PLGSNTGSSPVFNI-PSAMP  660
            ++DEEL LFLEMRRR+K  E+N   LL  S    DE DA P+  +     ++ I  SA P
Sbjct  13   DRDEELALFLEMRRRDKDKEKNGGFLLLPSKTAGDELDAAPIEYDKA---MYKINGSAAP  69

Query  661  ARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             R++  D+FLNSEN+K++YDWL+TPP TPLF
Sbjct  70   ERRSRVDEFLNSENEKSEYDWLITPPATPLF  100



>emb|CDY22176.1| BnaC01g39250D [Brassica napus]
Length=516

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 19/97 (20%)
 Frame = +1

Query  502  KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD-------------APLGSNTGSSPVFN  642
            +++DEEL +FLEMRRREKE     LL  SD                + + S T SS  ++
Sbjct  4    QDRDEELSMFLEMRRREKEHRGESLLTGSDNVSINGALTTAVSTALSGISSETVSSQPYS  63

Query  643  IPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +      R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  64   L------RRTAAENFLYSENEKSDYDWLLTPPGTPQF  94



>ref|XP_010486449.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
 ref|XP_010486450.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
 ref|XP_010486451.1| PREDICTED: flocculation protein FLO11-like [Camelina sativa]
Length=532

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 56/99 (57%), Gaps = 19/99 (19%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDA-------------PLGSNTGSSPV  636
            +  ++DEEL LFLEMRRREKE     LL  SD   +                S T SS  
Sbjct  2    LTHDRDEELSLFLEMRRREKEHRADSLLTGSDNVSSINETLKAAAAAALSGVSETASSQR  61

Query  637  FNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +      P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   Y------PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  94



>ref|NP_566340.1| proline-rich uncharacterized protein [Arabidopsis thaliana]
 gb|AAD56316.1|AC009326_3 hypothetical protein [Arabidopsis thaliana]
 gb|AAF07827.1|AC010871_3 hypothetical protein [Arabidopsis thaliana]
 gb|AAL16108.1|AF428276_1 AT3g09000/T16O11_4 [Arabidopsis thaliana]
 gb|AAN31886.1| unknown protein [Arabidopsis thaliana]
 gb|AAV85714.1| At3g09000 [Arabidopsis thaliana]
 gb|AEE74707.1| proline-rich uncharacterized protein [Arabidopsis thaliana]
Length=541

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD----APLGSNTGSSPVFNIPSAM--  657
            +  ++DEEL LFLEMRRREKE     LL  SD           +    S V    S+   
Sbjct  2    LTHDRDEELSLFLEMRRREKEHRADSLLTGSDNVSINATLTAAAAAALSGVSETASSQRY  61

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  93



>ref|XP_010464524.1| PREDICTED: cell wall protein DAN4-like [Camelina sativa]
 ref|XP_010464525.1| PREDICTED: cell wall protein DAN4-like [Camelina sativa]
Length=541

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 56/99 (57%), Gaps = 19/99 (19%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDA-------------PLGSNTGSSPV  636
            +  ++DEEL LFLEMRRREKE     LL  SD   +                S T SS  
Sbjct  2    LTHDRDEELSLFLEMRRREKEHRADSLLTGSDNVSSINETLKAAAAAALSGVSETASSQR  61

Query  637  FNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +      P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   Y------PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  94



>ref|XP_009146960.1| PREDICTED: flocculation protein FLO11-like [Brassica rapa]
Length=529

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD----APLGSNTGSSPVFNIPSAM--  657
            +  ++DEEL +FLEMRRR+KER    LL  SD           +    S V    S+   
Sbjct  2    LTHDRDEELSMFLEMRRRDKERRGESLLTGSDSTSINGALTTAAAAALSGVSETVSSQRY  61

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  93



>ref|XP_002323572.2| hypothetical protein POPTR_0016s12230g [Populus trichocarpa]
 gb|EEF05333.2| hypothetical protein POPTR_0016s12230g [Populus trichocarpa]
Length=519

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 8/94 (9%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKE--RNDLLLLQNSDEFDAPLGSNTGS-----SPVFNIPSA  654
            ++KEKDEEL LFLEMRRRE E  +N+LLL  ++DE  APLG  T +     S    + S 
Sbjct  2    VMKEKDEELTLFLEMRRREIEREKNNLLLNSSADEPQAPLGDPTSNNLSLVSNKITVSSI  61

Query  655  MPA-RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +P  RKT  + FL+SENDK+DYDWLLTPP TPLF
Sbjct  62   VPPPRKTATEKFLDSENDKSDYDWLLTPPRTPLF  95



>ref|XP_010248888.1| PREDICTED: uncharacterized protein LOC104591651 [Nelumbo nucifera]
Length=1209

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            ++  R  RAE   T +R  S  S + ++EKD++L LF EM+ RE+   D  LLQ+SD+ D
Sbjct  9    FSPGRELRAE---THKRGRSFESGLFLREKDDDLALFTEMQARER---DNFLLQSSDDLD  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
              L +   S   F +  ++PA    + D LN++ DKNDYDWLLTPP TPLF
Sbjct  63   ESLSTKLRSFSDFKLGISIPALGE-SSDLLNADGDKNDYDWLLTPPDTPLF  112



>ref|XP_009804551.1| PREDICTED: endochitinase A-like isoform X1 [Nicotiana sylvestris]
Length=552

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            +++E DE+L +FLEMRR EKE ND +   N +E D  LGS    S + N  S  PA +  
Sbjct  17   VMREVDEDLAMFLEMRRSEKEMNDQIPKHNCEESDPQLGSEVDFSLLSNGTSTEPANQ--  74

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
             D  LNSENDKNDYDWLL+ P TP
Sbjct  75   -DYLLNSENDKNDYDWLLSLPHTP  97



>ref|XP_010467544.1| PREDICTED: mucin-5AC-like [Camelina sativa]
 ref|XP_010467611.1| PREDICTED: mucin-5AC-like [Camelina sativa]
Length=542

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 56/101 (55%), Gaps = 21/101 (21%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDA---------------PLGSNTGSS  630
            +  ++DEEL LFLEMRRREKE     LL  SD   +                  S T SS
Sbjct  2    LTHDRDEELSLFLEMRRREKEHRADSLLTGSDNVSSINETLKAAAAAAAALSGVSETASS  61

Query  631  PVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
              +      P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   QRY------PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  96



>ref|XP_009804552.1| PREDICTED: endochitinase A-like isoform X2 [Nicotiana sylvestris]
Length=537

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            +++E DE+L +FLEMRR EKE ND +   N +E D  LGS    S + N  S  PA +  
Sbjct  2    VMREVDEDLAMFLEMRRSEKEMNDQIPKHNCEESDPQLGSEVDFSLLSNGTSTEPANQ--  59

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
             D  LNSENDKNDYDWLL+ P TP
Sbjct  60   -DYLLNSENDKNDYDWLLSLPHTP  82



>ref|XP_004246841.1| PREDICTED: endochitinase A-like [Solanum lycopersicum]
Length=535

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KE DE+L +FLEMRR EKE ND L   +S+E +  LGS    S + N     PA +  
Sbjct  17   VMKEVDEDLAMFLEMRRSEKEMNDQLAKCDSEELNQQLGSEVDFSLLSNGTLTKPANQ--  74

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
             D  LNSE+DKNDYDWLL+PP TP
Sbjct  75   -DYLLNSESDKNDYDWLLSPPQTP  97



>emb|CDY44674.1| BnaA05g29320D [Brassica napus]
Length=529

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD----APLGSNTGSSPVFNIPSAM--  657
            +  ++DEEL +FLEMRRR+KER    L+  SD           +    S V    S+   
Sbjct  2    LTHDRDEELSMFLEMRRRDKERRGESLVTGSDSTSINGALTTAAAAALSGVSETVSSQRY  61

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  93



>ref|NP_001143501.1| uncharacterized protein LOC100276180 [Zea mays]
 gb|ACG32624.1| hypothetical protein [Zea mays]
Length=178

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 59/119 (50%), Gaps = 38/119 (32%)
 Frame = +1

Query  490  SSMIKEKDEELGLFLEMRRREKER-------------------NDLLLLQNSDEFDAPLG  612
             ++IKEKDEE  LFLEMRRREKER                   N +LLL           
Sbjct  18   GAVIKEKDEEFALFLEMRRREKERGAAAAAADQLLLSGDVAAENGMLLLDPPPPAGGSFI  77

Query  613  SNTGSSPVFNIPSAMPARKTVA-----------DDFLNSE-NDKNDYDWLLTPPGTPLF  753
            S + S P        PA   VA           DDFLN++ +DKNDYDWLLTPPGTPLF
Sbjct  78   SASSSEP-------KPAAYKVAGGGFRRAPGGVDDFLNADASDKNDYDWLLTPPGTPLF  129



>ref|XP_006299014.1| hypothetical protein CARUB_v10015141mg [Capsella rubella]
 gb|EOA31912.1| hypothetical protein CARUB_v10015141mg [Capsella rubella]
Length=523

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSD--EFDAPLGSNTGS--SPVFNIPSAM--  657
            +  ++DEEL LFLEMRRREKE      L  SD    +  L +   +  S V  + S+   
Sbjct  2    LTHDRDEELSLFLEMRRREKEHRADSCLTGSDNASINGTLKAAAAAALSGVSEMASSQRY  61

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P R+T A++FL SEN+K+DYDWLLTPPGTP F
Sbjct  62   PLRRTAAENFLYSENEKSDYDWLLTPPGTPQF  93



>ref|XP_010250822.1| PREDICTED: uncharacterized protein LOC104592946 [Nelumbo nucifera]
Length=1211

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            ++  R  RAE   T +R  SL S ++ +EKD+ L LF EM+ REK   D  LLQ+SD+ D
Sbjct  9    FSPGRELRAE---THKRGRSLESGLLLREKDDNLALFNEMQAREK---DNFLLQSSDDLD  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                S       F +  ++P R   + D LN++ DKNDYDWLLTPP TPLF
Sbjct  63   DCFSSKLRYFSDFKLGISIPVRGE-SSDLLNADGDKNDYDWLLTPPDTPLF  112



>ref|XP_010543220.1| PREDICTED: mucin-1-like [Tarenaya hassleriana]
Length=523

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 10/86 (12%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + +++DEEL LFLEMRRR+KE +   LL  SD       S++ +  V ++    P R+T 
Sbjct  2    VTQDRDEELALFLEMRRRDKE-HGASLLTGSD-------SSSNNEAVSSL--RYPLRRTA  51

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            A++FL SEN+K+DY+WLLTPPGTP +
Sbjct  52   AENFLYSENEKSDYEWLLTPPGTPQY  77



>gb|EEC69917.1| hypothetical protein OsI_00338 [Oryza sativa Indica Group]
Length=600

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 56/110 (51%), Gaps = 23/110 (21%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKERN----------------------DLLLLQNSDEFDAP  606
            ++IKEKDEEL LFLEMRRREKER                       D +LL +      P
Sbjct  17   AVIKEKDEELALFLEMRRREKERGAAAAAAAAEQLLLSGDRVDVARDGMLLVDQPPPPRP  76

Query  607  LGSNTGSSPVFNIPSAMPARKTVADDFLNSE-NDKNDYDWLLTPPGTPLF  753
                   +  + +          ADDFLNS+  DKNDYDWLLTPPGTPLF
Sbjct  77   QPPAEHKAAAYRMTGGFRRAPGGADDFLNSDGGDKNDYDWLLTPPGTPLF  126



>gb|ACG46765.1| hypothetical protein [Zea mays]
Length=168

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 53/102 (52%), Gaps = 14/102 (14%)
 Frame = +1

Query  490  SSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTG------------SSP  633
             ++IKEKDEE  LFLEMRRREKER       +       + +  G               
Sbjct  18   GAVIKEKDEEFALFLEMRRREKERGAAAAAADQLLLSGDVAAENGMLLLDPPPPAEPKPA  77

Query  634  VFNIPSAMPARK-TVADDFLNSE-NDKNDYDWLLTPPGTPLF  753
             + +      R     DDFLN++ +DKNDYDWLLTPPGTPLF
Sbjct  78   AYKVAGGGFRRAPGGVDDFLNADASDKNDYDWLLTPPGTPLF  119



>ref|XP_008654702.1| PREDICTED: uncharacterized protein LOC100276180 isoform X1 [Zea 
mays]
Length=358

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 57/104 (55%), Gaps = 18/104 (17%)
 Frame = +1

Query  490  SSMIKEKDEELGLFLEMRRREKERN------DLLLLQNSDEFDAPLG--------SNTGS  627
             ++IKEKDEE  LFLEMRRREKER       D LLL  S +  A  G             
Sbjct  18   GAVIKEKDEEFALFLEMRRREKERGAAAAAADQLLL--SGDVAAENGMLLLDPPPPAEPK  75

Query  628  SPVFNIPSAMPARK-TVADDFLNSE-NDKNDYDWLLTPPGTPLF  753
               + +      R     DDFLN++ +DKNDYDWLLTPPGTPLF
Sbjct  76   PAAYKVAGGGFRRAPGGVDDFLNADASDKNDYDWLLTPPGTPLF  119



>ref|NP_001041987.1| Os01g0141900 [Oryza sativa Japonica Group]
 dbj|BAF03901.1| Os01g0141900 [Oryza sativa Japonica Group]
 dbj|BAG92172.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 55/109 (50%), Gaps = 22/109 (20%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKERNDLL-------LLQNSDEFDAP--------------L  609
            ++IKEKDEEL LFLEMRRREKER           LL + D  D                 
Sbjct  24   AVIKEKDEELALFLEMRRREKERGAAAAAAAAEQLLLSGDRVDVARDGMLLVDQPPPRPQ  83

Query  610  GSNTGSSPVFNIPSAMPARKTVADDFLNSEN-DKNDYDWLLTPPGTPLF  753
                  +  + +          ADDFLNS+  DKNDYDWLLTPPGTPLF
Sbjct  84   PPAEHKAAAYRMTGGFRRAPGGADDFLNSDGGDKNDYDWLLTPPGTPLF  132



>dbj|BAD61066.1| putative proteophosphoglycan [Oryza sativa Japonica Group]
 gb|EEE53843.1| hypothetical protein OsJ_00320 [Oryza sativa Japonica Group]
Length=601

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 55/109 (50%), Gaps = 22/109 (20%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKERNDLL-------LLQNSDEFDAP--------------L  609
            ++IKEKDEEL LFLEMRRREKER           LL + D  D                 
Sbjct  19   AVIKEKDEELALFLEMRRREKERGAAAAAAAAEQLLLSGDRVDVARDGMLLVDQPPPRPQ  78

Query  610  GSNTGSSPVFNIPSAMPARKTVADDFLNSEN-DKNDYDWLLTPPGTPLF  753
                  +  + +          ADDFLNS+  DKNDYDWLLTPPGTPLF
Sbjct  79   PPAEHKAAAYRMTGGFRRAPGGADDFLNSDGGDKNDYDWLLTPPGTPLF  127



>ref|XP_002457389.1| hypothetical protein SORBIDRAFT_03g006540 [Sorghum bicolor]
 gb|EES02509.1| hypothetical protein SORBIDRAFT_03g006540 [Sorghum bicolor]
Length=600

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 57/109 (52%), Gaps = 26/109 (24%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKERN----------DLLLLQNSDEFDAPLG----------  612
            ++IKEKDEEL LFLEMRRREKER           D LLL      DA  G          
Sbjct  20   AVIKEKDEELALFLEMRRREKERGAAAAAAAAAADQLLLSG----DAVAGDGMLLLDPPP  75

Query  613  SNTGSSPVFNIPSAMPARKT-VADDFLNSE-NDKNDYDWLLTPPGTPLF  753
                    + +      R    ADDFLN++  DKNDYDWLLTPPGTPLF
Sbjct  76   PAEPKPAAYKVAGCGFRRAPGGADDFLNADAGDKNDYDWLLTPPGTPLF  124



>ref|XP_010103184.1| hypothetical protein L484_006735 [Morus notabilis]
 gb|EXB94970.1| hypothetical protein L484_006735 [Morus notabilis]
Length=1171

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RA      +R  S    +I +EKD++L LF EM+ RE+E     LLQ+SD+ +
Sbjct  9    YSPGRESRANN---HKRGHSFEGGLIFREKDDDLALFNEMQTRERES---FLLQSSDDLE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            A   +         +  ++PAR   + D LN++ DKNDYDWLLTPP TPLF
Sbjct  63   ATFSTKLRHFSDIKLGISIPARGE-SSDLLNADGDKNDYDWLLTPPDTPLF  112



>ref|XP_008672699.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN27636.1| unknown [Zea mays]
 gb|ACN34315.1| unknown [Zea mays]
 gb|ACR36057.1| unknown [Zea mays]
Length=600

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 58/106 (55%), Gaps = 19/106 (18%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKER------------NDLLLLQNSDEFDAPL-----GSNT  621
            ++IKEKDEEL LFLEMRRREKER            + LLL  +S   D  L         
Sbjct  19   AVIKEKDEELALFLEMRRREKERGAAAAAAAVAAADQLLLSGDSVAGDGMLLLGPPPPAE  78

Query  622  GSSPVFNIPSAMPARKT-VADDFLNSE-NDKNDYDWLLTPPGTPLF  753
                 + +      R    ADDFL+++  DKNDYDWLLTPPGTPLF
Sbjct  79   PKPVAYKVAGGGFRRAPGGADDFLHADAGDKNDYDWLLTPPGTPLF  124



>ref|XP_008672700.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACN36549.1| unknown [Zea mays]
Length=570

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 58/106 (55%), Gaps = 19/106 (18%)
 Frame = +1

Query  493  SMIKEKDEELGLFLEMRRREKER------------NDLLLLQNSDEFDAPL-----GSNT  621
            ++IKEKDEEL LFLEMRRREKER            + LLL  +S   D  L         
Sbjct  19   AVIKEKDEELALFLEMRRREKERGAAAAAAAVAAADQLLLSGDSVAGDGMLLLGPPPPAE  78

Query  622  GSSPVFNIPSAMPARKT-VADDFLNSE-NDKNDYDWLLTPPGTPLF  753
                 + +      R    ADDFL+++  DKNDYDWLLTPPGTPLF
Sbjct  79   PKPVAYKVAGGGFRRAPGGADDFLHADAGDKNDYDWLLTPPGTPLF  124



>ref|XP_008449265.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Cucumis melo]
Length=517

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 13/92 (14%)
 Frame = +1

Query  517  ELGLFLEMRRREKERNDLLLLQNSDEFD------------APLGSNTGSSPVF-NIPSAM  657
            E+ + L+MR  EKE ++  LL  S   D            A   +N G SPV  N+ S +
Sbjct  9    EVVMLLDMRTVEKEMDNDNLLHRSCSGDPNLETVSFSVSAAEANNNGGCSPVSKNVVSPV  68

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P RK   +DF++SEN+K+DYDWLLTPPGTPLF
Sbjct  69   PPRKIKTEDFMDSENEKSDYDWLLTPPGTPLF  100



>ref|XP_008449274.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Cucumis melo]
Length=515

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 11/90 (12%)
 Frame = +1

Query  517  ELGLFLEMRRREKERNDLLLLQNSDEFDAPL----------GSNTGSSPVF-NIPSAMPA  663
            E+ + L+MR  EKE ++  LL  S   D  L           +N G SPV  N+ S +P 
Sbjct  9    EVVMLLDMRTVEKEMDNDNLLHRSCSGDPNLETVSFSVSEANNNGGCSPVSKNVVSPVPP  68

Query  664  RKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            RK   +DF++SEN+K+DYDWLLTPPGTPLF
Sbjct  69   RKIKTEDFMDSENEKSDYDWLLTPPGTPLF  98



>emb|CDP12663.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            ++KE + +L  FLEMR+REKERN L L++N+D FD    SN  +S V +       + T 
Sbjct  17   VMKEIEGDLATFLEMRKREKERNGLFLIENNDGFDHSAASNPDNSVVSDAIFIETTQTTP  76

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
            AD+F  + ++K+DYDWL+  P TP
Sbjct  77   ADNFFAAVSNKSDYDWLVASPDTP  100



>ref|XP_004165110.1| PREDICTED: uncharacterized protein LOC101231484 [Cucumis sativus]
Length=517

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 13/92 (14%)
 Frame = +1

Query  517  ELGLFLEMRRREKE--RNDLLLLQNSDEFDAPL----------GSNTGSSPVF-NIPSAM  657
            E+ + L+MR  EKE   ++LL    S++ D  L           +N G SPV  N+ S +
Sbjct  9    EVVMLLDMRTVEKEMDNDNLLHRSCSEDLDPNLETVSFSLSEANNNGGCSPVSKNVVSPV  68

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P RK   +DFL+SEN+K+DYDWLLTPPGTPLF
Sbjct  69   PPRKIRTEDFLDSENEKSDYDWLLTPPGTPLF  100



>ref|XP_004147920.1| PREDICTED: uncharacterized protein LOC101217147 [Cucumis sativus]
 gb|KGN54368.1| hypothetical protein Csa_4G308580 [Cucumis sativus]
Length=517

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 13/92 (14%)
 Frame = +1

Query  517  ELGLFLEMRRREKE--RNDLLLLQNSDEFDAPL----------GSNTGSSPVF-NIPSAM  657
            E+ + L+MR  EKE   ++LL    S++ D  L           +N G SPV  N+ S +
Sbjct  9    EVVMLLDMRTVEKEMDNDNLLHRSCSEDLDPNLETVSFSLSEANNNGGCSPVSKNVVSPV  68

Query  658  PARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            P RK   +DFL+SEN+K+DYDWLLTPPGTPLF
Sbjct  69   PPRKIRTEDFLDSENEKSDYDWLLTPPGTPLF  100



>ref|XP_004502320.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 
[Cicer arietinum]
 ref|XP_004502321.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 
[Cicer arietinum]
Length=1177

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = +1

Query  466  KQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFN  642
             +R  SL S ++ +EKD++L LF EM+ +E+   D  LLQ+SD+ +    +        N
Sbjct  20   HKRGRSLESGILFREKDDDLALFNEMQSKER---DGFLLQSSDDLEDSFATKLRHFSDVN  76

Query  643  IPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            I  ++P R+  +D  LN + DKNDYDWLLTPP TPLF
Sbjct  77   IGISIPGRRETSD-LLNIDGDKNDYDWLLTPPDTPLF  112



>ref|XP_009589500.1| PREDICTED: uncharacterized protein LOC104086863 [Nicotiana tomentosiformis]
 ref|XP_009589501.1| PREDICTED: uncharacterized protein LOC104086863 [Nicotiana tomentosiformis]
 ref|XP_009589502.1| PREDICTED: uncharacterized protein LOC104086863 [Nicotiana tomentosiformis]
Length=1125

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S + ++EKD++L LF E++ RE+   D  LLQ++D+ D    
Sbjct  13   REIRAE---NHKRGRSLESGIHLREKDDDLALFNEVQTRER---DNFLLQSNDDLDDLFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +  ++PAR   + D LN E DKNDYDWLLTPP TPLF
Sbjct  67   TKLRYFSDYKLGVSIPARGE-SSDLLNVEGDKNDYDWLLTPPDTPLF  112



>ref|XP_009797708.1| PREDICTED: uncharacterized protein LOC104244098 [Nicotiana sylvestris]
 ref|XP_009797709.1| PREDICTED: uncharacterized protein LOC104244098 [Nicotiana sylvestris]
 ref|XP_009797710.1| PREDICTED: uncharacterized protein LOC104244098 [Nicotiana sylvestris]
Length=1124

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S + ++EKD++L LF E++ RE+   D  LLQ++D+ D    
Sbjct  13   RELRAE---NHKRGRSLESGIHLREKDDDLALFNEVQTRER---DNFLLQSNDDLDDLFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +  ++PAR   + D LN E DKNDYDWLLTPP TPLF
Sbjct  67   TKLRYFSDYKLGVSIPARGE-SSDLLNVEGDKNDYDWLLTPPDTPLF  112



>ref|XP_002275753.3| PREDICTED: uncharacterized protein LOC100263061 isoform X2 [Vitis 
vinifera]
Length=371

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = +1

Query  502  KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVAD  681
            K++DE+L LF E+ +REKER   LL   SDEF+     N+G+ P++ I SA   +K    
Sbjct  18   KDRDEDLLLFREIHKREKERIASLLQPVSDEFEP----NSGNYPLYRIASA---KKGSGY  70

Query  682  DFLNSENDKNDYDWLLTPPGTPLF  753
            +FL   N KNDYDWL TPP TPLF
Sbjct  71   EFLAGGN-KNDYDWLKTPPATPLF  93



>ref|XP_002514993.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47547.1| conserved hypothetical protein [Ricinus communis]
Length=1178

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RAE     +R  SL   ++ KEKD++L LF EM+ RE+E     LLQ+SD+ +
Sbjct  9    YSPGRDPRAE---IHKRGRSLEGGLLFKEKDDDLALFNEMQSREREN---FLLQSSDDLE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                S       F +  ++P R   + + LN++ +KNDYDWLLTPP TPLF
Sbjct  63   DTFSSKLRHFSDFKLGISIPVRGE-SSELLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_010659787.1| PREDICTED: uncharacterized protein LOC100263061 isoform X1 [Vitis 
vinifera]
 ref|XP_010659788.1| PREDICTED: uncharacterized protein LOC100263061 isoform X1 [Vitis 
vinifera]
 emb|CBI39695.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = +1

Query  502  KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVAD  681
            K++DE+L LF E+ +REKER   LL   SDEF+     N+G+ P++ I SA   +K    
Sbjct  18   KDRDEDLLLFREIHKREKERIASLLQPVSDEFEP----NSGNYPLYRIASA---KKGSGY  70

Query  682  DFLNSENDKNDYDWLLTPPGTPLF  753
            +FL   N KNDYDWL TPP TPLF
Sbjct  71   EFLAGGN-KNDYDWLKTPPATPLF  93



>ref|XP_010682859.1| PREDICTED: uncharacterized protein LOC104897629 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682860.1| PREDICTED: uncharacterized protein LOC104897629 [Beta vulgaris 
subsp. vulgaris]
Length=1133

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = +1

Query  466  KQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFN  642
             +R  SL   M  KE+D++L LF E++ +E E     LLQ+SD+F+  L S   S P   
Sbjct  20   HKRGRSLEGGMSFKERDDDLALFNELQSKESES---FLLQSSDDFEDILSSRVKSFPDVK  76

Query  643  IPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +   +P R   + D LN++ DKNDY+WLLTPP TPLF
Sbjct  77   LGINIPTRGE-SSDLLNADGDKNDYEWLLTPPDTPLF  112



>ref|XP_011086742.1| PREDICTED: uncharacterized protein LOC105168379 [Sesamum indicum]
Length=1140

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (62%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSS-MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S  +++EKD++L LF E++ +E+   D  LL+++D+FD    
Sbjct  13   RELRAE---NHKRGRSLESGVLLREKDDDLALFNEVQNKER---DNFLLKSNDDFDDVFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +  ++PAR   + D LN+E DKNDYDWL+TPP TPLF
Sbjct  67   TKLKYFSDYKLGISIPARGE-SSDLLNAEGDKNDYDWLITPPETPLF  112



>ref|XP_008800364.1| PREDICTED: uncharacterized protein LOC103714757 isoform X2 [Phoenix 
dactylifera]
Length=1078

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            M+K KD++L LF EM+ RE+E     LL  SD+FD  + S       F +   +PAR   
Sbjct  32   MLKAKDDDLALFNEMQSREREN---FLLHISDDFDDSI-SKLRYCSDFKLNINIPARGE-  86

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            + D LNS+ +KNDYDWLLTPP TPLF
Sbjct  87   SSDLLNSDGEKNDYDWLLTPPDTPLF  112



>gb|KDO76877.1| hypothetical protein CISIN_1g038796mg [Citrus sinensis]
Length=390

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 7/83 (8%)
 Frame = +1

Query  505  EKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVADD  684
            +KDE+L LF E+ +REK+R   LL   SDEF+     N G+  ++ I S    +K   ++
Sbjct  26   DKDEDLVLFRELNKREKDRFASLLQPVSDEFEP----NAGNHALYRIGSG---KKGSGNE  78

Query  685  FLNSENDKNDYDWLLTPPGTPLF  753
            FL   N+KNDYDWL TPP TPLF
Sbjct  79   FLGENNNKNDYDWLKTPPATPLF  101



>gb|KHN12409.1| hypothetical protein glysoja_018539 [Glycine soja]
Length=1176

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = +1

Query  442  FRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSN  618
             R   S + QR  SL S +  +EKD++L LF EM+ RE+E     LLQ SD+ +    S 
Sbjct  12   VREPRSDSHQRGRSLESGLPSREKDDDLALFSEMQSREEES---FLLQPSDDLEDSFSSK  68

Query  619  TGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
              + P   +  ++P R   ++  LN++ D+NDYDWLLTPP TPLF
Sbjct  69   LRNFPDIKLGISIPGRGETSE-LLNADGDENDYDWLLTPPDTPLF  112



>ref|XP_008800363.1| PREDICTED: uncharacterized protein LOC103714757 isoform X1 [Phoenix 
dactylifera]
Length=1186

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            M+K KD++L LF EM+ RE+E     LL  SD+FD  + S       F +   +PAR   
Sbjct  32   MLKAKDDDLALFNEMQSREREN---FLLHISDDFDDSI-SKLRYCSDFKLNINIPARGE-  86

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            + D LNS+ +KNDYDWLLTPP TPLF
Sbjct  87   SSDLLNSDGEKNDYDWLLTPPDTPLF  112



>ref|XP_010320975.1| PREDICTED: uncharacterized protein LOC101256284 isoform X2 [Solanum 
lycopersicum]
Length=1131

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S + +++KD++L LF E++ RE+   D  LLQ++DE +    
Sbjct  13   RELRAE---NHKRGRSLESGIQLRDKDDDLALFNEVQTRER---DNFLLQSNDEIEDLFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +  ++PAR   + D LN+E DKNDYDWLLTPP TPLF
Sbjct  67   TKLRYFSDYKLGISIPARGE-SSDLLNAEGDKNDYDWLLTPPDTPLF  112



>ref|XP_008222046.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Prunus 
mume]
Length=1193

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVA  678
            +KEKDE+L LF EM+ REKE     LLQ+SD+ +    +         +  A+P R   +
Sbjct  32   LKEKDEDLALFNEMQTREKED---FLLQSSDDLEDTFATKLRQFSDLKLGIAIPTRGE-S  87

Query  679  DDFLNSENDKNDYDWLLTPPGTPLF  753
             D LN E +KNDYDWLLTPP TPLF
Sbjct  88   SDLLNVEGEKNDYDWLLTPPDTPLF  112



>ref|XP_004239504.1| PREDICTED: uncharacterized protein LOC101256284 isoform X1 [Solanum 
lycopersicum]
Length=1132

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S + +++KD++L LF E++ RE+   D  LLQ++DE +    
Sbjct  13   RELRAE---NHKRGRSLESGIQLRDKDDDLALFNEVQTRER---DNFLLQSNDEIEDLFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +  ++PAR   + D LN+E DKNDYDWLLTPP TPLF
Sbjct  67   TKLRYFSDYKLGISIPARGE-SSDLLNAEGDKNDYDWLLTPPDTPLF  112



>ref|XP_007225438.1| hypothetical protein PRUPE_ppa000426mg [Prunus persica]
 gb|EMJ26637.1| hypothetical protein PRUPE_ppa000426mg [Prunus persica]
Length=1192

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVA  678
            +KEKDE+L LF EM+ REKE     LLQ+SD+ +    +         +  A+P R   +
Sbjct  32   LKEKDEDLALFNEMQTREKED---FLLQSSDDLEDTFSTKLRQFSDLKLGIAIPTRGE-S  87

Query  679  DDFLNSENDKNDYDWLLTPPGTPLF  753
             D LN E +KNDYDWLLTPP TPLF
Sbjct  88   SDLLNVEGEKNDYDWLLTPPDTPLF  112



>emb|CAN77579.1| hypothetical protein VITISV_015345 [Vitis vinifera]
Length=1494

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = +1

Query  502  KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVAD  681
            K++DE+L LF E+ +REKER   LL   SDEF+     N+G+ P++ I SA   +K    
Sbjct  18   KDRDEDLLLFREIHKREKERIASLLQPVSDEFEP----NSGNYPLYRIASA---KKGSGY  70

Query  682  DFLNSENDKNDYDWLLTPPGTPLF  753
            +FL   N KNDYDWL TPP TPLF
Sbjct  71   EFLAGGN-KNDYDWLKTPPATPLF  93



>ref|XP_007133648.1| hypothetical protein PHAVU_011G197200g [Phaseolus vulgaris]
 gb|ESW05642.1| hypothetical protein PHAVU_011G197200g [Phaseolus vulgaris]
Length=369

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 9/96 (9%)
 Frame = +1

Query  472  RMGSLRSSMIKEKDEELGLFLEMRRREKER-NDLLLLQNSDEFDAPLGSNT-GSSPVFNI  645
            R   ++S M  E+DE+L LF E+R+R+ E    LL   NS+EF+    ++T G+  ++ I
Sbjct  7    RKTKMKSRM--ERDEDLTLFRELRKRQNEHIPSLLHCVNSEEFECATTNDTHGNFSLYRI  64

Query  646  PSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            PS    RK    +FL  E +KNDYDWL TPP TPLF
Sbjct  65   PSG---RKEYGVEFL--ETNKNDYDWLKTPPATPLF  95



>gb|KHN34801.1| hypothetical protein glysoja_036794 [Glycine soja]
Length=1162

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = +1

Query  445  RAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNT  621
            R   S + +R  SL S + ++EKD++L LF EM+ RE+E     LLQ SD+ +    S  
Sbjct  13   REPRSDSHKRGRSLESGLPLREKDDDLALFSEMQSREEES---FLLQPSDDLEDSFSSKL  69

Query  622  GSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
               P   +  ++P R   ++  LN++ +KNDYDWLLTPP TPLF
Sbjct  70   RDFPDIKLGISIPGRGETSE-LLNTDGNKNDYDWLLTPPDTPLF  112



>ref|XP_004310048.1| PREDICTED: mucin-12 [Fragaria vesca subsp. vesca]
Length=1230

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            +++EKDE+L LF EM+ REKE  D LL   SD+ +    +       F +  A+PAR   
Sbjct  30   LVREKDEDLALFNEMQTREKE--DFLL--QSDDLEDTFSTKLRQFSDFKLGIAIPARGE-  84

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            + D LN E +KNDY+WLLTPP TPLF
Sbjct  85   SSDLLNVEEEKNDYEWLLTPPDTPLF  110



>ref|XP_006341750.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Solanum 
tuberosum]
Length=1134

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S + ++++D++L LF E++ RE+   D  LLQ++DE +    
Sbjct  13   RELRAE---NHKRGRSLESGIHLRDRDDDLSLFNEVQTRER---DNFLLQSNDEIEDLFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +  ++PAR   + D LN+E DKNDYDWLLTPP TPLF
Sbjct  67   TKLRYFSDYKLGISIPARGE-SSDLLNAEGDKNDYDWLLTPPDTPLF  112



>ref|XP_006341749.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Solanum 
tuberosum]
Length=1135

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S + ++++D++L LF E++ RE+   D  LLQ++DE +    
Sbjct  13   RELRAE---NHKRGRSLESGIHLRDRDDDLSLFNEVQTRER---DNFLLQSNDEIEDLFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +  ++PAR   + D LN+E DKNDYDWLLTPP TPLF
Sbjct  67   TKLRYFSDYKLGISIPARGE-SSDLLNAEGDKNDYDWLLTPPDTPLF  112



>ref|NP_001066471.1| Os12g0239000 [Oryza sativa Japonica Group]
 gb|ABA96860.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29490.1| Os12g0239000 [Oryza sativa Japonica Group]
Length=1174

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 6/99 (6%)
 Frame = +1

Query  460  LTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPV  636
            ++ +R  S  S++  K KD+EL LF +MR+ E+   D  LL++SD FD  + S     P 
Sbjct  15   ISHRRGHSFGSTVPAKPKDDELALFNDMRKNEE---DNFLLESSDNFDETI-SKLSYFPD  70

Query  637  FNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
              +   + AR+  + DFLN++ DKNDYDWLLTPP TPLF
Sbjct  71   LKLGVNI-ARREESRDFLNTDGDKNDYDWLLTPPETPLF  108



>ref|XP_002266100.1| PREDICTED: microtubule-associated protein futsch [Vitis vinifera]
 emb|CBI27564.3| unnamed protein product [Vitis vinifera]
Length=1184

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 4/86 (5%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            +++EKD++L LF +M+ REK   D  L+Q+SD+F+    +         +  ++PAR   
Sbjct  31   ILREKDDDLALFSDMQTREK---DNFLVQSSDDFEDTFSTKLRYFSDLKLGISVPARGE-  86

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            + D LN++ +KNDYDWLLTPP TPLF
Sbjct  87   SSDLLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_008218545.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Prunus 
mume]
Length=462

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +1

Query  502  KEKDEE-LGLFLEMRRREKERNDLLLLQ-NSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            K++D E L LF E+ +R+KERN L LLQ  SDEF+ P G+       + +     A+K  
Sbjct  42   KDRDHEDLILFRELHKRQKERNILSLLQPVSDEFE-PTGN-------YQLYRTAAAQKGS  93

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
              +FL +ENDKNDYDWL TPP TPLF
Sbjct  94   GFEFL-AENDKNDYDWLKTPPATPLF  118



>ref|XP_003532717.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 ref|XP_006585102.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
 ref|XP_006585103.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Glycine 
max]
 ref|XP_006585104.1| PREDICTED: dentin sialophosphoprotein-like isoform X4 [Glycine 
max]
Length=1175

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = +1

Query  442  FRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSN  618
             R   S + +R  SL S +  +EKD++L LF EM+ RE+E     LLQ SD+ +    S 
Sbjct  12   VREPRSDSHKRGRSLESGLPSREKDDDLALFSEMQSREEES---FLLQPSDDLEDSFSSK  68

Query  619  TGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                P   +  ++P R   ++  LN++ D+NDYDWLLTPP TPLF
Sbjct  69   LRDFPDIKLGISIPGRGETSE-LLNADGDENDYDWLLTPPDTPLF  112



>ref|XP_006448387.1| hypothetical protein CICLE_v10017970mg [Citrus clementina]
 gb|ESR61627.1| hypothetical protein CICLE_v10017970mg [Citrus clementina]
Length=440

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 7/81 (9%)
 Frame = +1

Query  511  DEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVADDFL  690
            DE+L LF E+ +REK+R   LL   SDEF+     N G+  ++ I S    +K   ++FL
Sbjct  73   DEDLVLFRELNKREKDRFASLLQPVSDEFEP----NAGNHALYRIGSG---KKGSGNEFL  125

Query  691  NSENDKNDYDWLLTPPGTPLF  753
               N+KNDYDWL TPP TPLF
Sbjct  126  GENNNKNDYDWLKTPPATPLF  146



>ref|XP_007158713.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
 ref|XP_007158714.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
 ref|XP_007158715.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
 ref|XP_007158716.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
 gb|ESW30707.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
 gb|ESW30708.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
 gb|ESW30709.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
 gb|ESW30710.1| hypothetical protein PHAVU_002G176100g [Phaseolus vulgaris]
Length=1177

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (59%), Gaps = 5/104 (5%)
 Frame = +1

Query  445  RAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNT  621
            R   S + +R  SL S + ++EKD++L LF EM+ REKE     LLQ SD+ +    +  
Sbjct  13   REPRSDSHKRGRSLESGLHLREKDDDLTLFSEMQSREKES---FLLQPSDDLEDSFSTKL  69

Query  622  GSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                   +  ++P R   ++  LN++ DKNDYDWLLTPP TPLF
Sbjct  70   RHFSDIKLGISIPGRGETSE-LLNADGDKNDYDWLLTPPDTPLF  112



>gb|KDP26761.1| hypothetical protein JCGZ_17919 [Jatropha curcas]
Length=1162

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 64/111 (58%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  R E     +R  SL   ++ KEKD++L LF EM+ +E+E     LLQ+SD+F+
Sbjct  9    YSPRREPRGE---NHKRGRSLEGGLVFKEKDDDLALFNEMQSKEREN---FLLQSSDDFE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +         +  ++P R   + + LN++ +KNDYDWLLTPP TPLF
Sbjct  63   DTFSTKLKHFSDLKLGISIPVRGE-SSELLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_006484045.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=1188

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (59%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  R E   + +R  S  S ++ +EKD++L LF EM+ +EKE     LLQ+SD+F+    
Sbjct  13   RELRGE---SHKRGRSFESGILFREKDDDLALFNEMQTKEKE---TFLLQSSDDFEDTFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +         +  ++P R   +D  LN++ +KNDYDWLLTPP TPLF
Sbjct  67   TKLRHFSDIKLGISIPVRGERSD-LLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_003601815.1| hypothetical protein MTR_3g085680 [Medicago truncatula]
Length=1197

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 64/118 (54%), Gaps = 26/118 (22%)
 Frame = +1

Query  466  KQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGS-----  627
             +R  SL S ++ +EKD++L LF EM+ RE+   D  LLQ+SD+ +   G+   S     
Sbjct  20   HKRRHSLESGILFREKDDDLTLFNEMQSRER---DTFLLQSSDDLEDSFGNFLCSFLIED  76

Query  628  -SPVF---------------NIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
              P F               N+  ++P R+ V  D LN + DKNDYDWLLTPP TPLF
Sbjct  77   NVPFFGFFIWATKLRHFSEVNVGISIPGRR-VNSDLLNVDGDKNDYDWLLTPPDTPLF  133



>ref|XP_011041562.1| PREDICTED: uncharacterized protein LOC105137499 isoform X2 [Populus 
euphratica]
Length=1212

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 64/111 (58%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RAE     +R  SL   ++ KEKDE+L LF EM+ RE+E     LLQ++D+F+
Sbjct  9    YSPGREPRAE---NHKRGRSLEGGLLFKEKDEDLALFNEMQSREREN---FLLQSADDFE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +         +  ++P R   ++  LN + +KNDYDWLLTPP TPLF
Sbjct  63   DSFSTKLRYFSDLKLGVSIPVRGENSE-LLNVDGEKNDYDWLLTPPETPLF  112



>ref|XP_010025346.1| PREDICTED: uncharacterized protein LOC104415705 [Eucalyptus grandis]
 gb|KCW61982.1| hypothetical protein EUGRSUZ_H04665 [Eucalyptus grandis]
Length=1145

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (60%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE   + +R  SL   ++ +EKD++L LF EM+ RE+   D  LLQ+ D+ +    
Sbjct  13   REMRAE---SHKRGRSLEGGLLFREKDDDLALFKEMQTRER---DNFLLQSDDDIEDVFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       F +  ++PAR   + D LN++ +KNDY+WL+TPP TPLF
Sbjct  67   TKLKHFSDFKLGISIPARGE-SSDLLNADGEKNDYEWLITPPDTPLF  112



>ref|XP_002315628.1| hypothetical protein POPTR_0010s06630g [Populus trichocarpa]
 gb|EEF01799.1| hypothetical protein POPTR_0010s06630g [Populus trichocarpa]
Length=1057

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 63/111 (57%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RAE     +R  SL   ++ KEKDE+L LF EM+ RE E     LLQ++D+F+
Sbjct  9    YSPGREPRAE---NHKRGRSLEGGLLFKEKDEDLALFNEMQSREGEN---FLLQSADDFE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +         +  ++P R   + + LN + +KNDYDWLLTPP TPLF
Sbjct  63   DSFSTKLRYFSDLKLGVSIPVRGE-SSELLNVDGEKNDYDWLLTPPETPLF  112



>ref|XP_007207838.1| hypothetical protein PRUPE_ppa023307mg [Prunus persica]
 gb|EMJ09037.1| hypothetical protein PRUPE_ppa023307mg [Prunus persica]
Length=191

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 11/86 (13%)
 Frame = +1

Query  502  KEKDEE-LGLFLEMRRREKERNDLLLLQ-NSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            K++D E L LF E+ +R+KERN L LLQ  SDEF+ P G+       + +     A+K  
Sbjct  53   KDRDHEDLILFQELHKRQKERNILSLLQPVSDEFE-PTGN-------YQLYRTAAAQKGS  104

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
              +FL +ENDKNDYDWL TPP TPLF
Sbjct  105  GFEFL-AENDKNDYDWLKTPPVTPLF  129



>emb|CDP13309.1| unnamed protein product [Coffea canephora]
Length=1149

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (60%), Gaps = 8/107 (7%)
 Frame = +1

Query  436  RSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLG  612
            R  RAE     +R  SL S ++ +++D++L LF E++ RE+   D  LLQ++D+F+    
Sbjct  13   RELRAE---NHKRGRSLESGILFRQRDDDLALFNEVQSRER---DNFLLQSNDDFEDLFS  66

Query  613  SNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +       + +   +P R   + D LN+E DKNDYDWLLTPP TPLF
Sbjct  67   NKLRYFSDYKLGINVPTRGE-SSDLLNAEGDKNDYDWLLTPPDTPLF  112



>ref|XP_008801868.1| PREDICTED: uncharacterized protein LOC103715870 [Phoenix dactylifera]
Length=1181

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +1

Query  463  TKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVF  639
            T +R  S  S +  K KD++L LF EM+ RE+E     LL ++D+FD  + S       F
Sbjct  20   THKRGQSFESGLTHKAKDDDLALFNEMQNREREN---FLLHSTDDFDDSI-SKLRYFSDF  75

Query  640  NIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
             +   +PAR   + D LN++ +KNDYDWLLTPP TPLF
Sbjct  76   KLNINIPARGE-SSDLLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_011015874.1| PREDICTED: uncharacterized protein LOC105119429 [Populus euphratica]
Length=402

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 7/84 (8%)
 Frame = +1

Query  502  KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVAD  681
            K++DE+L LF E+ RREK+R   LL   SDEF+    +  G+  ++ I S    RK    
Sbjct  18   KDRDEDLLLFKELHRREKDRLASLLQPVSDEFEP---NTAGNHALYRIASG---RKGSGY  71

Query  682  DFLNSENDKNDYDWLLTPPGTPLF  753
            +    ENDKNDYDWL TPP TPLF
Sbjct  72   ELF-GENDKNDYDWLKTPPATPLF  94



>ref|XP_006438105.1| hypothetical protein CICLE_v10030548mg [Citrus clementina]
 gb|ESR51345.1| hypothetical protein CICLE_v10030548mg [Citrus clementina]
Length=1188

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + +EKD++L LF EM+ +EKE     LLQ+SD+F+    +         +  ++P R   
Sbjct  31   LFREKDDDLALFNEMQTKEKE---TFLLQSSDDFEDTFSTKLRHFSDIKLGISIPVRGE-  86

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
              + LN++ +KNDYDWLLTPP TPLF
Sbjct  87   GSELLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_002315099.2| hypothetical protein POPTR_0010s18450g [Populus trichocarpa]
 gb|EEF01270.2| hypothetical protein POPTR_0010s18450g [Populus trichocarpa]
Length=407

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 7/84 (8%)
 Frame = +1

Query  502  KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVAD  681
            K++DE+L LF E++RREK+R   LL   SDEF+  +    G+  ++ I S    RK    
Sbjct  18   KDRDEDLLLFKELQRREKDRLACLLQPVSDEFEPNIA---GNHTLYRIASG---RKGSGY  71

Query  682  DFLNSENDKNDYDWLLTPPGTPLF  753
            +    ENDKN+YDWL TPP TPLF
Sbjct  72   ELF-GENDKNEYDWLKTPPATPLF  94



>ref|XP_011041561.1| PREDICTED: uncharacterized protein LOC105137499 isoform X1 [Populus 
euphratica]
Length=1216

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RAE     +R  SL   ++ KEKDE+L LF EM+ RE+E     LLQ++D+F+
Sbjct  9    YSPGREPRAE---NHKRGRSLEGGLLFKEKDEDLALFNEMQSREREN---FLLQSADDFE  62

Query  601  APLGSNTGSSPV-----FNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                 N  S+ +       +  ++P R   ++  LN + +KNDYDWLLTPP TPLF
Sbjct  63   DSF-CNCPSTKLRYFSDLKLGVSIPVRGENSE-LLNVDGEKNDYDWLLTPPETPLF  116



>ref|XP_010930074.1| PREDICTED: uncharacterized protein LOC105051371 isoform X2 [Elaeis 
guineensis]
Length=1184

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            M+K KD++L LF EM+ RE+E     LL ++D+ D  + S       F +   +PAR   
Sbjct  32   MLKAKDDDLALFNEMQNREREN---FLLHSTDDVDDSI-SKLRYFSDFKLNINIPARGE-  86

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            + D LN++ +KNDYDWLLTPP TPLF
Sbjct  87   SSDLLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_010930072.1| PREDICTED: uncharacterized protein LOC105051371 isoform X1 [Elaeis 
guineensis]
 ref|XP_010930073.1| PREDICTED: uncharacterized protein LOC105051371 isoform X1 [Elaeis 
guineensis]
Length=1188

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            M+K KD++L LF EM+ RE+E     LL ++D+ D  + S       F +   +PAR   
Sbjct  32   MLKAKDDDLALFNEMQNREREN---FLLHSTDDVDDSI-SKLRYFSDFKLNINIPARGE-  86

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            + D LN++ +KNDYDWLLTPP TPLF
Sbjct  87   SSDLLNADGEKNDYDWLLTPPDTPLF  112



>gb|KHG04576.1| RUN and FYVE domain-containing protein 2 [Gossypium arboreum]
Length=1141

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 66/111 (59%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  R E     +R  SL S + ++EKD++L LF EM+ +E+E     LLQ+SD+ +
Sbjct  9    YSPGRELRGE---NHKRWRSLESGLNVQEKDDDLALFNEMQSKEREN---FLLQSSDDAE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +       F +  ++P R   ++  L+++++KNDY+WLLTPP TPLF
Sbjct  63   DSFSTKLKYFSDFKLGISVPVRGETSE-LLDADDEKNDYEWLLTPPDTPLF  112



>gb|KDO82006.1| hypothetical protein CISIN_1g000989mg [Citrus sinensis]
Length=1072

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + +EKD++L LF EM+ +EKE     LLQ+SD+F+    +         +  ++P R   
Sbjct  31   LFREKDDDLALFNEMQTKEKE---TFLLQSSDDFEDTFSTKLRHFSDIKLGISIPVRGER  87

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            ++  LN++ +KNDYDWLLTPP TPLF
Sbjct  88   SE-LLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_011041563.1| PREDICTED: uncharacterized protein LOC105137499 isoform X3 [Populus 
euphratica]
Length=1183

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RAE     +R  SL   ++ KEKDE+L LF EM+ RE+E     LLQ++D+F+
Sbjct  9    YSPGREPRAE---NHKRGRSLEGGLLFKEKDEDLALFNEMQSREREN---FLLQSADDFE  62

Query  601  APLGSNTGSSPV-----FNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                 N  S+ +       +  ++P R   ++  LN + +KNDYDWLLTPP TPLF
Sbjct  63   DSF-CNCPSTKLRYFSDLKLGVSIPVRGENSE-LLNVDGEKNDYDWLLTPPETPLF  116



>gb|KDO82004.1| hypothetical protein CISIN_1g000989mg [Citrus sinensis]
Length=1197

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + +EKD++L LF EM+ +EKE     LLQ+SD+F+    +         +  ++P R   
Sbjct  31   LFREKDDDLALFNEMQTKEKE---TFLLQSSDDFEDTFSTKLRHFSDIKLGISIPVRGER  87

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            ++  LN++ +KNDYDWLLTPP TPLF
Sbjct  88   SE-LLNADGEKNDYDWLLTPPDTPLF  112



>ref|XP_006591470.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 ref|XP_006591471.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
 ref|XP_006591472.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Glycine 
max]
 gb|KHN44415.1| hypothetical protein glysoja_014456 [Glycine soja]
Length=1153

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 9/111 (8%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RA+     +R  SL S ++ +EKD++L LF EM+ REK   D  LLQ+SD+ +
Sbjct  9    YSPGREPRAD---GHKRGRSLESGLLFREKDDDLALFNEMQIREK---DSFLLQSSDDLE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +        N+  ++P R   + + LN + DKNDYDWLLTPP TPLF
Sbjct  63   DSFTTKLRHISDVNLGISIPGRGE-SSELLN-DGDKNDYDWLLTPPDTPLF  111



>emb|CDY48118.1| BnaC02g03750D [Brassica napus]
Length=506

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 8/84 (10%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + +++DEEL LFLE+ R EK     LL + SD       SNT S          P R+T 
Sbjct  2    LTQDRDEELVLFLEIGRLEKSHQASLLTKFSDHCK----SNTTSMSSQQ----YPPRRTA  53

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
            AD+FL SE++K+DYDWL+TPP +P
Sbjct  54   ADNFLYSEDEKSDYDWLVTPPDSP  77



>ref|XP_010045976.1| PREDICTED: uncharacterized protein LOC104434810 [Eucalyptus grandis]
Length=359

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 16/86 (19%)
 Frame = +1

Query  508  KDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPS--AMPARKTVA-  678
            KDE+L LF E+ RREK+R   LLL  S+EF+ P G          IP    +P  +T + 
Sbjct  22   KDEDLLLFRELHRREKDRTMNLLLPISNEFE-PNG----------IPGNYPLPIHRTASG  70

Query  679  -DDFLNSENDKNDYDWLLTPPGTPLF  753
              +FL +ENDKNDYDWL TPP TPLF
Sbjct  71   KSEFL-AENDKNDYDWLKTPPATPLF  95



>gb|KJB30996.1| hypothetical protein B456_005G171400 [Gossypium raimondii]
Length=1137

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 65/111 (59%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  R E     +R  SL S + ++EKD++L LF EM+ +E+E     LLQ+SD+ +
Sbjct  9    YSPGRELRGE---NHKRWRSLESGLNVQEKDDDLALFNEMQSKEREN---FLLQSSDDAE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +       F +  ++P R   ++  L+++ +KNDY+WLLTPP TPLF
Sbjct  63   DSFSTKLKYFSDFKLGISVPVRGETSE-LLDADEEKNDYEWLLTPPDTPLF  112



>ref|XP_002986701.1| hypothetical protein SELMODRAFT_446681 [Selaginella moellendorffii]
 gb|EFJ12264.1| hypothetical protein SELMODRAFT_446681 [Selaginella moellendorffii]
Length=522

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = +1

Query  508  KDEELGLFLEMRRREKERNDLLLLQNSDEFDAPL-GSNTGSSPVFNIPSAMPARKTVADD  684
            +DE+L LF +MR RE+    +      D+   PL GS+ G         A  AR   ++D
Sbjct  19   RDEDLALFQDMRIREEHNGSMEAAM--DQQHTPLHGSSNGKGSHIRGGLAH-ARSRGSND  75

Query  685  FLNSENDKNDYDWLLTPPGTPLF  753
             L SE DKNDYDWLLTPPGTPLF
Sbjct  76   LLTSETDKNDYDWLLTPPGTPLF  98



>ref|XP_008367047.1| PREDICTED: dentin sialophosphoprotein-like [Malus domestica]
Length=1243

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVA  678
            +KEKDE+L LF EM+ REKE  D LL   SD+ +    +N        +   +P R   +
Sbjct  32   LKEKDEDLALFNEMQTREKE--DFLL--QSDDLEVIFSTNMRQFSDVKLGITIPTRGE-S  86

Query  679  DDFLNSENDKNDYDWLLTPPGTPLF  753
             D  N E +KNDYDWL+TPP TPLF
Sbjct  87   SDLFNVEGEKNDYDWLVTPPDTPLF  111



>ref|XP_006850316.1| hypothetical protein AMTR_s00020p00207770 [Amborella trichopoda]
 gb|ERN11897.1| hypothetical protein AMTR_s00020p00207770 [Amborella trichopoda]
Length=1060

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            M  +KD++L LF +M  RE+   D  LL ++D+F+  +  N      F +  ++PAR   
Sbjct  37   MKGDKDDDLALFNDMHTRER---DNFLLPSADDFEDSISMNLRYFSDFKLGISIPARGE-  92

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
            + D LN++ +KNDYDWLLTPP TPLF
Sbjct  93   SSDLLNADGNKNDYDWLLTPPDTPLF  118



>gb|ADK60792.1| hypothetical protein, partial [Arachis diogoi]
Length=75

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREK--ERNDLLLLQNSDEFD-APLGSNTGSSPVFNIPSAMPAR  666
            ++KE+DEEL LFLEMRR+EK  E+N+LL LQ+S+E D + L SN  +S +  I S++P R
Sbjct  10   VMKERDEELALFLEMRRKEKENEKNNLLFLQDSEELDLSNLESNRENSTISKIVSSVPPR  69

Query  667  KTVADD  684
            KT  ++
Sbjct  70   KTGVEE  75



>emb|CDY55901.1| BnaAnng13940D [Brassica napus]
Length=506

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + +++DEEL LFLE+ R EK     LL   SD       SNT S          P R+T 
Sbjct  2    LTQDRDEELVLFLEIGRLEKSHQASLLTNFSDHCK----SNTTSMSSQQ----YPPRRTA  53

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
            AD+FL SE++K+DYDWL+TPP +P
Sbjct  54   ADNFLYSEDEKSDYDWLVTPPDSP  77



>ref|XP_008662601.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Zea mays]
Length=1180

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 6/87 (7%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSS--PVFNIPSAMPARKT  672
            +K KD+EL LF +M++ E E     LL+ S++FD  +GS +  S  P   +   +PA   
Sbjct  31   VKSKDDELALFSDMQKVETEN---FLLEPSEDFDDSIGSASKLSYFPEVKLGVNIPAHGE  87

Query  673  VADDFLNSENDKNDYDWLLTPPGTPLF  753
             + + LN++++KNDY+WLLTPP TPLF
Sbjct  88   -SHNLLNADDNKNDYEWLLTPPETPLF  113



>ref|XP_008662602.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Zea mays]
Length=1179

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 6/87 (7%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSS--PVFNIPSAMPARKT  672
            +K KD+EL LF +M++ E E     LL+ S++FD  +GS +  S  P   +   +PA   
Sbjct  31   VKSKDDELALFSDMQKVETEN---FLLEPSEDFDDSIGSASKLSYFPEVKLGVNIPAHGE  87

Query  673  VADDFLNSENDKNDYDWLLTPPGTPLF  753
             + + LN++++KNDY+WLLTPP TPLF
Sbjct  88   -SHNLLNADDNKNDYEWLLTPPETPLF  113



>ref|XP_009125427.1| PREDICTED: uncharacterized protein DDB_G0271670 [Brassica rapa]
Length=536

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + +++DEEL LFLE+ R EK     LL   SD       SNT S          P R+T 
Sbjct  32   LTQDRDEELVLFLEIGRLEKSHQASLLTNFSDHCK----SNTTSMSS----QQYPPRRTA  83

Query  676  ADDFLNSENDKNDYDWLLTPPGTP  747
            AD+FL SE++K+DYDWL+TPP +P
Sbjct  84   ADNFLYSEDEKSDYDWLVTPPDSP  107



>ref|XP_003551686.2| PREDICTED: dentin sialophosphoprotein-like [Glycine max]
Length=1156

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 64/111 (58%), Gaps = 9/111 (8%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RA+     +R  SL S ++ +EK ++L LF EM+ REK   D  LLQ+SD+ +
Sbjct  9    YSPGREPRAD---GHKRGRSLESGLLFREKGDDLALFNEMQSREK---DSFLLQSSDDLE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +        N+  ++P R   ++  LN + DKNDYDWLLTPP TPLF
Sbjct  63   DSFTTKLRHISDVNLGISIPGRGETSE-LLN-DGDKNDYDWLLTPPDTPLF  111



>ref|XP_006842565.1| hypothetical protein AMTR_s00077p00146340 [Amborella trichopoda]
 gb|ERN04240.1| hypothetical protein AMTR_s00077p00146340 [Amborella trichopoda]
Length=557

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 11/88 (13%)
 Frame = +1

Query  490  SSMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARK  669
            S + KEKDE L LF    R        + + +SDE ++P+  N+       + SA P  +
Sbjct  14   SGIPKEKDENLQLFHSNHRS-------MFIPSSDESESPI--NSARLGRIAVASAKP--R  62

Query  670  TVADDFLNSENDKNDYDWLLTPPGTPLF  753
            T  DD LN+E  K+DYDWLLTPPGTPLF
Sbjct  63   TGMDDLLNTEYGKHDYDWLLTPPGTPLF  90



>ref|XP_007045001.1| Uncharacterized protein TCM_010765 [Theobroma cacao]
 gb|EOY00833.1| Uncharacterized protein TCM_010765 [Theobroma cacao]
Length=1164

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  R E     +R  SL S +I +EKD++L LF EM+ +E+E     LLQ S++F+
Sbjct  9    YSPGRELRGE---NHKRGRSLESGLIVREKDDDLALFNEMQSKEREN---FLLQASEDFE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                +         +  ++P R   + + L ++ +KNDY+WLLTPP TPLF
Sbjct  63   DTFSTKLKHFSDLKLGISIPVRGE-SSELLTADEEKNDYEWLLTPPDTPLF  112



>ref|XP_004304828.1| PREDICTED: uncharacterized protein LOC101311986 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=419

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = +1

Query  511  DEELGLFLEMRRREKERNDLLLLQ-NSDEFDAPLGSNTGSSPVFNIPSAMPARKTVADDF  687
            D++L LF E+ +REKERN + LLQ  S+EF+       G+  ++ I SA   +K    + 
Sbjct  33   DQDLILFQELHKREKERNIVTLLQPVSEEFEP-----NGNHQLYRIASA---KKGSGFES  84

Query  688  LNSENDKNDYDWLLTPPGTPLF  753
            L +EN+KNDYDWL TPP TPLF
Sbjct  85   L-AENEKNDYDWLKTPPATPLF  105



>ref|XP_007163731.1| hypothetical protein PHAVU_001G259600g [Phaseolus vulgaris]
 gb|ESW35725.1| hypothetical protein PHAVU_001G259600g [Phaseolus vulgaris]
Length=1164

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +1

Query  463  TKQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVF  639
            T +R  SL S ++ +EKDE+L LF EM+ REKE     LLQ +D+ +    +        
Sbjct  19   THKRGRSLESGLLFREKDEDLTLFNEMQSREKES---FLLQLTDDLEDSFSTKLKHISDV  75

Query  640  NIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            N+  ++P R   + + LN + +KNDYDWLLTPP TPLF
Sbjct  76   NLGISIPGRGE-SSELLN-DGEKNDYDWLLTPPDTPLF  111



>ref|XP_011029646.1| PREDICTED: uncharacterized protein LOC105129339 isoform X1 [Populus 
euphratica]
Length=1173

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRS-SMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RA+     +R  SL   S+++EKD++L LF EM+ RE+E     LLQ++ +F+
Sbjct  9    YSPGREPRAD---NHKRGHSLEGGSLLEEKDDDLALFNEMQSRERES---FLLQSAGDFE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                S       F +  ++P R   ++  LN + +K+DYDWLLTPP TPLF
Sbjct  63   DTFSSKLRYFSDFKLEVSIPVRGENSE-LLNIDGEKDDYDWLLTPPDTPLF  112



>ref|XP_011029647.1| PREDICTED: uncharacterized protein LOC105129339 isoform X2 [Populus 
euphratica]
Length=1172

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 8/111 (7%)
 Frame = +1

Query  424  YAMNRSFRAEESLTKQRMGSLRS-SMIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFD  600
            Y+  R  RA+     +R  SL   S+++EKD++L LF EM+ RE+E     LLQ++ +F+
Sbjct  9    YSPGREPRAD---NHKRGHSLEGGSLLEEKDDDLALFNEMQSRERES---FLLQSAGDFE  62

Query  601  APLGSNTGSSPVFNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
                S       F +  ++P R   ++  LN + +K+DYDWLLTPP TPLF
Sbjct  63   DTFSSKLRYFSDFKLEVSIPVRGENSE-LLNIDGEKDDYDWLLTPPDTPLF  112



>ref|XP_008444430.1| PREDICTED: signaling mucin MSB2 isoform X2 [Cucumis melo]
Length=1155

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVA  678
            I+EKD++L LF EM+ RE+E     LLQ++++ +    +         +  ++P R   +
Sbjct  34   IREKDDDLALFNEMQTREREG---FLLQSAEDLEDSFSTKLRHFSDLKLGISIPVRGENS  90

Query  679  DDFLNSENDKNDYDWLLTPPGTPLF  753
            D   N E +KNDYDWLLTPP TPLF
Sbjct  91   DLLNNVETEKNDYDWLLTPPDTPLF  115



>ref|XP_008444428.1| PREDICTED: signaling mucin MSB2 isoform X1 [Cucumis melo]
 ref|XP_008444429.1| PREDICTED: signaling mucin MSB2 isoform X1 [Cucumis melo]
Length=1156

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +1

Query  499  IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVA  678
            I+EKD++L LF EM+ RE+E     LLQ++++ +    +         +  ++P R   +
Sbjct  34   IREKDDDLALFNEMQTREREG---FLLQSAEDLEDSFSTKLRHFSDLKLGISIPVRGENS  90

Query  679  DDFLNSENDKNDYDWLLTPPGTPLF  753
            D   N E +KNDYDWLLTPP TPLF
Sbjct  91   DLLNNVETEKNDYDWLLTPPDTPLF  115



>ref|XP_004159580.1| PREDICTED: uncharacterized protein LOC101229973 [Cucumis sativus]
Length=1159

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +1

Query  466  KQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFN  642
             +R  S  S++ I+EKD++L LF EM+ RE+E     LLQ++++ +    +         
Sbjct  22   HKRGHSFESAVRIREKDDDLALFNEMQTREREG---FLLQSAEDLEDSFSTKLRHFSDLK  78

Query  643  IPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +  ++P R   +D   N E +KNDYDWLLTPP TPLF
Sbjct  79   LGISIPVRGENSDLLNNVEAEKNDYDWLLTPPDTPLF  115



>ref|XP_004143045.1| PREDICTED: uncharacterized protein LOC101205907 [Cucumis sativus]
 gb|KGN62363.1| hypothetical protein Csa_2G350460 [Cucumis sativus]
Length=1159

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = +1

Query  466  KQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFN  642
             +R  S  S++ I+EKD++L LF EM+ RE+E     LLQ++++ +    +         
Sbjct  22   HKRGHSFESAVRIREKDDDLALFNEMQTREREG---FLLQSAEDLEDSFSTKLRHFSDLK  78

Query  643  IPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +  ++P R   +D   N E +KNDYDWLLTPP TPLF
Sbjct  79   LGISIPVRGENSDLLNNVEAEKNDYDWLLTPPDTPLF  115



>ref|XP_010478134.1| PREDICTED: uncharacterized protein LOC104757115 [Camelina sativa]
 ref|XP_010478136.1| PREDICTED: uncharacterized protein LOC104757115 [Camelina sativa]
Length=1153

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + ++KD++L LF EM+ +E+   D  LLQ+SD+ +    +       F IP    + +  
Sbjct  31   LFRDKDDDLALFSEMQDKER---DSFLLQSSDDLEDAFSTKLKHFSEFTIPVQGESSR--  85

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
                L +E DKNDYDWLLTPP TPLF
Sbjct  86   ---LLTAEGDKNDYDWLLTPPDTPLF  108



>ref|XP_010499276.1| PREDICTED: uncharacterized protein LOC104776836 [Camelina sativa]
 ref|XP_010499277.1| PREDICTED: uncharacterized protein LOC104776836 [Camelina sativa]
Length=1146

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + ++KD++L LF EM+ +E+   D  LLQ+SD+ +    +       F IP    + +  
Sbjct  31   LFRDKDDDLALFSEMQDKER---DSFLLQSSDDLEDAFSTKLKHFSEFTIPVQGESSR--  85

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
                L +E DKNDYDWLLTPP TPLF
Sbjct  86   ---LLTAEGDKNDYDWLLTPPDTPLF  108



>ref|XP_010460547.1| PREDICTED: uncharacterized protein LOC104741389 [Camelina sativa]
 ref|XP_010460548.1| PREDICTED: uncharacterized protein LOC104741389 [Camelina sativa]
 ref|XP_010460549.1| PREDICTED: uncharacterized protein LOC104741389 [Camelina sativa]
Length=1149

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + ++KD++L LF EM+ +E+   D  LLQ+SD+ +    +       F IP    + +  
Sbjct  31   LFRDKDDDLALFSEMQDKER---DSFLLQSSDDLEDAFSTKLKHFSEFTIPVQGESSR--  85

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
                L +E DKNDYDWLLTPP TPLF
Sbjct  86   ---LLTAEGDKNDYDWLLTPPDTPLF  108



>ref|XP_006415723.1| hypothetical protein EUTSA_v10006616mg [Eutrema salsugineum]
 gb|ESQ34076.1| hypothetical protein EUTSA_v10006616mg [Eutrema salsugineum]
Length=1143

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + ++KD++L LF EM+ +E+   D  LLQ+SD+ +    +       F IP    + +  
Sbjct  31   LFRDKDDDLALFSEMQDKER---DGFLLQSSDDLEDAFSTKLKHFSEFTIPVQGESSR--  85

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
                L++E DKNDYDWLLTPP TPLF
Sbjct  86   ---LLSAEGDKNDYDWLLTPPDTPLF  108



>gb|KHN24087.1| hypothetical protein glysoja_025260 [Glycine soja]
Length=1156

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = +1

Query  466  KQRMGSLRSSMI-KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFN  642
             +R  SL S ++ +EK ++L LF EM+ REK   D  LLQ+SD+ +    +        N
Sbjct  20   HKRGRSLESGLLFREKGDDLALFNEMQSREK---DSFLLQSSDDLEDSFTTKLRHISDVN  76

Query  643  IPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
            +  ++P R   ++  LN + DKNDYDWLLTPP TPLF
Sbjct  77   LGISIPGRGETSE-LLN-DGDKNDYDWLLTPPDTPLF  111



>ref|XP_006303891.1| hypothetical protein CARUB_v10008135mg [Capsella rubella]
 gb|EOA36789.1| hypothetical protein CARUB_v10008135mg [Capsella rubella]
Length=1149

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +1

Query  496  MIKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTV  675
            + ++KD++L LF EM+ +E+   D  LLQ+SD+ +    +       F IP    + +  
Sbjct  31   LFRDKDDDLALFNEMQDKER---DSFLLQSSDDLEDAFSTKLKHFSEFTIPVQGESSR--  85

Query  676  ADDFLNSENDKNDYDWLLTPPGTPLF  753
                L +E DKNDYDWLLTPP TPLF
Sbjct  86   ---LLTAEGDKNDYDWLLTPPDTPLF  108



>ref|XP_006663925.1| PREDICTED: dentin sialophosphoprotein-like [Oryza brachyantha]
Length=1171

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = +1

Query  460  LTKQRMGSLRSSM-IKEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPV  636
            ++ +R  S  S++  K KD+EL LF +M++ +K   D  LL++SD FD  + S     P 
Sbjct  15   ISHRRGRSFGSAVPAKSKDDELTLFSDMQKNDK---DNFLLESSDNFDETI-SKLSYFPD  70

Query  637  FNIPSAMPARKTVADDFLNSENDKNDYDWLLTPPGTPLF  753
              +   + AR+    DFLN + +KNDYDWLLTPP TPLF
Sbjct  71   LKLGVNI-ARREENRDFLNVDGEKNDYDWLLTPPETPLF  108



>ref|XP_010927925.1| PREDICTED: uncharacterized protein LOC105049853 [Elaeis guineensis]
Length=358

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = +1

Query  502  KEKDEELGLFLEMRRREKERNDLLLLQNSDEFDAPLGSNTGSSPVFNIPSAMPARKTVAD  681
            KE+DE+L LF EM +REKER   LL   SDEF+       G+ P++ I            
Sbjct  17   KEQDEDLLLFREMFKREKERTMSLLQPVSDEFEP----GHGNYPLYKI------------  60

Query  682  DFLNSENDKNDYDWLLTPPGTPLF  753
                S ++KNDYDWL TPP TPLF
Sbjct  61   ----SSSEKNDYDWLKTPPATPLF  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050