BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041M24

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004253108.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    228   5e-66   Solanum lycopersicum
ref|XP_006342519.1|  PREDICTED: probable peptide transporter At1g...    226   7e-66   Solanum tuberosum [potatoes]
ref|XP_009787108.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            221   6e-64   Nicotiana sylvestris
ref|XP_009607662.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       219   3e-63   Nicotiana tomentosiformis
ref|XP_011090875.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    197   3e-55   Sesamum indicum [beniseed]
gb|EYU29274.1|  hypothetical protein MIMGU_mgv1a003369mg                195   3e-54   Erythranthe guttata [common monkey flower]
emb|CDP16183.1|  unnamed protein product                                191   4e-53   Coffea canephora [robusta coffee]
emb|CDP16193.1|  unnamed protein product                                189   3e-52   Coffea canephora [robusta coffee]
emb|CDP16194.1|  unnamed protein product                                189   4e-52   Coffea canephora [robusta coffee]
emb|CDP16191.1|  unnamed protein product                                188   9e-52   Coffea canephora [robusta coffee]
ref|XP_010691376.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            184   2e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010047267.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    181   3e-49   
gb|KDO38215.1|  hypothetical protein CISIN_1g041538mg                   172   6e-49   Citrus sinensis [apfelsine]
ref|XP_006422795.1|  hypothetical protein CICLE_v10029930mg             179   1e-48   
ref|XP_006422797.1|  hypothetical protein CICLE_v10029786mg             179   1e-48   
ref|XP_006486909.1|  PREDICTED: probable peptide transporter At1g...    177   1e-47   Citrus sinensis [apfelsine]
ref|XP_010254052.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            177   1e-47   Nelumbo nucifera [Indian lotus]
gb|KDO79777.1|  hypothetical protein CISIN_1g008264mg                   176   3e-47   Citrus sinensis [apfelsine]
ref|XP_006476064.1|  PREDICTED: probable peptide transporter At1g...    175   3e-47   Citrus sinensis [apfelsine]
ref|XP_006450663.1|  hypothetical protein CICLE_v10007857mg             175   5e-47   Citrus clementina [clementine]
ref|XP_010318545.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       175   5e-47   
ref|XP_006486905.1|  PREDICTED: probable peptide transporter At1g...    174   1e-46   
ref|XP_006343083.1|  PREDICTED: probable peptide transporter At1g...    174   1e-46   
ref|XP_004235680.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       174   1e-46   Solanum lycopersicum
ref|XP_006476061.1|  PREDICTED: probable peptide transporter At1g...    174   1e-46   Citrus sinensis [apfelsine]
ref|XP_006486906.1|  PREDICTED: probable peptide transporter At1g...    174   2e-46   Citrus sinensis [apfelsine]
gb|KDO79783.1|  hypothetical protein CISIN_1g039943mg                   174   2e-46   Citrus sinensis [apfelsine]
gb|KDP37260.1|  hypothetical protein JCGZ_06316                         173   3e-46   Jatropha curcas
ref|XP_006426938.1|  hypothetical protein CICLE_v10025189mg             173   5e-46   Citrus clementina [clementine]
ref|XP_002516544.1|  nitrate transporter, putative                      172   7e-46   Ricinus communis
ref|XP_006465634.1|  PREDICTED: probable peptide transporter At1g...    172   7e-46   Citrus sinensis [apfelsine]
ref|XP_006450665.1|  hypothetical protein CICLE_v10010641mg             172   7e-46   Citrus clementina [clementine]
ref|XP_003522705.1|  PREDICTED: probable peptide transporter At1g...    171   1e-45   Glycine max [soybeans]
gb|KHN10207.1|  Putative peptide transporter                            171   1e-45   Glycine soja [wild soybean]
gb|KJB56778.1|  hypothetical protein B456_009G135700                    171   2e-45   Gossypium raimondii
ref|XP_007019700.1|  Nitrate transporter, putative                      171   2e-45   
ref|XP_009783586.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       171   2e-45   Nicotiana sylvestris
emb|CDY69519.1|  BnaAnng30710D                                          165   2e-45   Brassica napus [oilseed rape]
ref|XP_009628045.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       171   3e-45   Nicotiana tomentosiformis
emb|CDY69522.1|  BnaCnng63980D                                          164   3e-45   Brassica napus [oilseed rape]
ref|XP_006343084.1|  PREDICTED: probable peptide transporter At1g...    170   3e-45   Solanum tuberosum [potatoes]
ref|XP_006343081.1|  PREDICTED: probable peptide transporter At1g...    169   8e-45   Solanum tuberosum [potatoes]
ref|XP_008462682.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       168   2e-44   Cucumis melo [Oriental melon]
ref|XP_010654644.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            168   2e-44   Vitis vinifera
ref|XP_002299719.2|  hypothetical protein POPTR_0001s18640g             168   3e-44   Populus trichocarpa [western balsam poplar]
gb|KEH28715.1|  peptide/nitrate transporter plant                       167   3e-44   Medicago truncatula
ref|XP_011008319.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            167   4e-44   Populus euphratica
ref|XP_011019627.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       167   5e-44   Populus euphratica
gb|KHG04534.1|  hypothetical protein F383_29859                         167   5e-44   Gossypium arboreum [tree cotton]
gb|KJB59595.1|  hypothetical protein B456_009G262700                    167   5e-44   Gossypium raimondii
ref|XP_004235683.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       167   5e-44   Solanum lycopersicum
ref|XP_007024207.1|  Major facilitator superfamily protein, putative    166   6e-44   
ref|XP_011026618.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       160   7e-44   Populus euphratica
ref|XP_007150641.1|  hypothetical protein PHAVU_005G169400g             166   8e-44   Phaseolus vulgaris [French bean]
ref|XP_010487466.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       166   8e-44   Camelina sativa [gold-of-pleasure]
gb|KCW79141.1|  hypothetical protein EUGRSUZ_C00586                     163   9e-44   Eucalyptus grandis [rose gum]
ref|XP_002516008.1|  nitrate transporter, putative                      166   9e-44   Ricinus communis
ref|XP_011026619.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    166   1e-43   Populus euphratica
ref|XP_002308609.1|  hypothetical protein POPTR_0006s25670g             166   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004151437.1|  PREDICTED: probable peptide transporter At1g...    166   1e-43   Cucumis sativus [cucumbers]
ref|XP_006392949.1|  hypothetical protein EUTSA_v10011325mg             166   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_009786716.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       166   2e-43   Nicotiana sylvestris
ref|XP_004171650.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    165   2e-43   
emb|CDY20187.1|  BnaA01g28150D                                          160   2e-43   Brassica napus [oilseed rape]
ref|XP_009147706.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            165   3e-43   Brassica rapa
gb|KJB18644.1|  hypothetical protein B456_003G064500                    164   3e-43   Gossypium raimondii
gb|KJB33640.1|  hypothetical protein B456_006G023500                    164   4e-43   Gossypium raimondii
ref|XP_006297268.1|  hypothetical protein CARUB_v10013282mg             164   5e-43   Capsella rubella
ref|XP_007024218.1|  Major facilitator superfamily protein              164   5e-43   
ref|XP_009593688.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       164   6e-43   Nicotiana tomentosiformis
ref|XP_010545694.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       164   7e-43   Tarenaya hassleriana [spider flower]
ref|XP_010503915.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       164   7e-43   Camelina sativa [gold-of-pleasure]
gb|AAM61194.1|  unknown                                                 158   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006596167.1|  PREDICTED: probable peptide transporter At1g...    164   8e-43   Glycine max [soybeans]
ref|XP_002885127.1|  proton-dependent oligopeptide transport fami...    163   1e-42   Arabidopsis lyrata subsp. lyrata
emb|CDP21289.1|  unnamed protein product                                163   1e-42   Coffea canephora [robusta coffee]
ref|XP_010668254.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       163   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006343082.1|  PREDICTED: probable peptide transporter At1g...    162   1e-42   
ref|XP_010318543.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    163   2e-42   Solanum lycopersicum
ref|XP_010318544.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    163   2e-42   
ref|XP_004235682.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    163   2e-42   
ref|NP_188239.1|  nitrate transporter 1.12                              162   2e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30141.1|  BnaC05g37210D                                          162   2e-42   Brassica napus [oilseed rape]
gb|AAM20441.1|  putative transport protein                              162   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KFK35804.1|  hypothetical protein AALP_AA4G038900                    162   3e-42   Arabis alpina [alpine rockcress]
emb|CDX97728.1|  BnaA05g23510D                                          162   3e-42   
ref|XP_004252349.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            162   3e-42   Solanum lycopersicum
ref|XP_010062498.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       162   4e-42   
ref|XP_007135665.1|  hypothetical protein PHAVU_010G148000g             161   6e-42   Phaseolus vulgaris [French bean]
emb|CDY70561.1|  BnaCnng68850D                                          160   6e-42   Brassica napus [oilseed rape]
ref|XP_007137205.1|  hypothetical protein PHAVU_009G108400g             161   6e-42   Phaseolus vulgaris [French bean]
ref|XP_009114876.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    161   7e-42   Brassica rapa
ref|XP_004506898.1|  PREDICTED: probable peptide transporter At1g...    161   7e-42   
ref|XP_004141840.1|  PREDICTED: probable peptide transporter At1g...    161   8e-42   
gb|KFK38969.1|  hypothetical protein AALP_AA3G183300                    160   8e-42   Arabis alpina [alpine rockcress]
ref|XP_006359461.1|  PREDICTED: probable peptide transporter At1g...    160   9e-42   Solanum tuberosum [potatoes]
gb|KHG12398.1|  hypothetical protein F383_17450                         160   1e-41   Gossypium arboreum [tree cotton]
ref|XP_006306954.1|  hypothetical protein CARUB_v10008522mg             160   1e-41   
ref|XP_009146163.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1            160   1e-41   Brassica rapa
ref|NP_175630.1|  nitrate transporter 1.11                              160   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011072387.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            159   2e-41   Sesamum indicum [beniseed]
ref|XP_011081806.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       159   2e-41   Sesamum indicum [beniseed]
ref|XP_010098095.1|  putative peptide transporter                       159   3e-41   Morus notabilis
ref|XP_006406868.1|  hypothetical protein EUTSA_v10020365mg             159   3e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010648805.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       159   3e-41   Vitis vinifera
ref|XP_002324234.2|  hypothetical protein POPTR_0018s00490g             159   3e-41   Populus trichocarpa [western balsam poplar]
gb|KHM98741.1|  Putative peptide transporter                            159   4e-41   Glycine soja [wild soybean]
ref|XP_003530142.1|  PREDICTED: probable peptide transporter At1g...    159   4e-41   Glycine max [soybeans]
gb|AFK45207.1|  unknown                                                 152   5e-41   Medicago truncatula
ref|XP_003546477.1|  PREDICTED: probable peptide transporter At1g...    158   6e-41   Glycine max [soybeans]
ref|XP_006371703.1|  hypothetical protein POPTR_0018s00450g             158   9e-41   
ref|XP_002891678.1|  proton-dependent oligopeptide transport fami...    158   9e-41   Arabidopsis lyrata subsp. lyrata
gb|KGN45387.1|  hypothetical protein Csa_7G447020                       158   9e-41   Cucumis sativus [cucumbers]
gb|KEH40280.1|  peptide/nitrate transporter plant                       157   1e-40   Medicago truncatula
ref|XP_010500813.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       157   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009352687.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       157   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_010668239.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       157   2e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002324232.2|  hypothetical protein POPTR_0018s00440g             157   2e-40   
ref|XP_011013128.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       157   2e-40   Populus euphratica
ref|XP_006475659.1|  PREDICTED: probable peptide transporter At1g...    157   2e-40   Citrus sinensis [apfelsine]
gb|KDO66442.1|  hypothetical protein CISIN_1g007910mg                   157   2e-40   Citrus sinensis [apfelsine]
ref|XP_011026621.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       157   2e-40   Populus euphratica
ref|XP_006451203.1|  hypothetical protein CICLE_v10007831mg             157   2e-40   Citrus clementina [clementine]
ref|XP_002324233.2|  hypothetical protein POPTR_0018s00480g             156   2e-40   
ref|XP_011026623.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       157   2e-40   Populus euphratica
ref|XP_011026620.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    157   2e-40   Populus euphratica
ref|XP_007012104.1|  Major facilitator superfamily protein              157   2e-40   
ref|XP_009787173.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    155   2e-40   Nicotiana sylvestris
ref|XP_010100643.1|  putative peptide/nitrate transporter               156   2e-40   Morus notabilis
ref|XP_003597726.1|  hypothetical protein MTR_2g101610                  157   3e-40   Medicago truncatula
gb|KJB27307.1|  hypothetical protein B456_004G290100                    156   3e-40   Gossypium raimondii
ref|XP_006371704.1|  hypothetical protein POPTR_0018s00460g             156   3e-40   
ref|XP_010049663.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       156   3e-40   Eucalyptus grandis [rose gum]
ref|XP_010050380.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       156   3e-40   
ref|XP_011026624.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       156   3e-40   Populus euphratica
gb|KCW79098.1|  hypothetical protein EUGRSUZ_C00542                     155   4e-40   Eucalyptus grandis [rose gum]
ref|XP_003597725.1|  hypothetical protein MTR_2g101590                  156   4e-40   Medicago truncatula
ref|XP_010479721.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    155   5e-40   Camelina sativa [gold-of-pleasure]
emb|CBI20867.3|  unnamed protein product                                159   5e-40   Vitis vinifera
ref|XP_003531667.1|  PREDICTED: probable peptide transporter At1g...    155   5e-40   Glycine max [soybeans]
ref|XP_010462057.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       155   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009787172.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    155   6e-40   Nicotiana sylvestris
ref|XP_003597722.1|  hypothetical protein MTR_2g101560                  155   6e-40   
ref|XP_009416500.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       155   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP33700.1|  hypothetical protein JCGZ_07271                         155   7e-40   Jatropha curcas
ref|XP_011026626.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       155   9e-40   Populus euphratica
ref|XP_010479719.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    155   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006465636.1|  PREDICTED: probable peptide transporter At1g...    154   1e-39   
ref|XP_009621369.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    154   1e-39   Nicotiana tomentosiformis
ref|XP_003597728.1|  hypothetical protein MTR_2g101640                  155   1e-39   Medicago truncatula
ref|XP_007204860.1|  hypothetical protein PRUPE_ppa023390mg             154   2e-39   Prunus persica
ref|XP_010479720.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    154   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_004301550.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       154   2e-39   Fragaria vesca subsp. vesca
ref|XP_007135664.1|  hypothetical protein PHAVU_010G147900g             154   2e-39   Phaseolus vulgaris [French bean]
ref|XP_009609879.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       150   2e-39   
ref|XP_008242634.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       153   3e-39   Prunus mume [ume]
ref|XP_004498697.1|  PREDICTED: probable peptide transporter At1g...    152   6e-39   
dbj|BAG91471.1|  unnamed protein product                                152   6e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044324.1|  Os01g0761500                                       152   7e-39   
gb|EAY75908.1|  hypothetical protein OsI_03828                          152   1e-38   Oryza sativa Indica Group [Indian rice]
gb|KHN04222.1|  Putative peptide transporter                            152   1e-38   Glycine soja [wild soybean]
ref|XP_011090957.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    151   1e-38   Sesamum indicum [beniseed]
ref|XP_003529761.1|  PREDICTED: probable peptide transporter At1g...    151   1e-38   Glycine max [soybeans]
ref|XP_008675020.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       152   1e-38   
ref|XP_004239355.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    151   2e-38   
ref|XP_010051584.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       151   2e-38   Eucalyptus grandis [rose gum]
ref|XP_006585587.1|  PREDICTED: probable peptide transporter At1g...    151   2e-38   
ref|XP_009788943.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       151   2e-38   Nicotiana sylvestris
ref|XP_011026625.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       151   2e-38   Populus euphratica
gb|KHN47833.1|  Putative peptide transporter                            151   2e-38   Glycine soja [wild soybean]
ref|XP_003546946.1|  PREDICTED: probable peptide transporter At1g...    151   2e-38   Glycine max [soybeans]
ref|XP_003531668.2|  PREDICTED: probable peptide transporter At1g...    151   2e-38   Glycine max [soybeans]
gb|KHM98742.1|  Putative peptide transporter                            150   2e-38   Glycine soja [wild soybean]
gb|KHN10296.1|  Putative peptide transporter                            150   3e-38   Glycine soja [wild soybean]
tpg|DAA57517.1|  TPA: hypothetical protein ZEAMMB73_958340              150   4e-38   
ref|XP_003630771.1|  hypothetical protein MTR_8g103250                  150   4e-38   
ref|XP_011040515.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       150   4e-38   Populus euphratica
emb|CDO98012.1|  unnamed protein product                                150   6e-38   Coffea canephora [robusta coffee]
gb|KHN41645.1|  Putative peptide transporter                            149   7e-38   Glycine soja [wild soybean]
ref|XP_003524398.1|  PREDICTED: probable peptide transporter At1g...    149   7e-38   Glycine max [soybeans]
ref|XP_006475661.1|  PREDICTED: probable peptide/nitrate transpor...    145   8e-38   
ref|XP_006355949.1|  PREDICTED: probable peptide transporter At1g...    149   9e-38   Solanum tuberosum [potatoes]
ref|XP_010320609.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       149   1e-37   Solanum lycopersicum
ref|XP_007160322.1|  hypothetical protein PHAVU_002G311900g             149   1e-37   Phaseolus vulgaris [French bean]
ref|XP_006355950.1|  PREDICTED: probable peptide transporter At1g...    149   1e-37   Solanum tuberosum [potatoes]
ref|XP_003597729.1|  hypothetical protein MTR_2g101650                  149   1e-37   Medicago truncatula
ref|XP_009774737.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       149   1e-37   Nicotiana sylvestris
gb|KEH21351.1|  peptide/nitrate transporter plant                       149   1e-37   Medicago truncatula
ref|XP_004503821.1|  PREDICTED: probable peptide transporter At1g...    148   1e-37   
ref|XP_007203564.1|  hypothetical protein PRUPE_ppa026167mg             149   2e-37   
ref|XP_006586332.1|  PREDICTED: probable peptide transporter At1g...    149   2e-37   
ref|XP_008242632.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       148   2e-37   
ref|XP_004164040.1|  PREDICTED: probable peptide transporter At1g...    148   2e-37   
gb|KGN62823.1|  hypothetical protein Csa_2G374650                       148   2e-37   
ref|XP_009628192.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       144   3e-37   
ref|XP_002318679.2|  hypothetical protein POPTR_0012s08940g             148   3e-37   
gb|KHN41359.1|  Putative peptide transporter                            147   3e-37   Glycine soja [wild soybean]
ref|XP_006363540.1|  PREDICTED: probable peptide transporter At1g...    147   3e-37   Solanum tuberosum [potatoes]
ref|XP_009795447.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    147   4e-37   Nicotiana sylvestris
ref|XP_009795448.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    147   4e-37   Nicotiana sylvestris
ref|XP_006355956.1|  PREDICTED: probable peptide transporter At1g...    147   4e-37   Solanum tuberosum [potatoes]
ref|XP_006833367.1|  hypothetical protein AMTR_s00109p00101980          147   4e-37   
ref|XP_008793166.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       147   6e-37   Phoenix dactylifera
ref|XP_006353565.1|  PREDICTED: probable peptide/nitrate transpor...    147   6e-37   
ref|XP_009628173.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       147   7e-37   Nicotiana tomentosiformis
ref|XP_004237077.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       146   9e-37   Solanum lycopersicum
ref|XP_010924574.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            146   9e-37   
ref|XP_010668218.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       146   1e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004239357.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       146   1e-36   Solanum lycopersicum
ref|XP_004238696.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2            145   2e-36   Solanum lycopersicum
ref|XP_004239356.2|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       145   2e-36   Solanum lycopersicum
ref|XP_006451204.1|  hypothetical protein CICLE_v10007800mg             145   2e-36   Citrus clementina [clementine]
ref|XP_006355952.1|  PREDICTED: probable peptide transporter At1g...    145   2e-36   Solanum tuberosum [potatoes]
ref|XP_006355951.1|  PREDICTED: probable peptide transporter At1g...    145   3e-36   Solanum tuberosum [potatoes]
dbj|BAB02684.1|  peptide/amino acid transporter-like protein            144   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHN04221.1|  Putative peptide transporter                            145   3e-36   Glycine soja [wild soybean]
ref|XP_004252058.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       144   4e-36   
gb|KDO66443.1|  hypothetical protein CISIN_1g007637mg                   144   4e-36   Citrus sinensis [apfelsine]
gb|KJB27309.1|  hypothetical protein B456_004G290200                    144   5e-36   Gossypium raimondii
ref|XP_009774738.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       144   5e-36   Nicotiana sylvestris
emb|CDP21642.1|  unnamed protein product                                144   7e-36   Coffea canephora [robusta coffee]
ref|XP_007150639.1|  hypothetical protein PHAVU_005G169300g             144   7e-36   Phaseolus vulgaris [French bean]
ref|XP_004238703.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       144   7e-36   Solanum lycopersicum
ref|XP_004486755.1|  PREDICTED: probable peptide transporter At1g...    143   1e-35   Cicer arietinum [garbanzo]
ref|XP_002324231.1|  hypothetical protein POPTR_0018s00430g             142   2e-35   
ref|XP_006355953.1|  PREDICTED: probable peptide transporter At1g...    142   2e-35   Solanum tuberosum [potatoes]
gb|KHG18966.1|  hypothetical protein F383_07419                         142   2e-35   Gossypium arboreum [tree cotton]
gb|KHN16613.1|  Putative peptide transporter                            142   2e-35   Glycine soja [wild soybean]
ref|XP_010519892.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3            142   3e-35   Tarenaya hassleriana [spider flower]
emb|CDP03303.1|  unnamed protein product                                142   3e-35   Coffea canephora [robusta coffee]
ref|XP_006355955.1|  PREDICTED: probable peptide transporter At1g...    141   5e-35   Solanum tuberosum [potatoes]
ref|XP_006355954.1|  PREDICTED: probable peptide transporter At1g...    141   6e-35   Solanum tuberosum [potatoes]
gb|AFK41192.1|  unknown                                                 135   6e-35   Lotus japonicus
emb|CDP21169.1|  unnamed protein product                                135   1e-34   Coffea canephora [robusta coffee]
ref|XP_003588616.1|  LATD/NIP                                           140   2e-34   Medicago truncatula
ref|XP_002458529.1|  hypothetical protein SORBIDRAFT_03g035260          139   2e-34   Sorghum bicolor [broomcorn]
ref|XP_004238701.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    139   2e-34   
ref|XP_009621370.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    138   4e-34   Nicotiana tomentosiformis
ref|XP_002458530.1|  hypothetical protein SORBIDRAFT_03g035270          138   5e-34   Sorghum bicolor [broomcorn]
ref|XP_008445026.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       138   8e-34   
ref|XP_007161541.1|  hypothetical protein PHAVU_001G078000g             138   8e-34   Phaseolus vulgaris [French bean]
ref|XP_006371707.1|  hypothetical protein POPTR_0018s00500g             137   9e-34   
ref|XP_006364284.1|  PREDICTED: probable peptide transporter At1g...    137   9e-34   Solanum tuberosum [potatoes]
ref|XP_004238698.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       137   1e-33   Solanum lycopersicum
ref|XP_004970046.1|  PREDICTED: probable peptide transporter At1g...    137   2e-33   Setaria italica
ref|XP_010920688.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    137   2e-33   Elaeis guineensis
dbj|BAK04396.1|  predicted protein                                      137   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004238699.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    136   3e-33   
gb|KGN62822.1|  hypothetical protein Csa_2G374640                       136   3e-33   
ref|XP_008793165.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like       136   4e-33   
emb|CDO98013.1|  unnamed protein product                                136   4e-33   Coffea canephora [robusta coffee]
gb|KEH40283.1|  peptide/nitrate transporter plant                       135   5e-33   Medicago truncatula
ref|XP_010320607.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2 isof...    135   6e-33   
ref|NP_001152466.1|  peptide transporter PTR2                           135   8e-33   Zea mays [maize]
ref|XP_004245185.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       135   1e-32   Solanum lycopersicum
ref|XP_003569868.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       134   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_010668942.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       134   1e-32   
ref|XP_010320604.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    134   1e-32   
ref|XP_010320606.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    134   1e-32   Solanum lycopersicum
ref|XP_008445024.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       134   2e-32   Cucumis melo [Oriental melon]
emb|CBI28041.3|  unnamed protein product                                134   2e-32   Vitis vinifera
ref|XP_004238700.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       134   2e-32   Solanum lycopersicum
ref|XP_010656492.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       134   3e-32   Vitis vinifera
emb|CDP16185.1|  unnamed protein product                                126   3e-32   Coffea canephora [robusta coffee]
gb|KDO79784.1|  hypothetical protein CISIN_1g045901mg                   127   3e-32   Citrus sinensis [apfelsine]
gb|KEH40281.1|  peptide/nitrate transporter plant                       133   4e-32   Medicago truncatula
ref|XP_004970048.1|  PREDICTED: probable peptide transporter At1g...    132   9e-32   Setaria italica
gb|KEH41920.1|  peptide/nitrate transporter plant                       131   2e-31   Medicago truncatula
ref|XP_006838787.1|  hypothetical protein AMTR_s00002p00259170          131   3e-31   
ref|XP_004164039.1|  PREDICTED: probable peptide transporter At1g...    130   3e-31   
ref|XP_002514272.1|  nitrate transporter, putative                      130   4e-31   Ricinus communis
ref|XP_004970045.1|  PREDICTED: probable peptide transporter At1g...    130   6e-31   Setaria italica
emb|CDP00275.1|  unnamed protein product                                130   9e-31   Coffea canephora [robusta coffee]
ref|XP_004970047.1|  PREDICTED: probable peptide transporter At1g...    129   9e-31   
ref|XP_004970044.1|  PREDICTED: probable peptide transporter At1g...    130   1e-30   Setaria italica
ref|XP_006601040.1|  PREDICTED: probable peptide transporter At1g...    129   1e-30   Glycine max [soybeans]
ref|XP_004150293.1|  PREDICTED: probable peptide transporter At1g...    129   2e-30   
gb|EMT13091.1|  Peptide transporter PTR1                                127   3e-30   
ref|XP_003568458.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       127   5e-30   Brachypodium distachyon [annual false brome]
ref|XP_010938844.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       127   5e-30   
ref|XP_008678618.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    127   5e-30   
ref|XP_002520155.1|  nitrate transporter, putative                      127   5e-30   
ref|XP_008678617.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.1-like...    127   6e-30   
emb|CDM84274.1|  unnamed protein product                                127   6e-30   
ref|XP_010320605.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    125   8e-30   
gb|KFK41277.1|  hypothetical protein AALP_AA2G109200                    126   1e-29   
ref|XP_007153857.1|  hypothetical protein PHAVU_003G070500g             126   1e-29   
ref|XP_004509940.1|  PREDICTED: nitrate transporter 1.7-like            126   2e-29   
ref|XP_009105401.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            125   3e-29   
ref|XP_004486756.1|  PREDICTED: probable peptide transporter At1g...    125   3e-29   
emb|CDY38595.1|  BnaC06g30180D                                          125   4e-29   
ref|XP_002873521.1|  proton-dependent oligopeptide transport fami...    124   4e-29   
ref|XP_009397036.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-lik...    125   5e-29   
gb|KDP21241.1|  hypothetical protein JCGZ_21712                         125   5e-29   
ref|XP_011086410.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      124   6e-29   
ref|XP_003614522.1|  Peptide transporter PTR                            124   7e-29   
gb|KHG04001.1|  hypothetical protein F383_28667                         124   7e-29   
ref|XP_004489968.1|  PREDICTED: nitrate transporter 1.7-like            124   7e-29   
gb|KJB80006.1|  hypothetical protein B456_013G077000                    124   8e-29   
ref|XP_010066730.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            124   8e-29   
gb|KDO39247.1|  hypothetical protein CISIN_1g007862mg                   124   8e-29   
ref|NP_001044323.1|  Os01g0761400                                       124   9e-29   
gb|EAY75907.1|  hypothetical protein OsI_03827                          123   1e-28   
gb|EMT24686.1|  Putative peptide transporter                            122   1e-28   
gb|EYU29810.1|  hypothetical protein MIMGU_mgv1a020560mg                124   1e-28   
ref|XP_009360408.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           124   1e-28   
emb|CDY69402.1|  BnaCnng63330D                                          120   2e-28   
gb|ACN40168.1|  unknown                                                 124   2e-28   
ref|XP_009103775.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    123   2e-28   
ref|XP_010511860.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       123   2e-28   
ref|XP_004962095.1|  PREDICTED: probable nitrite transporter At1g...    123   2e-28   
ref|XP_004297809.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      123   2e-28   
ref|XP_002863114.1|  proton-dependent oligopeptide transport fami...    122   2e-28   
gb|ADE76434.1|  unknown                                                 123   2e-28   
ref|XP_006483256.1|  PREDICTED: nitrate transporter 1.7-like isof...    123   2e-28   
emb|CDY25813.1|  BnaA07g09690D                                          123   2e-28   
ref|XP_003567138.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       122   2e-28   
ref|XP_010551275.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            123   2e-28   
ref|XP_010512049.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    122   2e-28   
ref|XP_006344125.1|  PREDICTED: probable nitrite transporter At1g...    122   3e-28   
ref|XP_004299089.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            122   3e-28   
gb|KJB71911.1|  hypothetical protein B456_011G146900                    122   3e-28   
ref|XP_008339950.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      120   3e-28   
ref|XP_007157410.1|  hypothetical protein PHAVU_002G067700g             122   4e-28   
ref|XP_010415653.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    122   4e-28   
ref|XP_010415480.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       122   4e-28   
ref|XP_010470810.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            122   4e-28   
ref|XP_008367039.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      122   4e-28   
ref|NP_177024.1|  putative nitrite transporter                          122   5e-28   
ref|XP_007162042.1|  hypothetical protein PHAVU_001G118900g             122   5e-28   
ref|XP_006378165.1|  proton-dependent oligopeptide transport fami...    122   6e-28   
ref|XP_008340336.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      122   6e-28   
ref|XP_010101985.1|  putative nitrite transporter                       121   6e-28   
ref|XP_007046254.1|  Major facilitator superfamily protein              121   7e-28   
ref|XP_010552600.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    121   7e-28   
ref|XP_011006584.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           121   8e-28   
gb|EPS62066.1|  hypothetical protein M569_12727                         120   9e-28   
ref|XP_009103122.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           121   1e-27   
ref|XP_006429209.1|  hypothetical protein CICLE_v10013496mg             121   1e-27   
ref|XP_006664784.1|  PREDICTED: probable peptide/nitrate transpor...    120   1e-27   
ref|XP_006481390.1|  PREDICTED: probable peptide/nitrate transpor...    121   1e-27   
ref|XP_002529118.1|  nitrate transporter, putative                      117   1e-27   
gb|KDO57946.1|  hypothetical protein CISIN_1g045410mg                   120   1e-27   
ref|XP_002314866.2|  hypothetical protein POPTR_0010s13620g             120   1e-27   
ref|XP_006646349.1|  PREDICTED: probable peptide transporter At1g...    119   1e-27   
ref|XP_006302031.1|  hypothetical protein CARUB_v10020013mg             120   1e-27   
ref|XP_002887190.1|  proton-dependent oligopeptide transport fami...    120   1e-27   
ref|XP_010910056.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       120   2e-27   
ref|XP_004238938.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            120   2e-27   
ref|XP_010265161.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       120   2e-27   
ref|XP_006573238.1|  PREDICTED: probable nitrite transporter At1g...    120   2e-27   
gb|AAX96583.1|  POT family, putative                                    121   2e-27   
ref|XP_006483255.1|  PREDICTED: nitrate transporter 1.7-like isof...    120   2e-27   
ref|XP_006438561.1|  hypothetical protein CICLE_v10030982mg             120   2e-27   
ref|XP_008243217.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            120   2e-27   
ref|XP_009127655.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       120   3e-27   
ref|XP_004155325.1|  PREDICTED: LOW QUALITY PROTEIN: nitrate tran...    120   3e-27   
ref|XP_004135202.1|  PREDICTED: nitrate transporter 1.7-like            120   3e-27   
ref|XP_006390954.1|  hypothetical protein EUTSA_v10019805mg             119   3e-27   
ref|XP_010532196.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       120   3e-27   
ref|NP_001057335.1|  Os06g0264500                                       119   3e-27   
ref|XP_006301787.1|  hypothetical protein CARUB_v10022251mg             119   4e-27   
ref|XP_007034086.1|  Major facilitator superfamily protein isoform 1    119   4e-27   
ref|NP_001267552.1|  probable nitrite transporter At1g68570-like        119   5e-27   
emb|CDY28441.1|  BnaC07g12690D                                          119   5e-27   
ref|XP_003519778.1|  PREDICTED: nitrate transporter 1.7-like            119   5e-27   
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       119   5e-27   
ref|XP_011008009.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            119   5e-27   
gb|KFK44623.1|  hypothetical protein AALP_AA1G282800                    119   6e-27   
ref|NP_196718.1|  major facilitator protein                             117   6e-27   
emb|CBI32821.3|  unnamed protein product                                118   7e-27   
emb|CDY54537.1|  BnaCnng27190D                                          119   7e-27   
ref|XP_009775473.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      119   8e-27   
ref|XP_004298155.2|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       119   8e-27   
gb|AHE63220.1|  nitrate/nitrite transporter                             119   8e-27   
ref|XP_002967570.1|  hypothetical protein SELMODRAFT_231062             118   8e-27   
gb|KDP29397.1|  hypothetical protein JCGZ_18318                         118   9e-27   
ref|XP_002277986.2|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            119   9e-27   
ref|XP_008446297.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    118   9e-27   
ref|XP_006576768.1|  PREDICTED: probable nitrite transporter At1g...    118   9e-27   
ref|XP_004238760.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           118   1e-26   
ref|NP_177144.1|  putative peptide/nitrate transporter                  118   1e-26   
ref|XP_009401275.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            118   1e-26   
ref|XP_008339682.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            118   1e-26   
gb|AES81116.2|  nitrate transporter 1                                   118   1e-26   
ref|XP_009610945.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            118   1e-26   
gb|KDO69969.1|  hypothetical protein CISIN_1g021653mg                   115   1e-26   
gb|EAY98037.1|  hypothetical protein OsI_19952                          118   1e-26   
gb|KDO69968.1|  hypothetical protein CISIN_1g021653mg                   115   2e-26   
gb|EEE63716.1|  hypothetical protein OsJ_18534                          118   2e-26   
ref|XP_010044269.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    117   2e-26   
gb|KDO69967.1|  hypothetical protein CISIN_1g021653mg                   115   2e-26   
ref|XP_009356666.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       117   2e-26   
ref|XP_003624896.1|  Peptide transporter PTR5                           118   2e-26   
ref|XP_002981774.1|  hypothetical protein SELMODRAFT_115215             117   2e-26   
ref|XP_002269340.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13           117   2e-26   
ref|XP_010907323.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...    117   2e-26   
ref|XP_006357252.1|  PREDICTED: nitrate transporter 1.7-like            117   2e-26   
ref|XP_010256203.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      117   2e-26   
ref|XP_002441094.1|  hypothetical protein SORBIDRAFT_09g020300          117   2e-26   
ref|XP_010543265.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       117   3e-26   
emb|CDP06231.1|  unnamed protein product                                117   3e-26   
ref|XP_006654400.1|  PREDICTED: probable nitrite transporter At1g...    117   3e-26   
ref|XP_008649639.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       117   3e-26   
gb|EYU20822.1|  hypothetical protein MIMGU_mgv1a003218mg                117   3e-26   
ref|XP_008239650.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      117   3e-26   
ref|XP_009757138.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            117   3e-26   
ref|XP_007026888.1|  Major facilitator superfamily protein, putative    117   3e-26   
gb|KDP24816.1|  hypothetical protein JCGZ_25283                         117   4e-26   
gb|AAT85255.1|  putative proton-dependent oligopeptide transporte...    117   4e-26   
ref|XP_006346628.1|  PREDICTED: peptide transporter PTR2-like           117   4e-26   
ref|NP_001055535.2|  Os05g0410900                                       117   4e-26   
gb|ADH21397.1|  nitrate transporter                                     117   4e-26   
ref|XP_006373301.1|  hypothetical protein POPTR_0017s11320g             117   4e-26   
ref|NP_001130360.1|  uncharacterized protein LOC100191455               116   4e-26   
ref|XP_003517977.1|  PREDICTED: probable nitrite transporter At1g...    116   4e-26   
ref|XP_004165996.1|  PREDICTED: LOW QUALITY PROTEIN: probable nit...    116   5e-26   
ref|XP_003624898.1|  Peptide transporter PTR2                           118   5e-26   
ref|XP_008221697.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      117   5e-26   
gb|KEH16315.1|  peptide/nitrate transporter                             115   5e-26   
ref|NP_001147810.1|  peptide transporter PTR2                           116   5e-26   
gb|ACN27476.1|  unknown                                                 116   5e-26   
ref|XP_010491891.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.3-like...    115   6e-26   
ref|XP_009400862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      116   6e-26   
ref|XP_008450058.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       116   6e-26   
ref|XP_008445025.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like       115   7e-26   
ref|XP_004980444.1|  PREDICTED: probable peptide transporter At1g...    116   7e-26   
ref|XP_009610610.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13 iso...    116   7e-26   
ref|XP_009610611.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13 iso...    116   7e-26   
ref|XP_010314832.1|  PREDICTED: protein NRT1/ PTR FAMILY 1.2-like...    114   8e-26   
ref|XP_006663392.1|  PREDICTED: probable peptide transporter At1g...    116   8e-26   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            115   9e-26   
ref|XP_007210270.1|  hypothetical protein PRUPE_ppa003155mg             115   9e-26   
gb|KHN28716.1|  Nitrate transporter 1.7                                 115   9e-26   
ref|XP_003554102.1|  PREDICTED: probable nitrite transporter At1g...    115   1e-25   
gb|KHN08912.1|  Putative nitrite transporter                            115   1e-25   
ref|XP_006391124.1|  hypothetical protein EUTSA_v10018310mg             115   1e-25   
ref|XP_006476663.1|  PREDICTED: probable peptide/nitrate transpor...    115   1e-25   
emb|CDY38766.1|  BnaA07g28380D                                          115   1e-25   
ref|XP_009105658.1|  PREDICTED: putative protein NRT1/ PTR FAMILY...    115   1e-25   
gb|KCW69640.1|  hypothetical protein EUGRSUZ_F03048                     114   1e-25   
gb|KDO39246.1|  hypothetical protein CISIN_1g007862mg                   115   2e-25   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg             115   2e-25   
ref|XP_007153449.1|  hypothetical protein PHAVU_003G036200g             115   2e-25   
ref|XP_008445656.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            115   2e-25   
emb|CDY40280.1|  BnaA07g09200D                                          114   2e-25   
ref|XP_006828353.1|  hypothetical protein AMTR_s00023p00251100          112   2e-25   
ref|XP_004164473.1|  PREDICTED: probable nitrite transporter At1g...    114   2e-25   
ref|XP_004142186.1|  PREDICTED: probable peptide/nitrate transpor...    114   2e-25   
ref|XP_011006634.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       114   2e-25   
ref|XP_004150669.1|  PREDICTED: probable nitrite transporter At1g...    114   2e-25   
ref|XP_010683278.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12           115   2e-25   
ref|XP_011006633.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.8-like       114   2e-25   
ref|XP_002322927.1|  hypothetical protein POPTR_0016s10270g             114   2e-25   
emb|CDP14879.1|  unnamed protein product                                114   2e-25   
ref|XP_010256190.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       114   2e-25   
ref|XP_004493331.1|  PREDICTED: uncharacterized protein LOC101504345    116   2e-25   
ref|XP_007155348.1|  hypothetical protein PHAVU_003G193600g             114   2e-25   
ref|XP_007162043.1|  hypothetical protein PHAVU_001G119000g             114   2e-25   
ref|XP_003521106.1|  PREDICTED: probable nitrite transporter At1g...    114   3e-25   
ref|XP_006437676.1|  hypothetical protein CICLE_v10031055mg             114   3e-25   
gb|KEH41919.1|  peptide/nitrate transporter plant                       113   3e-25   
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       114   3e-25   
ref|XP_007044382.1|  Nitrate transporter 1.7, putative                  114   3e-25   
ref|XP_008389297.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       114   3e-25   
ref|XP_008670500.1|  PREDICTED: uncharacterized protein LOC100191...    114   3e-25   
dbj|BAJ33669.1|  unnamed protein product                                114   3e-25   
ref|XP_006286746.1|  hypothetical protein CARUB_v10003056mg             112   4e-25   
ref|XP_010647749.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            114   4e-25   
ref|XP_002517267.1|  nitrate transporter, putative                      114   4e-25   
ref|XP_003613558.1|  Peptide transporter PTR1                           114   5e-25   
gb|KEH19853.1|  peptide/nitrate transporter                             114   5e-25   
ref|XP_006415996.1|  hypothetical protein EUTSA_v10007235mg             113   5e-25   
ref|XP_011464561.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    113   6e-25   
gb|KHN01163.1|  Nitrate transporter 1.7                                 113   6e-25   
emb|CDY11648.1|  BnaC06g30910D                                          113   6e-25   
ref|XP_007222023.1|  hypothetical protein PRUPE_ppa002984mg             113   6e-25   
ref|XP_010247222.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       113   6e-25   
ref|XP_003551991.1|  PREDICTED: nitrate transporter 1.7-like            113   7e-25   
ref|XP_009803584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    113   7e-25   
ref|XP_008796703.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like      113   8e-25   
gb|KHG05907.1|  hypothetical protein F383_32480                         113   8e-25   
ref|XP_007226648.1|  hypothetical protein PRUPE_ppa022076mg             113   8e-25   
ref|XP_007155347.1|  hypothetical protein PHAVU_003G193500g             113   8e-25   
ref|XP_011007525.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like       113   8e-25   
ref|XP_003551506.1|  PREDICTED: probable peptide/nitrate transpor...    113   8e-25   
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       113   9e-25   
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       112   9e-25   
ref|XP_006304643.1|  hypothetical protein CARUB_v10011778mg             112   9e-25   
ref|XP_009356281.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       112   9e-25   
ref|XP_002893357.1|  predicted protein                                  112   1e-24   
ref|XP_006346661.1|  PREDICTED: peptide transporter PTR2-like           113   1e-24   
gb|KJB16944.1|  hypothetical protein B456_002G256000                    112   1e-24   
ref|XP_002308184.2|  hypothetical protein POPTR_0006s09270g             112   1e-24   
ref|XP_009414362.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1-like       112   1e-24   
ref|XP_008807862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      112   1e-24   
ref|XP_003561175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like      112   1e-24   
gb|EYU29966.1|  hypothetical protein MIMGU_mgv1a003471mg                112   1e-24   
ref|XP_006439662.1|  hypothetical protein CICLE_v10019426mg             112   2e-24   
gb|KDO76031.1|  hypothetical protein CISIN_1g007827mg                   112   2e-24   



>ref|XP_004253108.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=657

 Score =   228 bits (581),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 166/228 (73%), Gaps = 4/228 (2%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++ LL+  + + KGGFRTLPFI+G  AL +  TS+L  +MI YLM EYHMDM TGSN+IY
Sbjct  95   EQSLLLDDTETQKGGFRTLPFILGNAALTNAATSALTPNMILYLMNEYHMDMTTGSNIIY  154

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS--  446
             W A+T I PV GA +ADS +GRFQ+IG+ S++  VGM+L WL +VIP A+PPPC  +  
Sbjct  155  MWSAVTNIAPVIGAFMADSFVGRFQMIGLGSVVTLVGMLLFWLTSVIPQARPPPCDSNNI  214

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH--IQNNAGAMESYFSWYYAI  620
            C SA TFQL  LC S  ++++G+G V S  LAFG+DQLK    Q+NA  ME YFSWYYA+
Sbjct  215  CRSAETFQLFFLCFSLGIVAIGAGAVKSSSLAFGSDQLKREIYQDNARLMERYFSWYYAL  274

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +AL  +V LTCLVY+Q N GW +G+G  V+ MLF+ L  +LG+PF+VK
Sbjct  275  YALSILVALTCLVYIQVNMGWALGFGAPVLLMLFSTLLIYLGTPFFVK  322



>ref|XP_006342519.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=576

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 164/229 (72%), Gaps = 5/229 (2%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++ LL+  S + KGGFRTLPFI+G  AL +  TS+L  +MI YLM EYHMDM TGSN+IY
Sbjct  13   EQTLLLDDSETQKGGFRTLPFILGNAALTNAATSALTPNMILYLMNEYHMDMTTGSNIIY  72

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS--  446
             W A+T I PV GA +ADS +GRFQ+IG+ S++  VGM + WL +VIP A+PPPC +S  
Sbjct  73   MWSAVTNIAPVVGAFMADSFVGRFQMIGLGSVVTLVGMFMFWLTSVIPQARPPPCVNSNN  132

Query  447  -CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH--IQNNAGAMESYFSWYYA  617
             C SA  FQL  LC S  ++++G+G V S  LAFG+DQLK    Q+NA  ME YFSWYYA
Sbjct  133  ICRSAEMFQLFFLCFSLGIVAIGAGAVKSSSLAFGSDQLKREVYQDNARLMERYFSWYYA  192

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +AL  +V LTCLVY+Q N GW +G+G  V+ MLF+ L  +LG+PFYVK
Sbjct  193  SYALSILVALTCLVYIQVNMGWALGFGAPVLLMLFSTLLIYLGTPFYVK  241



>ref|XP_009787108.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Nicotiana sylvestris]
Length=576

 Score =   221 bits (562),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 167/229 (73%), Gaps = 6/229 (3%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++PLL   S + KGGFRTLPFI+G +AL++  T++L  ++I YLM EYHMDM TGSN++Y
Sbjct  13   EQPLL-DASETQKGGFRTLPFILGNVALMNAATNALTPNLILYLMNEYHMDMTTGSNILY  71

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SD  443
             W A T I PV  A LADS +GRF++IG+ S++  VGM L WL +VIP A+PPPC   ++
Sbjct  72   IWSATTNIAPVLAAFLADSFVGRFKMIGLGSVVTLVGMFLFWLTSVIPQARPPPCIGSNN  131

Query  444  SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH--IQNNAGAMESYFSWYYA  617
             C SA  FQL  LC+S  L+++G+G + S  LAFG+DQLK    Q NA A+ESYFSWYYA
Sbjct  132  ICRSAEMFQLFFLCSSLGLVAIGAGAIKSSSLAFGSDQLKREVYQENARAIESYFSWYYA  191

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++AL  +V LTCLVY+Q N GW +G+G  V+ MLF+ L  FLG+PFYVK
Sbjct  192  VYALSVLVALTCLVYIQVNMGWALGFGAPVLLMLFSTLLIFLGTPFYVK  240



>ref|XP_009607662.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=576

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 165/229 (72%), Gaps = 6/229 (3%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++PLL   S + KGGFRT PFI+G  AL++  T++L  ++I YLM EYHMDM TGSN++Y
Sbjct  13   EQPLL-DASETQKGGFRTFPFILGNAALMNAATNALTPNLILYLMNEYHMDMTTGSNILY  71

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SD  443
             W A T I PV  A LADS +GRF++IG+ S++  VGM L WL +VIP A+PPPC   ++
Sbjct  72   IWSATTNIAPVLAAFLADSFVGRFKMIGLGSVVTLVGMFLFWLTSVIPQARPPPCIGSNN  131

Query  444  SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH--IQNNAGAMESYFSWYYA  617
             C SA  FQL  LC+S  L+++G+G + S  LAFG+DQLK    Q NA A+ESYFSWYYA
Sbjct  132  ICRSAEMFQLFFLCSSLGLVAIGAGAIKSSSLAFGSDQLKREVYQQNARAIESYFSWYYA  191

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++AL  +V LTCLVY+Q N GW +G+G  V+ MLF+ L  FLG+PFYVK
Sbjct  192  VYALSVLVSLTCLVYIQVNMGWALGFGAPVLLMLFSTLLIFLGNPFYVK  240



>ref|XP_011090875.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Sesamum indicum]
Length=572

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 158/235 (67%), Gaps = 7/235 (3%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EK    ++ LL  T    KGGFRTLPFI+G  AL  M T  L  +M  YLM EYHM M T
Sbjct  3    EKNTMLEEHLLERTDQ--KGGFRTLPFIIGIEALEKMATFGLMPNMTLYLMKEYHMGMTT  60

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
             SNL++FW A T  +P+ GA++ADS +GRF  IGI S+I  +GM+LLW  TVIP A+PPP
Sbjct  61   ASNLLFFWSAATNFMPLLGALVADSFLGRFYTIGIGSVISLMGMILLWSTTVIPQARPPP  120

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH--IQNNAGAMESY  599
            C   ++SCSS TTFQ + LCT+F L+SVG+GG+ S  LAFGADQL+    + ++G  +SY
Sbjct  121  CKQFNNSCSSPTTFQFMYLCTAFGLISVGAGGIRSSSLAFGADQLEKGDFKKSSGLKQSY  180

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F WYYA +    ++ LTC+VY+Q+N GW +G+ +  V ML     FFL S FYVK
Sbjct  181  FGWYYASYMFSVLIALTCVVYIQDNMGWGVGFAVPAVLMLIGVSIFFLASRFYVK  235



>gb|EYU29274.1| hypothetical protein MIMGU_mgv1a003369mg [Erythranthe guttata]
Length=589

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 160/235 (68%), Gaps = 4/235 (2%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            MEK   E++PLL     + KGGFRTLPFI+G  ++  M T  +  +M  YL+ EYHM++ 
Sbjct  1    MEKTMAEEEPLLKEEDCNKKGGFRTLPFIIGNESVEKMATYGVMPNMALYLIKEYHMELT  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            T SN+++ W + T  +P+  A+LADS  GRF  IG  SII F+GM+LLW  T+IP AKPP
Sbjct  61   TASNVLFMWSSATNFMPLVAALLADSFFGRFYTIGFGSIICFMGMILLWSTTIIPQAKPP  120

Query  432  PCSDS--CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH--IQNNAGAMESY  599
            PCS++  CSS    QL+LLCTSFVL+S+G+GG+ S  LAFGADQL+    +  +   ESY
Sbjct  121  PCSNNPICSSVAIPQLVLLCTSFVLISIGAGGIRSSSLAFGADQLERGEFKRKSNLKESY  180

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA +    ++ LTC+VY+Q+N GW +G+ +  + MLF    FFL SPFYVK
Sbjct  181  FTWYYASYTFSVLIALTCVVYIQDNVGWGVGFLVPALLMLFGVGSFFLASPFYVK  235



>emb|CDP16183.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 164/242 (68%), Gaps = 8/242 (3%)
 Frame = +3

Query  54   LASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            + S+ + EK    ++PLL    +SP+GG RT+PFI+    L  + +  L  +M  YLM +
Sbjct  1    MESSSVDEKKDTIKEPLL---KSSPRGGVRTMPFIIANGMLEGVASFGLTPNMTLYLMRQ  57

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            YHM+M   SN++++W A T  +P+ GAI+ADS +GRF +IG  S++  +GM+LLWL T+I
Sbjct  58   YHMEMTAASNVLFYWSAATNFMPILGAIIADSYVGRFHMIGFGSVVSLLGMILLWLTTMI  117

Query  414  PHAKPPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NN  578
            P A PPPC   ++SC S T+FQLLLL TSF L+S G+GG+ S  LAFGADQL+      +
Sbjct  118  PQATPPPCIESNNSCDSTTSFQLLLLFTSFALISTGAGGIRSSSLAFGADQLEKGDGCES  177

Query  579  AGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFY  758
             G    Y SWYYA +    ++ LTC+VY+QEN GW+ G+G+ VV MLFAAL FFL +PFY
Sbjct  178  VGVSGRYLSWYYASYTFSVLIALTCMVYIQENMGWQFGFGVSVVVMLFAALSFFLATPFY  237

Query  759  VK  764
            VK
Sbjct  238  VK  239



>emb|CDP16193.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 153/230 (67%), Gaps = 7/230 (3%)
 Frame = +3

Query  96   KPLLVTTSA--SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            KPLL       S KGGFRT+PFI+   A   + +  L   MI YL GEYH++M TGSN+I
Sbjct  4    KPLLKDDHDCFSAKGGFRTMPFILANEAFAQVASCGLQPSMILYLTGEYHLNMATGSNII  63

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-  446
            + W A T  +P+ GA +ADS +GRF++I    +I  +GM LLWL ++IP  KPPPC +S 
Sbjct  64   FLWSAATNFMPLLGATVADSFLGRFRMILFGCVISLLGMALLWLTSMIPQVKPPPCHESN  123

Query  447  --CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHI--QNNAGAMESYFSWYY  614
              CSSAT+FQL LLC+ F L+S+G GG+ S  LAFGADQL+     NN   +ESYFSWY 
Sbjct  124  KNCSSATSFQLSLLCSCFGLMSIGFGGIRSSSLAFGADQLQKAGGHNNGRVLESYFSWYS  183

Query  615  AIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            A+  +  ++  TC+VY+QEN GW++G+GI V+ ML + L F L S  YVK
Sbjct  184  ALSTISLLIAYTCIVYVQENLGWQVGFGIPVMLMLLSTLSFSLASHLYVK  233



>emb|CDP16194.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 155/230 (67%), Gaps = 7/230 (3%)
 Frame = +3

Query  96   KPLLVTTSA--SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            KPLL       S KGGFRT+PFI+   A   + +  L  +MI YL  EYH++M TGSN+I
Sbjct  4    KPLLNDDHDCFSAKGGFRTMPFILANEAFAQVASYGLQPNMILYLTREYHLNMATGSNII  63

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-  446
            + W A T ++P+ GAI+ADS +GRF++I     I  +GM LLWL T+IP AKP PC +S 
Sbjct  64   FLWSAATNLMPLLGAIVADSFLGRFRMILFGCAISLLGMALLWLTTMIPQAKPLPCYESD  123

Query  447  --CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHI--QNNAGAMESYFSWYY  614
              CSSAT+FQL LLC+   L S+G GG+VS  LAFGADQL+    QNN   +ESYFSWYY
Sbjct  124  NKCSSATSFQLFLLCSCLGLTSIGFGGIVSSSLAFGADQLQKAGGQNNGWVLESYFSWYY  183

Query  615  AIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            A+  +  ++  TC+VY+Q+N GW++G+GI V+ ML + L F L S  YVK
Sbjct  184  ALCTISILIAFTCIVYVQDNLGWQLGFGIPVMLMLLSTLSFSLASHLYVK  233



>emb|CDP16191.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 152/229 (66%), Gaps = 6/229 (3%)
 Frame = +3

Query  96   KPLLVTTSA-SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            KPLL      S KGGFRT+PF++   A   + +  L   MI YL  EYH++M TGSN+I+
Sbjct  4    KPLLDDHDGFSGKGGFRTMPFVLANEAFAQVASYGLQPSMILYLTREYHLNMATGSNIIF  63

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS--  446
             W A T  +P+ GAI+ADS +GRF++I    +I  +GM LLWL ++IP AKPPPC +S  
Sbjct  64   LWSAATNFMPLLGAIVADSFLGRFRMILFGCVISLLGMALLWLTSMIPQAKPPPCHESNK  123

Query  447  -CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHI--QNNAGAMESYFSWYYA  617
             CSSAT+FQL LLC+   L S+G GG+ S  +AFGADQL+     NN   +ESYFSWYYA
Sbjct  124  NCSSATSFQLFLLCSCLGLTSIGFGGITSSSIAFGADQLQKAGGHNNGRVLESYFSWYYA  183

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +  +  ++  TC+VY QE+ GW++G+GI V+ ML + L F L S  YVK
Sbjct  184  LSTISVLIAYTCIVYAQESLGWQVGFGIPVMLMLLSTLSFSLASHLYVK  232



>ref|XP_010691376.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 155/242 (64%), Gaps = 12/242 (5%)
 Frame = +3

Query  72   MEKMGDEQKPL------LVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            ME   DE++ +         TS   KGGF T+PFI+   +   + +  L  +MI YLM +
Sbjct  1    MESSSDEERKMNGHNQDEEETSKKKKGGFITMPFIIANESFEKVASYGLTPNMILYLMKD  60

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            Y M +  G NL++FW A T  +P+ GA +ADS +GRF  IGI SII  +G +LLWL TVI
Sbjct  61   YKMSLAKGQNLLFFWTAATNFLPLIGAFVADSYLGRFLTIGIGSIISLLGTILLWLTTVI  120

Query  414  PHAKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--N  575
            PHAKPPPC+     +C S T+ Q  LL  +F+L+S+G+GGV  C  AFGADQ+   +  N
Sbjct  121  PHAKPPPCNPLAPQTCESPTSGQYALLVFAFLLMSIGAGGVRPCSQAFGADQVDQRENPN  180

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            N   +E++F+WYYA   L  V+ LT +VY+Q++ GW+IG+GI V+ M  + LFFFL SPF
Sbjct  181  NKRVLETFFNWYYACACLSVVIALTVIVYIQDHLGWRIGFGIPVILMFLSGLFFFLASPF  240

Query  756  YV  761
            YV
Sbjct  241  YV  242



>ref|XP_010047267.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 1.2 
[Eucalyptus grandis]
Length=591

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 157/248 (63%), Gaps = 19/248 (8%)
 Frame = +3

Query  72   MEKMGDE----------QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKY  221
            M +MGD           ++PLL   + +PKGG RT+PFI+   A   + +  L  +M+ Y
Sbjct  1    MSQMGDRSCDQPAKKMIREPLL--ENPTPKGGLRTIPFIIANEAFEKVASFGLLPNMVLY  58

Query  222  LMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWL  401
            L  EYH++ V  +N+++ W A T  +P+ GA LADS  GR+ +IG  SI   +GM+LLWL
Sbjct  59   LTREYHLENVAAANVLFLWSAATNFLPIIGAFLADSYFGRYAMIGFGSIASLLGMILLWL  118

Query  402  PTVIPHAKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLK--  563
             TV P A+PP C     D+C SATT QLLLL +SF L+S+G+GGV S  LAFGADQLK  
Sbjct  119  TTVFPQARPPSCDEFSKDTCGSATTAQLLLLYSSFGLMSIGAGGVRSSALAFGADQLKTG  178

Query  564  -HIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalfff  740
             + +N+   ++ YFSWYY       +V +TC+VY+Q+ AGWK+G+G+ VV M  +   FF
Sbjct  179  ANSKNSGNLLQKYFSWYYVSVMASVMVAMTCIVYIQDTAGWKVGFGVPVVLMFISTFSFF  238

Query  741  lGSPFYVK  764
            L SPFY K
Sbjct  239  LASPFYFK  246



>gb|KDO38215.1| hypothetical protein CISIN_1g041538mg, partial [Citrus sinensis]
Length=225

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 143/222 (64%), Gaps = 14/222 (6%)
 Frame = +3

Query  72   MEKMGDEQK----PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   +E+K    PLL+  + +PKGG RTLPFI+   A   M ++    +MI YL  EY+
Sbjct  1    METCSEEKKMITEPLLI--NKNPKGGIRTLPFIIANEAFERMASTGFMPNMILYLCREYN  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M +  G+N+++FW A +  +P+ GA LADS +GR+ +IG   I   +GMVLLWL T+ PH
Sbjct  59   MKITEGTNVLFFWSAASNFLPILGAFLADSYVGRYAMIGFGCITCLLGMVLLWLTTIFPH  118

Query  420  AKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH----IQN  575
            A+P  C     DSC SAT  QL+LL  +F L+S+G GG+ S  LAFGADQL+        
Sbjct  119  ARPLACDYTLRDSCESATGSQLMLLYLAFGLMSLGGGGIRSSSLAFGADQLEKGDGIKSK  178

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGI  701
            + GA++SYFSWYY   +   +V +T +VY+Q+N GWK+G+GI
Sbjct  179  SEGALKSYFSWYYVSVSASSMVAVTFIVYIQDNLGWKVGFGI  220



>ref|XP_006422795.1| hypothetical protein CICLE_v10029930mg, partial [Citrus clementina]
 gb|ESR36035.1| hypothetical protein CICLE_v10029930mg, partial [Citrus clementina]
Length=584

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 157/243 (65%), Gaps = 14/243 (6%)
 Frame = +3

Query  72   MEKMGDEQK----PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   +E+K    PLL+  + +PKGG RTLPFI+   A   M ++    +MI YL  EY+
Sbjct  1    MEACSEEKKMITEPLLI--NKNPKGGIRTLPFIIANEAFERMASTGFMPNMILYLCREYN  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M +  G+N+++FW A +  +P+ GA LADS +GR+ +IG   I   +GMVLLWL T+ PH
Sbjct  59   MKITEGTNVLFFWSAASNFLPILGAFLADSYVGRYAMIGFGCITCLLGMVLLWLTTIFPH  118

Query  420  AKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH----IQN  575
            A+P  C     DSC SAT  QL+LL  +F L+S+G GG+ S  LAFGADQL+        
Sbjct  119  ARPLACDYTLRDSCESATGSQLMLLYLAFGLMSLGGGGIRSSSLAFGADQLEKGDGIKSK  178

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            + GA++SYFSWYY   +   +V +T +VY+Q+N GWK+G+GI    ML +AL FFL SPF
Sbjct  179  SEGALKSYFSWYYVSVSASSMVAVTFIVYIQDNLGWKVGFGIPAAIMLLSALCFFLASPF  238

Query  756  YVK  764
            YVK
Sbjct  239  YVK  241



>ref|XP_006422797.1| hypothetical protein CICLE_v10029786mg, partial [Citrus clementina]
 gb|ESR36037.1| hypothetical protein CICLE_v10029786mg, partial [Citrus clementina]
Length=584

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 157/243 (65%), Gaps = 14/243 (6%)
 Frame = +3

Query  72   MEKMGDEQK----PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   +E+K    PLL+  + +PKGG RTLPFI+   A   M ++    +MI YL  EY+
Sbjct  1    METCSEEKKMITEPLLI--NKNPKGGIRTLPFIIANEAFERMASTGFMPNMILYLCREYN  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M +  G+N+++FW A +  +P+ GA LADS +GR+ +IG   I   +GMVLLWL T+ PH
Sbjct  59   MKITEGTNVLFFWSAASNFLPILGAFLADSYVGRYAMIGFGCITCLLGMVLLWLTTIFPH  118

Query  420  AKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH----IQN  575
            A+P  C     DSC SAT  QL+LL  +F L+S+G GG+ S  LAFGADQL+        
Sbjct  119  ARPLACDYPLRDSCESATGSQLMLLYLAFGLMSLGGGGIRSSSLAFGADQLEKGDGIKSK  178

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            + GA++SYFSWYY   +   +V +T +VY+Q+N GWK+G+GI    ML +AL FFL SPF
Sbjct  179  SEGALKSYFSWYYVSVSASSMVAVTFIVYIQDNLGWKVGFGIPAAIMLLSALCFFLASPF  238

Query  756  YVK  764
            YVK
Sbjct  239  YVK  241



>ref|XP_006486909.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=585

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 158/243 (65%), Gaps = 14/243 (6%)
 Frame = +3

Query  72   MEKMGDEQK----PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   +E+K    PLL+  + +PKGG RTLPFI+   A   M ++    +MI YL  EY+
Sbjct  1    METCSEEKKMITEPLLI--NKNPKGGIRTLPFIIANEAFERMASTGFMPNMILYLCREYN  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M +  G+N+++FW A +  +P+ GA LADS +GR+ +IG   I   +GMVLLWL T++PH
Sbjct  59   MKITEGTNVLFFWSAASSFLPILGAFLADSYVGRYLMIGFGCITCLLGMVLLWLTTILPH  118

Query  420  AKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH----IQN  575
            A+P  C     DSC SAT  QL+LL  +F L+S+G GG+ S  LAFGA+QL+        
Sbjct  119  ARPLACDYPLRDSCESATGSQLMLLYLAFGLMSLGGGGIRSSSLAFGAEQLEKGDGIKSK  178

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            + GA++SYFSWYY   +   +V +T +VY+Q+N GWK+G+GI    ML +AL FFL SPF
Sbjct  179  SEGALKSYFSWYYVSVSASSMVAVTFIVYIQDNLGWKMGFGIPAAIMLLSALCFFLASPF  238

Query  756  YVK  764
            YVK
Sbjct  239  YVK  241



>ref|XP_010254052.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Nelumbo nucifera]
Length=588

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 158/238 (66%), Gaps = 12/238 (5%)
 Frame = +3

Query  72   MEKMGDEQ--KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            ME   D++  +PL     + PKGGFRT+PFI+   A   + +  L  +MI YLM EY+M 
Sbjct  1    MEGSSDKKITQPL-----SRPKGGFRTMPFIIANEAFERVASHGLMPNMILYLMKEYNMS  55

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
              TG++++++W A+T  +P+ GA L+DS +GRF +IG+ SI   +GM+LLWL T++P AK
Sbjct  56   TATGTSILFYWSALTNFMPIIGAFLSDSCLGRFALIGLGSISSLLGMILLWLTTMVPQAK  115

Query  426  PPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAM  590
            P  C   S+ C S T  QL+LL +SF L+SVG+GG+ +C +AFGADQL       N   +
Sbjct  116  PLSCNAPSERCQSPTPAQLVLLFSSFCLMSVGAGGIRACSMAFGADQLDQRDKPANKRVL  175

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ES+F+WYYA+     +V +T +VY+Q++ GWK+G+GI  + ML + L FFL S FYVK
Sbjct  176  ESFFNWYYALTTFSVLVAITLIVYIQDHMGWKVGFGIPAILMLLSTLLFFLASSFYVK  233



>gb|KDO79777.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=548

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 150/228 (66%), Gaps = 7/228 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL+  + +PKGG RTLPFI+   A   M T     +MI YL  EY+M+    +N+I+ 
Sbjct  4    EPLLI--NKNPKGGLRTLPFIIANEAFERMATVGFTPNMILYLCREYNMETTAATNIIFI  61

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DS  446
            W A T  +P+ GA+LADS +GR+++IG       +GMVLLW  T++P AKPP C    + 
Sbjct  62   WTAATNFLPIVGALLADSYVGRYRMIGFGCFTCLLGMVLLWSTTILPGAKPPACDQLRNG  121

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAI  620
            C SAT  QL+ L  +F L+S+GSGG+ S  LAFGA+QL       + GA++SYFSWYY  
Sbjct  122  CESATWSQLMPLYFAFGLMSLGSGGIRSSSLAFGAEQLDKGDGTKSKGALQSYFSWYYVF  181

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +   +V +TC+VY+Q+N GWK+G+G+  V ML +AL FFL SPFYVK
Sbjct  182  VSASSIVAVTCIVYIQDNLGWKVGFGVPAVIMLLSALSFFLASPFYVK  229



>ref|XP_006476064.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 gb|KDO79776.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=539

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 150/228 (66%), Gaps = 7/228 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL+  + +PKGG RTLPFI+   A   M T     +MI YL  EY+M+    +N+I+ 
Sbjct  4    EPLLI--NKNPKGGLRTLPFIIANEAFERMATVGFTPNMILYLCREYNMETTAATNIIFI  61

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DS  446
            W A T  +P+ GA+LADS +GR+++IG       +GMVLLW  T++P AKPP C    + 
Sbjct  62   WTAATNFLPIVGALLADSYVGRYRMIGFGCFTCLLGMVLLWSTTILPGAKPPACDQLRNG  121

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAI  620
            C SAT  QL+ L  +F L+S+GSGG+ S  LAFGA+QL       + GA++SYFSWYY  
Sbjct  122  CESATWSQLMPLYFAFGLMSLGSGGIRSSSLAFGAEQLDKGDGTKSKGALQSYFSWYYVF  181

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +   +V +TC+VY+Q+N GWK+G+G+  V ML +AL FFL SPFYVK
Sbjct  182  VSASSIVAVTCIVYIQDNLGWKVGFGVPAVIMLLSALSFFLASPFYVK  229



>ref|XP_006450663.1| hypothetical protein CICLE_v10007857mg [Citrus clementina]
 ref|XP_006476063.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
 gb|ESR63903.1| hypothetical protein CICLE_v10007857mg [Citrus clementina]
 gb|KDO79778.1| hypothetical protein CISIN_1g008264mg [Citrus sinensis]
Length=572

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 150/228 (66%), Gaps = 7/228 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL+  + +PKGG RTLPFI+   A   M T     +MI YL  EY+M+    +N+I+ 
Sbjct  4    EPLLI--NKNPKGGLRTLPFIIANEAFERMATVGFTPNMILYLCREYNMETTAATNIIFI  61

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DS  446
            W A T  +P+ GA+LADS +GR+++IG       +GMVLLW  T++P AKPP C    + 
Sbjct  62   WTAATNFLPIVGALLADSYVGRYRMIGFGCFTCLLGMVLLWSTTILPGAKPPACDQLRNG  121

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAI  620
            C SAT  QL+ L  +F L+S+GSGG+ S  LAFGA+QL       + GA++SYFSWYY  
Sbjct  122  CESATWSQLMPLYFAFGLMSLGSGGIRSSSLAFGAEQLDKGDGTKSKGALQSYFSWYYVF  181

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +   +V +TC+VY+Q+N GWK+G+G+  V ML +AL FFL SPFYVK
Sbjct  182  VSASSIVAVTCIVYIQDNLGWKVGFGVPAVIMLLSALSFFLASPFYVK  229



>ref|XP_010318545.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=581

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 153/237 (65%), Gaps = 7/237 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            + +M D +K    +  +  KGG  T+PFI+   AL S+ +  L  +M  YLM +Y MD+ 
Sbjct  7    LSQMEDSEKQN-SSIKSRKKGGLITIPFIIANEALESVASYGLLPNMTFYLMRDYRMDIT  65

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            T  NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G V+LWL  +IP A+PP
Sbjct  66   TTQNLLFFWSAATNFLPIVGAVVADSYLGRFLTIGLGSIFSFMGTVVLWLTAMIPKARPP  125

Query  432  PCSDS---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGA---ME  593
            PC+ S   C S TT Q +LL  SF+L+S+G+GG+ S  LAFGA+QL    NN      ME
Sbjct  126  PCNQSGQACKSTTTSQYMLLVFSFLLMSIGAGGIRSSSLAFGANQLDKGDNNPNKYKMME  185

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            S+F+WYY +     ++ LT +VYLQ+  GWK+G+G+  + M  +AL F+L SPFY+K
Sbjct  186  SFFTWYYTLCVASVLIALTGIVYLQDRLGWKVGFGVPAILMFLSALSFYLASPFYIK  242



>ref|XP_006486905.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
Length=585

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 157/243 (65%), Gaps = 14/243 (6%)
 Frame = +3

Query  72   MEKMGDEQK----PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   +E+K    PLL+  + +PKGG RTLPFI+   A  SM ++    +MI YL  EY+
Sbjct  1    METCSEEKKMITEPLLI--NKNPKGGIRTLPFIIANEAFESMASTGFMPNMILYLCREYN  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M +  G+N+++FW A +  +P+ GA LADS +GR+ +IG   I   +GMVLLWL T++PH
Sbjct  59   MKITEGTNVLFFWSAASSFLPILGAFLADSYVGRYLMIGFGCITCLLGMVLLWLTTILPH  118

Query  420  AKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ----N  575
            A+P  C     DSC SAT  QL+LL  +F L+S+G GG+ S  LAFGA+QL+        
Sbjct  119  ARPLACDYPLRDSCESATGSQLMLLYLAFGLMSLGGGGIRSSSLAFGAEQLEKRDGIKSK  178

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            +  A++SYF WYY   +   +V +T +VY+Q+N GWK+G+GI    ML +AL FFL SPF
Sbjct  179  SECALKSYFGWYYVSVSASSMVAVTLIVYIQDNLGWKMGFGIPAAIMLLSALCFFLASPF  238

Query  756  YVK  764
            YVK
Sbjct  239  YVK  241



>ref|XP_006343083.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=594

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 152/237 (64%), Gaps = 8/237 (3%)
 Frame = +3

Query  78   KMGDEQKPL--LVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            KM D ++    L+   +  KGG  T+PFI+   AL ++ +  L  +M  YLM EY MD+ 
Sbjct  16   KMEDSERQTFSLIPIKSRKKGGLITMPFIIANEALENVASYGLLPNMTFYLMREYRMDIT  75

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            T  NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G V+LWL  +IP A+PP
Sbjct  76   TTQNLLFFWSATTNFLPIVGAVVADSYLGRFLTIGLGSIFSFLGTVVLWLTAMIPKARPP  135

Query  432  PCSDS---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGA---ME  593
            PC  S   C S TT Q +LL  SF+L+S+G+GG+  C LAFGA+Q     +N      +E
Sbjct  136  PCDQSGQACKSTTTSQYMLLVFSFLLMSIGAGGIRPCSLAFGANQFDKGGSNPNKHTVLE  195

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            S+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL SPFY+K
Sbjct  196  SFFAWYYTSSIVSVLIALTGIVYLQDRLGWKIGFGVPAILMFLSALFFFLASPFYIK  252



>ref|XP_004235680.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=597

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 151/240 (63%), Gaps = 11/240 (5%)
 Frame = +3

Query  78   KMGDEQKPL-----LVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            KM D ++       L+   +  KGG  T+PFI+   AL ++ +  L  +M  YLM EY M
Sbjct  16   KMEDSERQTYSHSSLIPIKSRNKGGLMTMPFIIANEALENVASYGLLPNMTFYLMREYRM  75

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
            D+    NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G  +LWL  +IP A
Sbjct  76   DITATQNLLFFWSAATNFLPIVGAVVADSYLGRFLTIGLGSIFSFMGTAVLWLTAMIPRA  135

Query  423  KPPPCSDS---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGA--  587
            +PPPC+ S   C S TT Q +LL  SF+L+S+G+GG+  C LAFGA+Q     NN+    
Sbjct  136  RPPPCNQSGQACKSTTTSQYMLLVFSFLLMSIGAGGIRPCSLAFGANQFDKGDNNSNKRT  195

Query  588  -MESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ES+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  + LFFFL SPFY+K
Sbjct  196  VLESFFAWYYTSSIVSVLIALTGIVYLQDRFGWKIGFGVPAILMFLSVLFFFLASPFYIK  255



>ref|XP_006476061.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=581

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 149/228 (65%), Gaps = 7/228 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL+  + +PKGG RTLPFI+   A   M +  L  +MI YL GEY+M+   G+N++  
Sbjct  13   EPLLI--NKNPKGGLRTLPFIIANEAFERMASMGLMPNMILYLCGEYNMETTAGTNVLLI  70

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---S  446
            W A T  +P+ GA LADS +GR+ +IG   I   +G+VLLWL T++  A+PP C      
Sbjct  71   WTAATNFLPIIGAFLADSCVGRYPMIGFGCITCLLGVVLLWLTTILSQAQPPACDQLRSD  130

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNN--AGAMESYFSWYYAI  620
            C SAT  QL+LL ++  L+S+G GG+ S  LAFGA+QL+    N   GA++SYFSWYY  
Sbjct  131  CESATWSQLMLLYSALGLMSLGGGGIRSSSLAFGAEQLEKGDENKSKGALQSYFSWYYVS  190

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
                 +V +TC+VY+Q+N GWK+G+G+  V  L +AL FFL SPFYV+
Sbjct  191  VLASSMVAVTCIVYIQDNLGWKVGFGVPAVISLLSALSFFLASPFYVQ  238



>ref|XP_006486906.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486907.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Citrus sinensis]
Length=585

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 156/243 (64%), Gaps = 14/243 (6%)
 Frame = +3

Query  72   MEKMGDEQK----PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   +E+K    PLL+  + +PKGG RTLPFI+   A  SM ++    +MI YL  EY+
Sbjct  1    METCSEEKKMITEPLLI--NKNPKGGIRTLPFIIANEAFESMASTGFMPNMILYLCREYN  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M +  G+N+++FW A +  +P+ GA LADS +GR+ +IG   I   +GMVLLWL T+ PH
Sbjct  59   MKITEGTNVLFFWSAASSFLPILGAFLADSYVGRYLMIGFGCITCLLGMVLLWLTTIFPH  118

Query  420  AKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ----N  575
            A+P  C     DSC SAT  QL+LL  +F L+S+G GG+ S  LAFGA+QL+        
Sbjct  119  ARPVACDYPLRDSCESATGSQLMLLYLAFGLMSLGGGGIRSSSLAFGAEQLEKRDGIKSK  178

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            +  A++SYF WYY   +   +V +T +VY+Q+N GWK+G+GI    ML +AL FFL SPF
Sbjct  179  SECALKSYFGWYYVSVSASSMVAVTLIVYIQDNLGWKMGFGIPAAIMLLSALCFFLASPF  238

Query  756  YVK  764
            YVK
Sbjct  239  YVK  241



>gb|KDO79783.1| hypothetical protein CISIN_1g039943mg [Citrus sinensis]
Length=581

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 149/228 (65%), Gaps = 7/228 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL+  + +PKGG RTLPFI+   A   M +  L  +MI YL GEY+M+   G+N++  
Sbjct  13   EPLLI--NKNPKGGLRTLPFIIANEAFERMASMGLMPNMILYLCGEYNMETTAGTNVLLI  70

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---S  446
            W A T  +P+ GA LADS +GR+ +IG   I   +G+VLLWL T++  A+PP C      
Sbjct  71   WTAATNFLPIIGAFLADSCVGRYPMIGFGCITYLLGVVLLWLTTILSQAQPPACDQLRSD  130

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNN--AGAMESYFSWYYAI  620
            C SAT  QL+LL ++  L+S+G GG+ S  LAFGA+QL+    N   GA++SYFSWYY  
Sbjct  131  CESATWSQLMLLYSALGLMSLGGGGIRSSSLAFGAEQLEKGDENKSKGALQSYFSWYYVS  190

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
                 +V +TC+VY+Q+N GWK+G+G+  V  L +AL FFL SPFYV+
Sbjct  191  VLASSMVAVTCIVYIQDNLGWKVGFGVPAVISLLSALSFFLASPFYVQ  238



>gb|KDP37260.1| hypothetical protein JCGZ_06316 [Jatropha curcas]
Length=611

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 146/239 (61%), Gaps = 6/239 (3%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            E  E+    Q  ++ TT  + KGGF TLPFI+   A   + +  L  +MI YL+ +YHM 
Sbjct  2    EKTEETASRQTEVMTTTPKTRKGGFVTLPFIIANEAFEKVASYGLLPNMILYLLKDYHMS  61

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
            +  G+N+I+ W A T   P+ GA L+DS +GRF  IGI SI    G++LLWL  +IP  K
Sbjct  62   VAKGANIIFLWNAATNFSPLLGAFLSDSYLGRFLTIGIGSIASLSGVILLWLTAMIPRLK  121

Query  426  PPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGA  587
            P PC      SC + T  QL +L +S  L+S+G+GG+  C LA+GADQ+ +  N  N   
Sbjct  122  PLPCDLMTPTSCKTPTGGQLTMLFSSMALMSIGAGGIRPCSLAYGADQIDNRSNPKNERV  181

Query  588  MESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +ESYF WYYA  A+  ++ LT +VY+Q++ GW++G+G+  + M FA   F + SP Y+K
Sbjct  182  LESYFGWYYASTAVSVIIALTAIVYIQDHQGWRVGFGVPAILMFFALFLFLVASPLYLK  240



>ref|XP_006426938.1| hypothetical protein CICLE_v10025189mg [Citrus clementina]
 gb|ESR40178.1| hypothetical protein CICLE_v10025189mg [Citrus clementina]
Length=611

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 142/217 (65%), Gaps = 5/217 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   A   + +  L  +MI YLM +YH+ +  G+N+++FW A T  +P+ 
Sbjct  27   KGGLITMPFIIANEAFEKVASYGLVTNMILYLMKDYHLGVANGTNVLFFWTAATNFMPIL  86

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA L+DS +GRF  IG+AS    +GM LLWL  +IP  KP PC+    SC S TT Q+ L
Sbjct  87   GAFLSDSYLGRFLTIGLASFCSLLGMFLLWLTAMIPKVKPSPCNILTQSCESPTTAQMTL  146

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            L +SF  +S+G+GG+  C +AFGADQL  K   NN   +ES+F WYYA  A+  V+ LT 
Sbjct  147  LISSFCFISIGAGGIRPCSIAFGADQLDRKDNPNNERVLESFFGWYYATSAIAVVIALTA  206

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q++ GWK+G+G+  + M+ + L FF+ SP YVK
Sbjct  207  IVYIQDHLGWKVGFGVPAILMVLSVLLFFIASPLYVK  243



>ref|XP_002516544.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45885.1| nitrate transporter, putative [Ricinus communis]
Length=578

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 149/222 (67%), Gaps = 6/222 (3%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            S++ KGGFR LPFIV  MA   + +  L  +MI YL  EY ++   G+N+I+FW A T  
Sbjct  18   SSNQKGGFRVLPFIVVNMAFEKVASFGLTPNMILYLTREYRIEAAKGANIIFFWSAATNF  77

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC----SDSCSSATT  464
             P+ GA +ADS +GRF++IG  SI   +G++LLWL  VIP A+P PC    SDSC S TT
Sbjct  78   TPILGAFIADSYVGRFRMIGFGSIASLLGIILLWLTAVIPQARPLPCDQFTSDSCQSPTT  137

Query  465  FQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEV  638
             QLLLL +SF LLS+G+GG+ S  LAFGADQL   Q+   AG +E + SWYY + ++  V
Sbjct  138  LQLLLLYSSFGLLSIGAGGIRSSSLAFGADQLGMGQSLKRAGILERFISWYYVLVSVSAV  197

Query  639  VGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            V +TC+VY+Q+  GWK+G+G+ VV M  A L FF  S FYVK
Sbjct  198  VAMTCIVYIQDAMGWKVGFGVPVVLMAIAVLSFFSASSFYVK  239



>ref|XP_006465634.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Citrus sinensis]
 ref|XP_006465635.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Citrus sinensis]
 gb|KDO56946.1| hypothetical protein CISIN_1g007262mg [Citrus sinensis]
 gb|KDO56947.1| hypothetical protein CISIN_1g007262mg [Citrus sinensis]
Length=611

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 142/217 (65%), Gaps = 5/217 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   A   + +  L  +MI YLM +YH+ +  G+N+++FW A T  +P+ 
Sbjct  27   KGGLITMPFIIANEAFEKVASYGLVTNMILYLMKDYHLGVAKGTNVLFFWTAATNFMPIL  86

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA L+DS +GRF  IG+AS    +GM LLWL  +IP  KP PC+    SC S TT Q+ L
Sbjct  87   GAFLSDSYLGRFLTIGLASFCSLLGMFLLWLTAMIPKVKPSPCNILTQSCESPTTAQMTL  146

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            L +SF  +S+G+GG+  C +AFGADQL  K   NN   +ES+F WYYA  A+  V+ LT 
Sbjct  147  LISSFCFISIGAGGIRPCSIAFGADQLDRKDNPNNERVLESFFGWYYATSAIAVVIALTA  206

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q++ GWK+G+G+  + M+ + L FF+ SP YVK
Sbjct  207  IVYIQDHLGWKVGFGVPAILMVLSLLLFFIASPLYVK  243



>ref|XP_006450665.1| hypothetical protein CICLE_v10010641mg [Citrus clementina]
 gb|ESR63905.1| hypothetical protein CICLE_v10010641mg [Citrus clementina]
Length=581

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 149/228 (65%), Gaps = 7/228 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL+  + +PKGG RTLPFI+   A   M +  L  +MI YL GEY+M+   G+N++  
Sbjct  13   EPLLI--NKNPKGGLRTLPFIIANEAFERMASMGLMPNMILYLCGEYNMETTAGTNVLLI  70

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---S  446
            W A T  +P+ GA LADS +GR+ +IG   I   +G+VLLWL T++  A+PP C      
Sbjct  71   WTAATNFLPIIGAFLADSCVGRYPMIGFGCITCLLGVVLLWLTTILSQAQPPACDQLRSD  130

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH--IQNNAGAMESYFSWYYAI  620
            C SAT  QL+LL ++  L+S+G GG+ S  LAFGA+QL+      + GA++SYFSWYY  
Sbjct  131  CESATWSQLMLLYSALGLMSLGGGGIRSSSLAFGAEQLEKGDETKSKGALQSYFSWYYVS  190

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
                 +V +TC+VY+Q+N GWK+G+G+  V  L +AL FFL SPFYV+
Sbjct  191  VLASSMVAVTCIVYIQDNLGWKVGFGVPAVMTLLSALSFFLASPFYVQ  238



>ref|XP_003522705.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Glycine max]
 ref|XP_006578223.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Glycine max]
Length=568

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 146/226 (65%), Gaps = 3/226 (1%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++PLL   +++ KGGFRTLPFI+   A   + +  L  +MI YL  EY M     +N + 
Sbjct  12   EEPLLSKQNSNAKGGFRTLPFIIANEAFERLASLGLMPNMILYLTREYGMQTAGATNFLL  71

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP--PPCSDS  446
             W A +   P  GA+L+DS +GR+ +I   SI   +GMVLLWL T+IP +KP     ++S
Sbjct  72   LWSAASNFTPFVGAVLSDSYVGRYSMIAFGSIASLLGMVLLWLTTLIPLSKPLCNQFTNS  131

Query  447  C-SSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGAMESYFSWYYAIF  623
            C +S TT  LL+L +SF L+S+G+GG+ S  LAFG DQL     NAG  ESYFSWYYAI 
Sbjct  132  CNNSPTTIHLLILHSSFALMSIGAGGIRSSSLAFGVDQLSKRDKNAGIKESYFSWYYAIV  191

Query  624  ALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            A+  ++GLT +VY+Q+N GW +G+GI V+ M  A   FFL SPFYV
Sbjct  192  AMSSLIGLTVVVYIQDNMGWAVGFGIPVILMFVATASFFLASPFYV  237



>gb|KHN10207.1| Putative peptide transporter [Glycine soja]
Length=562

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 147/226 (65%), Gaps = 3/226 (1%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++PLL   +++ KGGFRTLPFI+   A   + +  L  +MI YL  EY M     +N + 
Sbjct  6    EEPLLSKQNSNAKGGFRTLPFIIANEAFERLASLGLMPNMILYLTREYGMQTAGATNFLL  65

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP--PPCSDS  446
             W A +   P  GA+L+DS +GR+ +I   SI   +GMVLLWL T+IP +KP     ++S
Sbjct  66   LWSAASNFTPFVGAVLSDSYVGRYSMIAFGSIASLLGMVLLWLTTLIPLSKPLCNQFTNS  125

Query  447  C-SSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGAMESYFSWYYAIF  623
            C +S TT  LL+L +SF L+S+G+GG+ S  LAFG DQL     NAG  ESYFSWYYAI 
Sbjct  126  CNNSPTTIHLLILHSSFALMSIGAGGIRSSSLAFGVDQLSKRDKNAGIKESYFSWYYAIV  185

Query  624  ALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            A+  ++GLT +VY+Q+N GW +G+GI V+ M  A + FFL SPFYV
Sbjct  186  AMSSLIGLTVVVYIQDNMGWAVGFGIPVILMFVATVSFFLASPFYV  231



>gb|KJB56778.1| hypothetical protein B456_009G135700 [Gossypium raimondii]
Length=579

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 151/235 (64%), Gaps = 10/235 (4%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
             +M  E+ P         KGG  T+PFI+   +   + +  L  +MI YL+ +YHM +  
Sbjct  13   REMSHEEMP-----ETHSKGGLITMPFIIANESFEKVASYGLVPNMILYLIKDYHMGVAK  67

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
            G+N+++FW A T   P+ GA +ADS +GRF  IG+ SI   +GM+LLWL  ++P +KPPP
Sbjct  68   GTNILFFWQAATNFTPILGAFVADSYLGRFLTIGLGSICSLLGMILLWLTAMVPQSKPPP  127

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C   + +CSS T+ Q+ LL  SFVL+S+G+GGV  C LAFGADQL    N  N   +ES+
Sbjct  128  CDLMTQTCSSPTSAQMTLLFFSFVLISLGAGGVRPCSLAFGADQLDRRDNPKNVRVLESF  187

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F WYYA  A+  ++ LT +VY+Q+  G+++G+G+  + ML +AL FFL SPFY+K
Sbjct  188  FGWYYASAAISVLIALTGIVYIQDQFGYRVGFGVPAILMLLSALVFFLASPFYLK  242



>ref|XP_007019700.1| Nitrate transporter, putative [Theobroma cacao]
 gb|EOY16925.1| Nitrate transporter, putative [Theobroma cacao]
Length=603

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 150/244 (61%), Gaps = 13/244 (5%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSA-------SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMG  230
            MEK  D Q        A       S KGG +T+PF++       +    L A+MI YL  
Sbjct  3    MEKPSDHQMKSSENQHAQQQKQITSQKGGLKTMPFVISNETFEKVAGIGLQANMILYLKN  62

Query  231  EYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTV  410
            +YHM   TG+N+++ W AI+  +P+ GA L+DS +GRF+VI + ++I  +GM LLWL  V
Sbjct  63   KYHMSTATGTNVLFLWSAISNFMPILGAFLSDSFLGRFRVIALGTVISLLGMSLLWLTAV  122

Query  411  IPHAKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN-  575
            +P A+PP CS    +SC+S    QL LL +SF L+S+G+GG+  C LAFGADQ  +  N 
Sbjct  123  LPQARPPDCSSQNLESCASPKAAQLALLFSSFALMSIGAGGIRPCSLAFGADQFNNPSNP  182

Query  576  -NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSP  752
             N   ++S+F+WYYA   +  ++ +T +VY+Q+ AGW +G+G+    MLF+ + F LGSP
Sbjct  183  KNERVLQSFFNWYYASVGISIMISITVIVYIQDKAGWAVGFGVPAGLMLFSTVMFLLGSP  242

Query  753  FYVK  764
             Y+K
Sbjct  243  LYIK  246



>ref|XP_009783586.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana sylvestris]
Length=613

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 152/241 (63%), Gaps = 10/241 (4%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSA-----SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEY  236
            ME    +QK     +S+      PKGG  T+PFI+   AL  + +  L  +M  YLM +Y
Sbjct  17   MEDSEQQQKQTSPHSSSIPIKSRPKGGLITMPFIIANEALEKVASYGLLPNMTFYLMKDY  76

Query  237  HMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP  416
             M++ T  NL++FW A T  +P+ GA +ADS +GRF  IG+ SI  F+G  +LWL  +IP
Sbjct  77   RMEVTTAQNLLFFWSAATNFLPLVGAFVADSYLGRFLAIGLGSIFSFLGTTVLWLTAMIP  136

Query  417  HAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNA  581
             A+PPPC+    +C SAT  Q +LL  SF+L+S+G+GG+  C LAFGA+Q   +   NN 
Sbjct  137  KARPPPCNQVGQACKSATASQFMLLVFSFLLMSIGAGGIRPCSLAFGANQFDKRDNPNNQ  196

Query  582  GAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
              +ES+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL SPFY+
Sbjct  197  RVLESFFAWYYTSSIVSVLIALTGIVYLQDKMGWKIGFGVPAILMFLSALFFFLASPFYI  256

Query  762  K  764
            K
Sbjct  257  K  257



>emb|CDY69519.1| BnaAnng30710D [Brassica napus]
Length=292

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 144/232 (62%), Gaps = 7/232 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K + +     PKGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQLNGEKKPKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---  440
            + W A T   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC    
Sbjct  69   FMWSAATNFTPLLGAFLSDSYLGRFLTIAIASLSSFLGMVLLWLTAMLPQVKPSPCDPTA  128

Query  441  --DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
              + C SAT  QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGNHCGSATASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YYA  A+  ++  T +VY+QE+ GW+IG+G+  V ML AAL F L  P YV+
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWRIGFGVPAVLMLIAALLFVLAFPLYVR  240



>ref|XP_009628045.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=613

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 146/224 (65%), Gaps = 5/224 (2%)
 Frame = +3

Query  108  VTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAI  287
            +   + PKGG  T+PFI+   AL  + +  L  +M  YLM +Y M++ T  NL++FW A 
Sbjct  34   IPIKSRPKGGLITMPFIIANEALEKVASYGLLPNMTFYLMKDYRMEVTTAQNLLFFWSAA  93

Query  288  TYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSA  458
            T  +P+ GA +ADS +GRF  IG+ SI  F+G  +LWL  +IP A+PPPC+    +C SA
Sbjct  94   TNFLPLVGAFVADSYLGRFLAIGLGSIFSFLGTTVLWLTAMIPKARPPPCNQVGQACKSA  153

Query  459  TTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALC  632
            T  Q +LL  SF+L+S+G+GG+  C LAFGA+Q   +   NN   +ES+F+WYY    + 
Sbjct  154  TASQFMLLVFSFLLMSIGAGGIRPCSLAFGANQFDKRDNPNNQRVLESFFAWYYTSSIVS  213

Query  633  EVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL SPFY+K
Sbjct  214  VLIALTGIVYLQDKMGWKIGFGVPAILMFLSALFFFLASPFYIK  257



>emb|CDY69522.1| BnaCnng63980D [Brassica napus]
Length=292

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 143/232 (62%), Gaps = 7/232 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K + +     PKGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQLNGEKKPKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---  440
            + W A T   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC    
Sbjct  69   FMWSAATNFTPLLGAFLSDSYLGRFLTIAIASLSSFLGMVLLWLTAMLPQVKPSPCDPTA  128

Query  441  --DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
              + C SAT  QL LL T+F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGNHCGSATASQLALLYTAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YYA  A+  ++  T +VY+QE+ GW+IG+G+  V ML AA  F L  P YV+
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWRIGFGVPAVLMLIAAFLFVLAFPLYVR  240



>ref|XP_006343084.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=594

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 151/237 (64%), Gaps = 8/237 (3%)
 Frame = +3

Query  78   KMGDEQKPL--LVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            KM D ++    L+   +  KGG  T+PFI+   AL ++ +  L  +M  YLM EY MD+ 
Sbjct  16   KMEDSERQTFSLIPIKSRKKGGLITMPFIIANEALENVASYGLLPNMTFYLMREYRMDIT  75

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            T  NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G V+LWL  +IP A+PP
Sbjct  76   TTQNLLFFWSATTNFLPIVGAVVADSYLGRFLTIGLGSIFSFLGTVVLWLTAMIPKARPP  135

Query  432  PCSDS---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGA---ME  593
            PC  S   C S TT Q +LL  SF+L+S+G+GG+  C LAFGA+Q     +N      +E
Sbjct  136  PCDQSGQACKSTTTSQYMLLVFSFLLMSIGAGGIRPCSLAFGANQFDKGGSNPNKHTVLE  195

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            S+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL S FY+K
Sbjct  196  SFFAWYYTSSIVSVLIALTGIVYLQDRLGWKIGFGVPAILMFLSALFFFLASLFYIK  252



>ref|XP_006343081.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=617

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 152/243 (63%), Gaps = 9/243 (4%)
 Frame = +3

Query  57   ASTEIMEKM-GDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            + TE  EK       P+ + +    KGGF T+PFI+   AL S+ +  L  +M  YLMG+
Sbjct  15   SKTEDSEKQTSSHSSPIPIKSRK--KGGFITMPFIIANEALESVASYGLLPNMTNYLMGQ  72

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            Y M   T  NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G  +LWL  +I
Sbjct  73   YRMGFTTAQNLLFFWSATTNFLPIVGAVVADSYLGRFLTIGLGSIFSFLGSTVLWLTAMI  132

Query  414  PHAKPPPCSDS---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH---IQN  575
            P A+PPPC+ +   C+S T  Q +LL  SF+LLS+G+GG+  C LAFGA+Q        N
Sbjct  133  PKARPPPCNQTGQACNSTTGPQYMLLVFSFLLLSIGAGGIRPCSLAFGANQFDKGGSDPN  192

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
                +ES+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL SPF
Sbjct  193  KQTVLESFFAWYYTSSVVSVLIALTGIVYLQDRLGWKIGFGVPAILMFLSALFFFLASPF  252

Query  756  YVK  764
            Y+K
Sbjct  253  YIK  255



>ref|XP_008462682.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=583

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 149/235 (63%), Gaps = 11/235 (5%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EKM   QK          KGG RT+PFI+       ++   L A+MI YLM EYHMD   
Sbjct  7    EKMETTQK------VERKKGGLRTMPFIIANETFEKISNVGLHANMIFYLMNEYHMDKAK  60

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
            G+ +++ W A+T  +P+ GA L+DS +GRF+VI + +++  +GMV+LWL  + P A+PP 
Sbjct  61   GAIVLFLWSALTNFLPIGGAFLSDSYLGRFKVIAMGTVVTLLGMVVLWLTAIFPKARPPH  120

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C   S+ C SA T QL+LL  +F+L++ G+GG+  C LAFGADQL++  N  N   M+S+
Sbjct  121  CRPPSEFCVSANTAQLMLLYFAFLLMAAGAGGIRPCSLAFGADQLENPGNPKNQRTMQSF  180

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   +   + +  +VYLQ  AGW +G+G+ V  MLF+ + FFLGS  YVK
Sbjct  181  FNWYYASVGISVTISVVFMVYLQNAAGWIVGFGVPVGLMLFSTVMFFLGSSLYVK  235



>ref|XP_010654644.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 ref|XP_010654645.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 ref|XP_010654646.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Vitis vinifera]
 emb|CBI36110.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 149/234 (64%), Gaps = 9/234 (4%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTG  257
            +   EQ+ +    S   KGG  T+PFI+   A   + +  L  +MI YL+ +YH+ +  G
Sbjct  4    EANSEQRKM----SQRAKGGLITMPFIIANEAFERVASYGLLPNMILYLIQDYHLGVAKG  59

Query  258  SNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC  437
            +N+++ W A T  +PV GA L+DS +GRF  IG+ SI   +GM+LLWL  +IP  KPP C
Sbjct  60   TNILFLWSAATNFLPVVGAFLSDSYLGRFLTIGLGSITSLLGMILLWLTAMIPKTKPPHC  119

Query  438  ---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
               + SC + T  Q +LL +SF L+S+G+GGV  C LAFGADQL    N  N   +ES+F
Sbjct  120  DLLTQSCKAPTAAQFILLYSSFALMSIGAGGVRPCSLAFGADQLDKRDNPKNERVLESFF  179

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            SWYYA  AL  V+ LT +VY+Q + GW++G+G+  + M FAAL FFL SPFY+K
Sbjct  180  SWYYASAALSVVIALTGIVYIQVHLGWRVGFGVPAILMFFAALLFFLASPFYIK  233



>ref|XP_002299719.2| hypothetical protein POPTR_0001s18640g [Populus trichocarpa]
 gb|EEE84524.2| hypothetical protein POPTR_0001s18640g [Populus trichocarpa]
Length=597

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 146/223 (65%), Gaps = 5/223 (2%)
 Frame = +3

Query  111  TTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAIT  290
            TT    KGG  T+PFI+   A   + +  L  +MI YLM +Y + +  G+N+++ W A T
Sbjct  20   TTPKHSKGGLITMPFIIANEAFEKVASYGLIPNMILYLMRDYSVGVAKGTNILFLWTAGT  79

Query  291  YIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSAT  461
              +P+ GA+++DS +GRF  IG+ SI   +GM+LLWL  ++P  +PPPC   + SC + T
Sbjct  80   NFMPILGALISDSYLGRFLTIGLGSISSLLGMILLWLTAMVPKVRPPPCDITTQSCKTPT  139

Query  462  TFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCE  635
            T Q+ LL +SF L+S+G+GGV  C +AFGADQL +  N  N   +ES+F WYYA  A+  
Sbjct  140  TGQMTLLLSSFALMSIGAGGVRPCSIAFGADQLDNKSNPKNERVLESFFGWYYASAAISV  199

Query  636  VVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++ LT +VY+Q++ GWK+G+G+  + M  +AL FF  SPFYVK
Sbjct  200  LISLTAIVYIQDHLGWKVGFGVPAILMFLSALLFFFASPFYVK  242



>gb|KEH28715.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=601

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 145/235 (62%), Gaps = 7/235 (3%)
 Frame = +3

Query  78   KMGDEQKPLLVTT-SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            KM  +QK  +++      KGGF T+PFI+   +L  + T  L  +MI YLMG Y++ +  
Sbjct  15   KMDSQQKDTVISQPQLHNKGGFITMPFIIANESLARVATLGLLPNMILYLMGSYNLHLSK  74

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
             ++++    A T  +P+ GA +ADS +GRF  +G+ SII F+GM+LLWL  +IP A+PPP
Sbjct  75   ANHILLLSVATTNFMPLIGAFVADSHLGRFLAVGLGSIITFIGMILLWLTAMIPQARPPP  134

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C   ++ C SATT Q + +  S + L     G + C +AFGADQ+    N  N  A+E +
Sbjct  135  CIPATEKCISATTAQ-MAMLISSLALMSIGNGGLQCSIAFGADQVNRKDNPDNQRALEIF  193

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            FSWYYA  A+  ++  T +VY+Q++ GWK+G+G+    M F+  FFFL SP YVK
Sbjct  194  FSWYYASSAISVIIAFTGIVYIQDHLGWKLGFGVPAALMFFSTFFFFLASPLYVK  248



>ref|XP_011008319.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Populus euphratica]
Length=597

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 146/223 (65%), Gaps = 5/223 (2%)
 Frame = +3

Query  111  TTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAIT  290
            TT    KGG  T+PFI+   A   + +  L  +MI YLM +Y + +  G+N+++ W A T
Sbjct  20   TTPKHSKGGLITMPFIIANEAFEKVASYGLIPNMILYLMRDYSVGVAKGTNILFLWTAGT  79

Query  291  YIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSAT  461
              +P+ GA+++DS +GRF  IG+ SI   +GM+LLWL  ++P  +PPPC   + SC + T
Sbjct  80   NFMPILGALISDSYLGRFLTIGLGSISSLLGMILLWLTAMVPKVRPPPCDITTRSCKTPT  139

Query  462  TFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCE  635
            T Q+ LL +SF L+S+G+GGV  C +AFGADQL +  N  N   +ES+F WYYA  A+  
Sbjct  140  TGQMTLLLSSFALMSIGAGGVRPCSIAFGADQLDNKSNPKNERVLESFFGWYYASAAISV  199

Query  636  VVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++ LT +VY+Q++ GWK+G+G+  + M  +AL FF  SPFYVK
Sbjct  200  LISLTAIVYVQDHLGWKVGFGVPAILMFLSALLFFFASPFYVK  242



>ref|XP_011019627.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=571

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 149/237 (63%), Gaps = 6/237 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASP-KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            ME    E+K +L+     P KGG RT+PFI+   A   + +  L  +MI YLM  Y M+ 
Sbjct  1    MENSIVEEKMVLIPKDKDPRKGGLRTMPFIIVNEAFERVASYGLMPNMIFYLMKNYRMEA  60

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
             +GS +++ W A++  + + GA L+DS MGR+ VI + S+   +GM+LLWL  +IP   P
Sbjct  61   ASGSTILFLWSAMSNGLSIFGAFLSDSFMGRYLVISLGSLCSLLGMILLWLTAMIPQLTP  120

Query  429  PPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAME  593
            PPC   ++ CSSAT  QL  L +SF L+S+G+G +  C +AFGADQL + +  NN   ++
Sbjct  121  PPCDRFTNVCSSATAGQLATLFSSFGLISIGAGCIRPCSIAFGADQLDNKENPNNESVLQ  180

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            S+F+WYYA   L  ++  T +VY+Q+N GWK+G+ I  V M F+AL F +GS  YVK
Sbjct  181  SFFNWYYAATGLSTIIAFTAIVYVQDNLGWKVGFAIPAVLMFFSALMFLVGSSQYVK  237



>gb|KHG04534.1| hypothetical protein F383_29859 [Gossypium arboreum]
Length=580

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 151/235 (64%), Gaps = 10/235 (4%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
             +M  E+ P         KGG  T+PFI+   +   + +  L  +MI YL+ +YHM +  
Sbjct  13   REMSHEEMP-----ETHSKGGLITMPFIIANESFEKVASYGLVPNMILYLIKDYHMGVAK  67

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
            G+N+++FW A T   P+ GA +ADS +GRF  IG+ SI   +GM+LLWL  ++P +KP P
Sbjct  68   GTNILFFWQAATNFTPILGAFVADSYLGRFLTIGLGSICSLLGMILLWLTAMVPQSKPLP  127

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C   + +CSS T+ Q+ LL  SFVL+S+G+GGV  C LAFGADQL    N  N   +ES+
Sbjct  128  CDLMTQTCSSPTSAQMTLLFFSFVLISLGAGGVRPCSLAFGADQLDRRDNPKNVRVLESF  187

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F WYYA  A+  ++ LT +VY+Q++ G+++G+G+  + ML +AL FFL SPFY+K
Sbjct  188  FGWYYASAAISVLIALTGIVYIQDHFGYRVGFGVPAILMLLSALVFFLASPFYLK  242



>gb|KJB59595.1| hypothetical protein B456_009G262700 [Gossypium raimondii]
Length=601

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 145/235 (62%), Gaps = 11/235 (5%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTG  257
            K GDE+K +         GG +T+PF++       + +  L  +MI YL  EYHM + TG
Sbjct  11   KSGDEEKHV-----TRKLGGLKTMPFVISNETFEKVASFGLLPNMILYLTNEYHMSIATG  65

Query  258  SNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC  437
            +N+++ W AI+  +P+ GA L+DS +GRF VI + ++   +GM LLWL  V P A+PP C
Sbjct  66   ANVLFIWSAISNFMPILGAFLSDSFLGRFLVIALGTVTSLIGMSLLWLTAVFPQARPPHC  125

Query  438  ----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
                ++SC  A + QL  L  SFVL+S+G+GG+  C LAFGADQL    N  N   M+S+
Sbjct  126  DSPMTESCVKANSAQLAHLFGSFVLMSIGAGGIRPCSLAFGADQLYDPSNPKNKRVMQSF  185

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   L  ++ +T +VY+Q+ AGW +G+G+ V  M  + + F LGSP Y+K
Sbjct  186  FNWYYASVGLAIMISITVIVYIQDKAGWVVGFGVPVGLMFISTVMFLLGSPLYIK  240



>ref|XP_004235683.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=603

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 151/237 (64%), Gaps = 7/237 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            + +M D +K    +  +  KGG  T+PFI+   AL ++ +  L  +M  YLM EY MD+ 
Sbjct  11   LSQMEDSEKQN-SSIKSRKKGGLITMPFIIANEALENVASYGLLPNMTFYLMREYRMDIT  69

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
               NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G ++LWL  +IP A+PP
Sbjct  70   ATQNLLFFWSAATNFLPIVGAVVADSYLGRFLTIGLGSIFSFMGTLVLWLTAMIPKARPP  129

Query  432  PCSDS---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGA---ME  593
            PC+ S   C S TT Q +LL  SF+L+S+G+GG+ S   AFGA+QL    +N      +E
Sbjct  130  PCNQSGQVCKSTTTSQYMLLIFSFLLMSIGAGGIRSSSSAFGANQLDKGDSNPNKYTMLE  189

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            S+F+WYY +     ++ LT +VYLQ+  GWKIG+G+  + M  + LFF++ SPFY+K
Sbjct  190  SFFTWYYTLSIASVLIALTGIVYLQDRLGWKIGFGVSAILMFLSTLFFYIASPFYIK  246



>ref|XP_007024207.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY26829.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=568

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 141/240 (59%), Gaps = 11/240 (5%)
 Frame = +3

Query  54   LASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            +AS +IMEK G  Q      +S   KGGF  LPFI+   AL  + + +L   M  YL   
Sbjct  1    MASEKIMEK-GIRQD-----SSERRKGGFIALPFIIANEALEKVPSYALVPSMTLYLKSN  54

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            YH+ +    NLI  W A +   P+ GA  ADS MGRF  IG+ SI  F+G+ +LWL TVI
Sbjct  55   YHLTIAAVHNLINHWQAFSNFAPILGAFFADSFMGRFVTIGLGSISSFLGVAILWLTTVI  114

Query  414  PHAKPPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAG  584
            P A PPPC   + SC SAT  Q+ +L  +    S+G+GG+  C + FGADQL +   N  
Sbjct  115  PQATPPPCDHLAQSCKSATAGQVAILVAALFFKSIGAGGIRPCSMPFGADQLSN--KNEK  172

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ESYFSWYYA  +L   +GLT ++Y+ +  GW +GYG+  + M  A + F++ SP YVK
Sbjct  173  ILESYFSWYYAAASLGGSLGLTSVIYILQMYGWMVGYGVCAILMFLATVAFYIASPLYVK  232



>ref|XP_011026618.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=263

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 145/237 (61%), Gaps = 6/237 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSAS-PKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            ME    E+K +L+       KGG RT+PF +  MA   + +  L  +M+ YLM  Y ++ 
Sbjct  1    MENTIAEEKMILIAKDKDRKKGGLRTMPFFIVNMAFERVASYGLMPNMMFYLMNNYRLET  60

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
              GS +++ W A++  + + GA L+DS MGR+ VI + S    +GM+LLWL  +IP  +P
Sbjct  61   ENGSTILFLWSAMSNGLSIFGAFLSDSFMGRYLVISLGSFCSLLGMILLWLTAMIPQLQP  120

Query  429  PPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAME  593
            PPC   +D+CSSAT  ++ +L  SF L+S+G+G +  C +AF ADQL + +  NN   ++
Sbjct  121  PPCDRFTDTCSSATADRMAVLFFSFGLISIGAGCIRPCSIAFSADQLHNEENPNNESVLQ  180

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            S+F+WYYA   L  ++  T +VY+Q+N  WK+G+ +  + M  +AL F +GS  YVK
Sbjct  181  SFFNWYYAAKGLSTIIAFTVIVYIQDNLSWKVGFAVPAILMFLSALMFLVGSSQYVK  237



>ref|XP_007150641.1| hypothetical protein PHAVU_005G169400g [Phaseolus vulgaris]
 gb|ESW22635.1| hypothetical protein PHAVU_005G169400g [Phaseolus vulgaris]
Length=605

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 139/232 (60%), Gaps = 6/232 (3%)
 Frame = +3

Query  84   GDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSN  263
            G+E     +      KGG  T+PFI+   AL  + +  L  +MI+YLMG Y + +   + 
Sbjct  12   GEEVSTQHIPQPQKRKGGLVTMPFIIANEALARVASLGLLPNMIQYLMGTYKLHLAKATQ  71

Query  264  LIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS-  440
            ++    A +   PV GA +ADS +GRF  +G+ S I F+GM LLWL  +IP A+PPPCS 
Sbjct  72   ILLLSSASSNFTPVVGAFIADSYLGRFLTVGLGSAISFLGMTLLWLTAMIPQARPPPCSH  131

Query  441  --DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSW  608
              + C SAT  Q + +  S + L     G +SC LAFGADQ+  K   NN   +E++FSW
Sbjct  132  EAEGCKSATGGQ-MAMLISALALMSIGNGGLSCSLAFGADQVNRKDNPNNRRILETFFSW  190

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YYA  A+  ++ LT +VY+Q+N GWK+GYG+    ML + +FFFL SP Y+K
Sbjct  191  YYASAAISVIIALTAIVYIQDNVGWKVGYGVPAALMLLSTIFFFLASPLYLK  242



>ref|XP_010487466.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Camelina sativa]
Length=595

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 143/229 (62%), Gaps = 6/229 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +P      +  KGG  T+PFI+G  A   + +  L  +MI YLM +Y + +     +++ 
Sbjct  16   QPSSSRRRSRAKGGLLTMPFIIGNEAFEKVASYGLLQNMILYLMNDYRLGVAKAQTVLFM  75

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC----SD  443
            W A T  +P+ GA L+DS +GRF  I +AS+ GF+GMV+LWL  ++P  KP PC      
Sbjct  76   WVAATNFLPLVGAFLSDSYLGRFLTIAVASLSGFLGMVVLWLTAMLPQVKPSPCLATAGT  135

Query  444  SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
            +CSSAT+ QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F WYYA
Sbjct  136  NCSSATSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGWYYA  195

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              ++  ++  T +VY+Q++ GWKIG+GI  + ML A   F   SP YVK
Sbjct  196  SSSVAVLIAFTVIVYIQDHLGWKIGFGIPAILMLLAGFLFVFASPLYVK  244



>gb|KCW79141.1| hypothetical protein EUGRSUZ_C00586, partial [Eucalyptus grandis]
Length=400

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 161/289 (56%), Gaps = 60/289 (21%)
 Frame = +3

Query  72   MEKMGDE----------QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKY  221
            M +MGD           ++PLL   + +PKGG RT+PFI+   A   + +  L  +M+ Y
Sbjct  1    MSQMGDRSCDQPAKKMIREPLL--ENPTPKGGLRTIPFIIANEAFEKVASFGLLPNMVLY  58

Query  222  LMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIG---IASIIGFV----  380
            L  EYH++ V  +N+++ W A T  +P+ GA LADS  GR+ +IG   IAS++G +    
Sbjct  59   LTREYHLENVAAANVLFLWSAATNFLPIIGAFLADSYFGRYAMIGFGSIASLLGLMNKIT  118

Query  381  ----------------------------------GMVLLWLPTVIPHAKPPPCS----DS  446
                                              GM+LLWL TV P A+PP C     D+
Sbjct  119  GFLAFGLEQSLEIPSLVAVQILADEIYVLIQTEKGMILLWLTTVFPQARPPSCDEFSKDT  178

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLK---HIQNNAGAMESYFSWYYA  617
            C SATT QLLLL +SF L+S+G+GGV S  LAFGADQLK   + +N+   ++ YFSWYY 
Sbjct  179  CGSATTAQLLLLYSSFGLMSIGAGGVRSSALAFGADQLKTGANSKNSGNLLQKYFSWYYV  238

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
                  +V +TC+VY+Q+ AGWK+G+G+ VV M  +   FFL SPFY K
Sbjct  239  SVMASVMVAMTCIVYIQDTAGWKVGFGVPVVLMFISTFSFFLASPFYFK  287



>ref|XP_002516008.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF46428.1| nitrate transporter, putative [Ricinus communis]
Length=612

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 149/242 (62%), Gaps = 11/242 (5%)
 Frame = +3

Query  54   LASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            LA TE+M     +  P       S KGG  T+PFI+   A   +++  L  +MI YLM +
Sbjct  10   LAQTEVMASTHQQHTP------KSRKGGLITMPFIIANEAFEKVSSYGLLPNMIFYLMKD  63

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            Y + +  G+N+I+ W A T  +P+ GA ++DS +GR+  IG+ SI   +G VLLWL T+I
Sbjct  64   YGLGVAKGANIIFLWNAATNFMPLLGAFISDSYLGRYLTIGLGSIFSLLGTVLLWLTTMI  123

Query  414  PHAKPPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--N  578
            P +KPP C   + +C S T  Q+ +L +S   +S+G+GG+  C LAFGADQL +  N  N
Sbjct  124  PQSKPPLCDLMTQNCKSPTAGQITMLLSSMAFISIGAGGIRPCSLAFGADQLDNKSNPKN  183

Query  579  AGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFY  758
               +ESYF WYYA  A+  ++ LT +VY+Q++ GW++G+G+  + +  +A  FF+ SP Y
Sbjct  184  ERILESYFGWYYASTAISVLIALTGIVYIQDHHGWRVGFGVPAILVFLSAFLFFIASPLY  243

Query  759  VK  764
            +K
Sbjct  244  LK  245



>ref|XP_011026619.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X1 [Populus 
euphratica]
Length=581

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 156/236 (66%), Gaps = 7/236 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ++  G+ ++PLL  +S++ KGG R L FI+   A   +    L+A++I YL  EY +D V
Sbjct  5    LDHKGEIKEPLL--SSSTTKGGLRALIFIIVNEAFERLANYGLSANLILYLTREYGIDAV  62

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
             G+ ++Y   A T   P  GA LAD+ +GR+ +IG   I   +G++LLWL T+IP A+PP
Sbjct  63   NGAQILYLHSAATNFTPFIGAFLADTYVGRYFMIGFGCIACLLGVILLWLTTIIPGARPP  122

Query  432  PC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMES  596
            PC    DSC SA+T QLLLL +S  L+++G+GG+ S  LAFGADQL    N   AG +ES
Sbjct  123  PCVQFHDSCESASTLQLLLLYSSLGLMAIGAGGIRSSSLAFGADQLGKRDNLKRAGILES  182

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +FSWYYA  ++   + +TC++Y+Q+N GWK+G+GI VV M+ + L FFL SP YVK
Sbjct  183  FFSWYYATVSVAVFLAMTCILYIQDNLGWKVGFGIPVVLMILSTLSFFLASPIYVK  238



>ref|XP_002308609.1| hypothetical protein POPTR_0006s25670g [Populus trichocarpa]
 gb|EEE92132.1| hypothetical protein POPTR_0006s25670g [Populus trichocarpa]
Length=572

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 148/237 (62%), Gaps = 6/237 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASP-KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            ME    E+K +L+     P KGG RT+PFI+   A   + +  L  +MI YLM  Y M+ 
Sbjct  1    MENSIVEEKMVLIPKDKDPRKGGLRTMPFIIVNEAFERVASYGLMPNMIFYLMKNYRMEA  60

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
             +GS +++ W A++  + + GA L+DS MGR+ VI + S    +GM+LLWL  +IP   P
Sbjct  61   ASGSTILFLWSAMSNGLSIFGAFLSDSFMGRYLVISLGSFCSLLGMILLWLTAMIPQLTP  120

Query  429  PPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAME  593
            PPC   ++ CSSAT  QL  L +SF L+S+G+G +  C +AFGADQL + +  NN   ++
Sbjct  121  PPCDRFTNVCSSATAGQLATLFSSFGLISIGAGCIRPCSIAFGADQLDNKENPNNESVLQ  180

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            S+F+WYYA   L  ++  T +VY+Q+N GWK+G+ I  V M F+AL F +GS  YVK
Sbjct  181  SFFNWYYAATGLSTIIAFTAIVYVQDNLGWKVGFAIPAVLMFFSALMFLVGSSQYVK  237



>ref|XP_004151437.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=582

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 148/235 (63%), Gaps = 11/235 (5%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EKM   QK          KGG RT+PFI+       ++   L A+MI YLM EYH+D   
Sbjct  7    EKMETTQK------VERKKGGLRTMPFIIANEIFEKISNVGLHANMIFYLMNEYHLDSAK  60

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
            G+ +++ W A+T ++P+ GA L+DS +GRF+VI + +++  VGMV+LWL  + P A+PP 
Sbjct  61   GAIVLFLWSALTNLLPIGGAFLSDSYLGRFKVIAMGTVVTLVGMVVLWLTAIFPKARPPH  120

Query  435  CS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C+   + C SA T QL+LL  +F+L++ G+GG+  C LAFGADQL++  N  N   M+S+
Sbjct  121  CTPAGEFCVSANTAQLMLLYFAFLLMAAGAGGIRPCSLAFGADQLENPGNPRNQRTMQSF  180

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   +   + +  +VYLQ   GW +G+G+ V  MLF+   FFLGS  YVK
Sbjct  181  FNWYYASVGISVTISVVFMVYLQNATGWVVGFGVPVGLMLFSTAMFFLGSSLYVK  235



>ref|XP_006392949.1| hypothetical protein EUTSA_v10011325mg [Eutrema salsugineum]
 gb|ESQ30235.1| hypothetical protein EUTSA_v10011325mg [Eutrema salsugineum]
Length=609

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 146/232 (63%), Gaps = 7/232 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K + +  +   KGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQLNGAKKSKGGIITMPFIIANEAFEKVASYGLLPNMIMYLITDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-  446
            + W A TY  P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC  + 
Sbjct  69   FMWSAATYFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTT  128

Query  447  ----CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
                C SAT  QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AESHCGSATAPQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YYA  A+  ++  T +VY+QE+ GW+IG+G+  V M+ AAL F L SP YV+
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWRIGFGVPAVLMVIAALLFVLASPLYVR  240



>ref|XP_009786716.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana sylvestris]
Length=609

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/250 (42%), Positives = 154/250 (62%), Gaps = 15/250 (6%)
 Frame = +3

Query  60   STEIMEKMGDEQKPLLVTTSASP----------KGGFRTLPFIVGTMALVSMTTSSLAAD  209
            S++ M KM ++    L ++S SP          KGG  T+PFI+   +L  + +  L  +
Sbjct  9    SSDHMTKMEEDHNHQLSSSSFSPMAVPRIMTRSKGGLVTMPFIIANESLEKVASYGLLPN  68

Query  210  MIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMV  389
            M  YLM +Y M + T  NL+++W + T  +P+ GA +ADS +GRF VIG  SI  F+G V
Sbjct  69   MTFYLMKDYRMGVTTAQNLLFYWSSATNFLPLVGAFIADSYLGRFLVIGFGSIFSFLGAV  128

Query  390  LLWLPTVIPHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL  560
            LLWL  +IP A+P PC     +C SAT  Q  LL +SF+L+S+G+GGV  C LAFGA+Q 
Sbjct  129  LLWLTAMIPKARPSPCDLSVQACKSATPAQYTLLVSSFMLMSIGAGGVRPCSLAFGANQF  188

Query  561  KHIQ--NNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalf  734
                  NN   +E++F+WYYA   +  ++ +T +VYLQ++ GWK+G+G+  + M F+ L 
Sbjct  189  DKPDNPNNKRVLETFFNWYYASAMISVLIAMTGIVYLQDHMGWKVGFGVPAIIMFFSGLL  248

Query  735  fflGSPFYVK  764
            FFL SP Y+K
Sbjct  249  FFLASPLYIK  258



>ref|XP_004171650.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide transporter 
At1g52190-like [Cucumis sativus]
Length=582

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 147/235 (63%), Gaps = 11/235 (5%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EKM   QK          KGG RT+PFI+       ++   L A+MI YLM EYH+D   
Sbjct  7    EKMETTQK------VERKKGGLRTMPFIIANEIFEKISNVGLHANMIFYLMNEYHLDSAK  60

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
            G+ +++ W A+T ++P+ GA L+DS +GRF+VI + +++  VGMV LWL  + P A+PP 
Sbjct  61   GAIVLFLWSALTNLLPIGGAFLSDSYLGRFKVIAMGTVVTLVGMVXLWLTAIFPKARPPH  120

Query  435  CS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C+   + C SA T QL+LL  +F+L++ G+GG+  C LAFGADQL++  N  N   M+S+
Sbjct  121  CTPAGEFCVSANTAQLMLLYFAFLLMAAGAGGIRPCSLAFGADQLENPGNPRNQRTMQSF  180

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   +   + +  +VYLQ   GW +G+G+ V  MLF+   FFLGS  YVK
Sbjct  181  FNWYYASVGISVTISVVFMVYLQNATGWVVGFGVPVGLMLFSTAMFFLGSSLYVK  235



>emb|CDY20187.1| BnaA01g28150D [Brassica napus]
Length=294

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 147/234 (63%), Gaps = 8/234 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ +L      PKGG  T+PFI+       + +  L  +MI YLM +Y + +V G N+
Sbjct  9    ESKEMMLQPRIIRPKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYGLGLVKGQNV  68

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS  446
            ++ W A T  +P+ GA L+DS +GRF  I IAS+  F+GM++LWL  ++P  KP PC  S
Sbjct  69   LFMWVAATNFMPLVGAFLSDSYLGRFLTISIASLSSFLGMMVLWLTAMLPQVKPSPCVAS  128

Query  447  ----CSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
                CSS  AT+ QL LL  +F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F
Sbjct  129  TVTKCSSTAATSSQLALLYFAFGLISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFF  188

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             WYYA  ++  ++  T +VY+Q++ GW+IG+G+  + ML A++ F   SP YVK
Sbjct  189  GWYYASSSVAVLIAFTVIVYIQDHLGWRIGFGVPAILMLLASIVFVFASPLYVK  242



>ref|XP_009147706.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Brassica rapa]
Length=606

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 145/232 (63%), Gaps = 7/232 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K + +     PKGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQLNGEKKPKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---  440
            + W A T   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC    
Sbjct  69   FMWSAATNFTPLLGAFLSDSYLGRFLTIAIASLSSFLGMVLLWLTAMLPQVKPSPCDPTA  128

Query  441  --DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
              + C SAT  QL LL ++FVL+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGNHCGSATASQLALLYSAFVLISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YYA  A+  ++  T +VY+QE+ GW+IG+G+  V ML AAL F L  P YV+
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWRIGFGVPAVLMLIAALLFVLAFPLYVR  240



>gb|KJB18644.1| hypothetical protein B456_003G064500 [Gossypium raimondii]
Length=591

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 152/238 (64%), Gaps = 10/238 (4%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            + ME+  D ++        S KGG  T+PFI+G  +L  +   ++  +MI YL+ +YHM 
Sbjct  3    DKMEESSDRRE-----MWRSKKGGLITMPFIIGNESLEKVAGYAVVPNMILYLIKDYHMS  57

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
            +  G+N++++W A T   P+  A +ADS +GRF +IG ASI   +GM+LLWL  ++P +K
Sbjct  58   VAKGTNILFYWQAATNFTPILAAFVADSYLGRFLIIGFASICSLLGMILLWLTAMVPESK  117

Query  426  PPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAM  590
            PP C   +  C S T  Q+ LL +SFVL+S+G+GGV  C LAFGADQL    N  N   +
Sbjct  118  PPTCDLLTQRCRSPTAAQMSLLISSFVLISIGAGGVRPCSLAFGADQLDQRDNPKNDRVL  177

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ES+F WYYA  A+  ++ LT +VY+Q++ G+++G+G+  + ML + L FF+ SP Y+K
Sbjct  178  ESFFGWYYASAAISVLIALTGIVYIQDHLGYRVGFGVSAILMLLSVLVFFIASPLYLK  235



>gb|KJB33640.1| hypothetical protein B456_006G023500 [Gossypium raimondii]
Length=598

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 146/235 (62%), Gaps = 11/235 (5%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTG  257
            K G+E+K L      +  GG +T+ F++ T     + +  L A+MI YL+ EYHM    G
Sbjct  10   KHGEEEKHL-----TTKLGGLKTMAFVISTETFEKVASFGLHANMILYLINEYHMSNAKG  64

Query  258  SNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC  437
            +N+++ W AI+  +P+ GA L+DS +GRF+VI + + +  +GM LLWL   +P A PP C
Sbjct  65   ANVLFLWSAISNFMPILGAFLSDSFLGRFRVIALGTFVSLLGMSLLWLTAALPQATPPQC  124

Query  438  ----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
                ++SC+S    QL LL +S  L+S+G+GG+  C LAFGADQL +  N  N   ++S+
Sbjct  125  NGLATESCASPKAAQLALLFSSLALMSIGAGGIRPCALAFGADQLYNPSNPENKRVLQSF  184

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   L  +V +T +VY+Q+ AGW IG+G+    M  + + F LGSP Y+K
Sbjct  185  FNWYYASVGLSLMVSITVIVYIQDAAGWVIGFGVPAGLMFLSTVMFLLGSPLYIK  239



>ref|XP_006297268.1| hypothetical protein CARUB_v10013282mg [Capsella rubella]
 gb|EOA30166.1| hypothetical protein CARUB_v10013282mg [Capsella rubella]
Length=597

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 138/218 (63%), Gaps = 6/218 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+       + +  L  +MI YLM +Y + +  G  +++ W A T  +P+ 
Sbjct  29   KGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYRLGVAKGQTVLFMWVAATNFMPLV  88

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC----SDSCSSATTFQll  476
            GA L+DS  GRF  I IAS+  F+GMV LWL  V+P  KP PC      SCSSAT+ QL 
Sbjct  89   GAFLSDSFFGRFLTIAIASLSSFLGMVFLWLTAVLPQVKPSPCVAAAGTSCSSATSSQLA  148

Query  477  llctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLT  650
            LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F WYYA  ++  ++  T
Sbjct  149  LLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGWYYASSSVAVLIAFT  208

Query  651  CLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +VY+Q++ GWKIG+GI  + ML AA  F L SP YVK
Sbjct  209  VIVYIQDHLGWKIGFGIPAILMLLAAFLFVLASPLYVK  246



>ref|XP_007024218.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY26840.1| Major facilitator superfamily protein [Theobroma cacao]
Length=605

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 150/238 (63%), Gaps = 5/238 (2%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            + ME   D+++          KGG  T+PFI+   +L  + +  L  +MI YL+ +YHM 
Sbjct  3    DKMEGSSDQREMTHQDIPDRQKGGLITMPFIIANESLEKVASYGLVPNMILYLIKDYHMG  62

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
            +  G+N ++FW A T   P+  A ++DS +GR+  IG+ SI   +GM+LLWL  +IP +K
Sbjct  63   VAKGTNTLFFWQAATNFTPILCAFVSDSYLGRYLTIGLGSICSLLGMILLWLTAMIPQSK  122

Query  426  PPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAM  590
            P PC   + SC S T  Q+ LL +SFVL+SVG+GGV  C LAFGADQL    N  N   +
Sbjct  123  PFPCDLLTQSCRSPTAAQMTLLTSSFVLISVGAGGVRPCSLAFGADQLDRRDNPKNDRVL  182

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ES+F WYYA  A+  ++ LT +VY+Q++ GWK+G+G+  + ML +A+ FFL SP Y+K
Sbjct  183  ESFFGWYYASAAISVLIALTGIVYIQDHLGWKVGFGVPAILMLLSAIVFFLASPLYLK  240



>ref|XP_009593688.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=603

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 155/252 (62%), Gaps = 16/252 (6%)
 Frame = +3

Query  54   LASTEIMEKMGDEQKPLLVTTSASP----------KGGFRTLPFIVGTMALVSMTTSSLA  203
            L+S   M KM ++    L ++S SP          KGG  T+PFI+   +L  + +  L 
Sbjct  8    LSSDHHMTKMEEDHHHQL-SSSLSPMAVPRIMTRSKGGLITMPFIIANESLEKVASYGLL  66

Query  204  ADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVG  383
             +M  YLM +Y M +    NL+++W + T  +P+ GA +ADS +GRF VIG  SI  F+G
Sbjct  67   PNMTFYLMKDYRMGVTAAQNLLFYWSSATNFLPLVGAFIADSYLGRFLVIGFGSIFSFLG  126

Query  384  MVLLWLPTVIPHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGAD  554
             VLLWL  +IP A+PPPC+    +C SAT  Q  LL +SF+L+S+G+GGV  C LAFGA+
Sbjct  127  AVLLWLTAMIPKARPPPCNLSGQACKSATPAQYTLLVSSFMLMSIGAGGVRPCSLAFGAN  186

Query  555  QLKHIQ--NNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaa  728
            Q       NN   +E++F+WYYA   +  ++ +T +VYLQ++ GWK+G+G+  + M F+ 
Sbjct  187  QFDKPDNPNNKRVLETFFNWYYASAMISVLIAMTGIVYLQDHMGWKVGFGVPAIIMFFSG  246

Query  729  lffflGSPFYVK  764
            L FFL SP Y+K
Sbjct  247  LLFFLASPLYIK  258



>ref|XP_010545694.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Tarenaya hassleriana]
Length=600

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 146/230 (63%), Gaps = 5/230 (2%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K    ++    KGG  T+PFI+   A   +++  L  +MI YLM +Y   +  G+N++
Sbjct  9    EMKENQPSSHGRTKGGLITMPFIIANEAFEKVSSYGLLPNMIMYLMRDYGFGLARGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-  446
            Y W A T  +P+ GA L+DS +GRF  I  AS+  F+GM+LLWL  ++P  KPPPC++  
Sbjct  69   YMWSAATNFLPLLGAFLSDSYLGRFLTIAFASLSSFMGMLLLWLTAMLPQVKPPPCNNPT  128

Query  447  --CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYY  614
              C S T  QL LL ++F L+S+GSGG+  C LAFGADQL   +N  N   +ES+F WYY
Sbjct  129  GVCKSPTASQLALLYSAFALISIGSGGIRPCSLAFGADQLDKKENPKNERVLESFFGWYY  188

Query  615  AIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            A  A+  ++ LT +VY+Q++ GW++G+GI  + ML A LFF L SP YVK
Sbjct  189  ASSAVSVLIALTGIVYIQDHLGWRLGFGIPAILMLLALLFFVLASPLYVK  238



>ref|XP_010503915.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Camelina sativa]
Length=595

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 143/229 (62%), Gaps = 6/229 (3%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +P   +  +  KGG  T+PFI+G  A   + +  L  +MI YLM +Y + +     +++ 
Sbjct  16   QPSSSSRRSRAKGGLLTMPFIIGNEAFEKVASYGLLQNMILYLMSDYRLGVAKAQTVLFM  75

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC----SD  443
            W A T  +P+ GA L+DS +GRF  I +AS+ GF+GMV+LWL  ++P  KP PC      
Sbjct  76   WVAATNFLPLVGAFLSDSYLGRFLTIAVASLSGFLGMVVLWLTAMLPQVKPSPCVATAGT  135

Query  444  SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
            +CSS T+ QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F WYYA
Sbjct  136  NCSSPTSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGWYYA  195

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              ++  ++  T +VY+Q++ GWKIG+GI  + ML A   F   SP YVK
Sbjct  196  SSSVAVLIAFTVIVYIQDHLGWKIGFGIPAILMLLAGFLFVFASPLYVK  244



>gb|AAM61194.1| unknown [Arabidopsis thaliana]
Length=292

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 147/239 (62%), Gaps = 9/239 (4%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPK--GGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            ME   +E +   + T+   K  GG  T+PFI+   A   + +  L  +MI YL+ +Y   
Sbjct  1    MENPPNETEAKQIQTNEGKKTMGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFG  60

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
            +  G+N+++ W A +   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  K
Sbjct  61   VAKGTNVLFMWSAASNFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVK  120

Query  426  PPPCSDS-----CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
            P PC  +     C S+T  QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N  
Sbjct  121  PSPCDPTAAGSHCGSSTASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNER  180

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
             +ES+F WYYA  A+  ++  T +VY+QE+ GWKIG+G+  V ML AAL F L SP YV
Sbjct  181  VLESFFGWYYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPAVLMLIAALLFILASPLYV  239



>ref|XP_006596167.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=585

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 145/234 (62%), Gaps = 7/234 (3%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EK+ +   P   ++S   KGG RT+PFI+   +L  + +  +  +MI YL  EY M +  
Sbjct  10   EKLLENGTP---SSSQMRKGGLRTMPFIIVNESLEKVASYGIMPNMILYLRDEYRMSIAK  66

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
            G+++IY W A + I+ + GA L+DS +GRF VI I S    +G+ +LWL  +IP  KP  
Sbjct  67   GTSVIYTWTAASDILSIFGAFLSDSYLGRFLVIAIGSFSSLLGLTMLWLTAMIPDLKPTR  126

Query  435  CSD--SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYF  602
             SD   C+SAT  QL LL  S  L+S+G+G V  C +AFGADQL  K   N+   ++SYF
Sbjct  127  ESDMLGCNSATAVQLALLFFSMGLISIGAGCVRPCSIAFGADQLTIKERSNDERLLDSYF  186

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +WYY   A+  ++ L+ +VY+QEN GWKIG+G+  + M  +A  F LGSPFYVK
Sbjct  187  NWYYTSIAISSMIALSVIVYIQENLGWKIGFGLPALLMFISAASFILGSPFYVK  240



>ref|XP_002885127.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61386.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=593

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 144/231 (62%), Gaps = 9/231 (4%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            +Q+P+        KGG  T+PFI+       + +  L  +MI YLM +Y + +V G  ++
Sbjct  15   QQQPI---RRRRTKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYRLGLVKGQTVL  71

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC----  437
            + W A T  +P+ GA L+DS +GRF  I IAS+   +GMV+LWL  ++P  KP PC    
Sbjct  72   FMWVAATNFMPLVGAFLSDSYLGRFLTIAIASLSSLLGMVVLWLTAMLPQVKPSPCVATA  131

Query  438  SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWY  611
              SCSSAT+ QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F WY
Sbjct  132  GTSCSSATSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGWY  191

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA  ++  ++  T +VY+Q++ GWKIG+GI  + MLFA   F   SP YVK
Sbjct  192  YASSSVAVLIAFTVIVYIQDHLGWKIGFGIPAILMLFAGFLFVFASPLYVK  242



>emb|CDP21289.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 161/278 (58%), Gaps = 50/278 (18%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EK    ++PLL T  ASPKGG  T+PFI+    L  + T  ++ +M  YL+ EYH++M T
Sbjct  7    EKKDMVKEPLLST--ASPKGGSGTMPFIIANSVLEKVATYGVSPNMTLYLLKEYHLEMAT  64

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFV------------------  380
             SN++++  A     PV GAI+AD+ +GRF +IG   +I F+                  
Sbjct  65   ASNILFYLSAANNFTPVLGAIVADAYVGRFHMIGFGCVISFLLIFGQISDKQEERGNSFG  124

Query  381  -------------------------GMVLLWLPTVIPHAKPPPC---SDSCSSATTFQll  476
                                     G ++LWL T+IP A+PPPC   S+SC+SAT+FQL 
Sbjct  125  RGKGEFGFRFPIPRTSTSTTFLHLLGTIVLWLTTMIPQARPPPCNESSNSCTSATSFQLF  184

Query  477  llctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGA--MESYFSWYYAIFALCEVVGLT  650
            +L TSF+LLSVG+GG+ S  LAFGADQ +       A  ++ YFSWYY  ++L  V+ LT
Sbjct  185  MLFTSFILLSVGAGGIRSASLAFGADQFEKRDGKKDAVLLQRYFSWYYVSYSLSLVLALT  244

Query  651  CLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            C+VY+Q+  GW+IG+G  VV M FAA  FFL SPFY+K
Sbjct  245  CMVYIQDQMGWQIGFGASVVVMFFAAFLFFLASPFYIK  282



>ref|XP_010668254.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=574

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 152/229 (66%), Gaps = 11/229 (5%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++PLL T+    KGG RTLPFI+   A     +  L  +MI YLMG Y M++ TGSN I+
Sbjct  12   REPLLGTS----KGGLRTLPFILANEAFEKAASYGLLPNMILYLMGGYGMELATGSNFIF  67

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS--  446
            F  A T + PV GA LADS +GRF +IG  SII F+GM+LLWL  +IP A+  PC +S  
Sbjct  68   FLSAATNLTPVIGAFLADSFVGRFWMIGFGSIISFLGMILLWLTAIIPGAR--PCDESGS  125

Query  447  -CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYA  617
             C+S   FQ  LL +SF L+S+G+GG+ S  LAFGADQL  +    NAG +E +F+WYY 
Sbjct  126  ECTSWNIFQFTLLASSFALMSIGAGGIRSSSLAFGADQLLTRDDLGNAGILERFFNWYYF  185

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +   VV LT +VY+QE  GWK+G+G+ V+ ML ++L FFL SPFY+K
Sbjct  186  AASAAVVVALTLVVYIQEQFGWKVGFGVPVMLMLLSSLSFFLASPFYIK  234



>ref|XP_006343082.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Solanum tuberosum]
Length=552

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 141/213 (66%), Gaps = 7/213 (3%)
 Frame = +3

Query  147  LPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILAD  326
            +PFI+   AL S+ +  L  +M  YLM +Y MD+ T  NL++FW A T  +P+ GA++AD
Sbjct  1    MPFIIANEALESVASYGLLPNMTFYLMRDYRMDITTTQNLLFFWSATTNFLPIVGAVVAD  60

Query  327  SLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS----CSSATTFQllllctsf  494
            S +GRF  IG+ SI  F+G V+LWL  +IP A+PPPC+ S    C S TT Q +LL  SF
Sbjct  61   SYLGRFLTIGLGSIFSFLGTVVLWLTAMIPKARPPPCNQSGHEACKSTTTSQYMLLVFSF  120

Query  495  vllsvgsggvvsCMLAFGADQLKHIQNNAGA---MESYFSWYYAIFALCEVVGLTCLVYL  665
            +L+S+G+GG+  C LAFGA+Q     +N      +ES+F+WYY    +  ++ LT +VYL
Sbjct  121  LLMSIGAGGIRPCSLAFGANQFDKGGSNPNKHTVLESFFAWYYTSSIVSVLIALTGIVYL  180

Query  666  QENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            Q+  GWKIG+G+  + M  +ALFFFL SPFY+K
Sbjct  181  QDRLGWKIGFGVPAILMFLSALFFFLASPFYIK  213



>ref|XP_010318543.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=615

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 147/240 (61%), Gaps = 11/240 (5%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASP-----KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            KM D +K     +S  P     KGG  T+PFI+   AL ++ +  L  +M  YLMGEY M
Sbjct  16   KMEDSEKQTSSHSSPIPIKSRKKGGIITMPFIIANEALENVASYGLLPNMTNYLMGEYRM  75

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
               T  NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G  +LWL  +IP A
Sbjct  76   GFTTTQNLLFFWSAATNFLPIVGAVVADSYLGRFLTIGLGSIFSFMGSAVLWLTAMIPKA  135

Query  423  KPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH---IQNNAG  584
            +PP C+    +C S    Q +LL  +F+L+SVG+GG+  C LAFGA+Q        N   
Sbjct  136  RPPACNQAGQACKSTRGPQYMLLVFAFLLMSVGAGGIRPCSLAFGANQFDKGGSNPNKQT  195

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ES+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL SPFY+K
Sbjct  196  VLESFFAWYYTSSVVSVLIALTGIVYLQDKLGWKIGFGVPAMLMFLSALFFFLASPFYIK  255



>ref|XP_010318544.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Solanum 
lycopersicum]
Length=623

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 147/240 (61%), Gaps = 11/240 (5%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASP-----KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            KM D +K     +S  P     KGG  T+PFI+   AL ++ +  L  +M  YLMGEY M
Sbjct  16   KMEDSEKQTSSHSSPIPIKSRKKGGIITMPFIIANEALENVASYGLLPNMTNYLMGEYRM  75

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
               T  NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G  +LWL  +IP A
Sbjct  76   GFTTTQNLLFFWSAATNFLPIVGAVVADSYLGRFLTIGLGSIFSFMGSAVLWLTAMIPKA  135

Query  423  KPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH---IQNNAG  584
            +PP C+    +C S    Q +LL  +F+L+SVG+GG+  C LAFGA+Q        N   
Sbjct  136  RPPACNQAGQACKSTRGPQYMLLVFAFLLMSVGAGGIRPCSLAFGANQFDKGGSNPNKQT  195

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ES+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL SPFY+K
Sbjct  196  VLESFFAWYYTSSVVSVLIALTGIVYLQDKLGWKIGFGVPAMLMFLSALFFFLASPFYIK  255



>ref|XP_004235682.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X3 [Solanum 
lycopersicum]
Length=616

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 147/240 (61%), Gaps = 11/240 (5%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASP-----KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            KM D +K     +S  P     KGG  T+PFI+   AL ++ +  L  +M  YLMGEY M
Sbjct  16   KMEDSEKQTSSHSSPIPIKSRKKGGIITMPFIIANEALENVASYGLLPNMTNYLMGEYRM  75

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
               T  NL++FW A T  +P+ GA++ADS +GRF  IG+ SI  F+G  +LWL  +IP A
Sbjct  76   GFTTTQNLLFFWSAATNFLPIVGAVVADSYLGRFLTIGLGSIFSFMGSAVLWLTAMIPKA  135

Query  423  KPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKH---IQNNAG  584
            +PP C+    +C S    Q +LL  +F+L+SVG+GG+  C LAFGA+Q        N   
Sbjct  136  RPPACNQAGQACKSTRGPQYMLLVFAFLLMSVGAGGIRPCSLAFGANQFDKGGSNPNKQT  195

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ES+F+WYY    +  ++ LT +VYLQ+  GWKIG+G+  + M  +ALFFFL SPFY+K
Sbjct  196  VLESFFAWYYTSSVVSVLIALTGIVYLQDKLGWKIGFGVPAMLMFLSALFFFLASPFYIK  255



>ref|NP_188239.1| nitrate transporter 1.12 [Arabidopsis thaliana]
 sp|Q8LPL2.2|PTR32_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 1.1; Short=AtNPF1.1; AltName: 
Full=Nitrate transporter 1.12 [Arabidopsis thaliana]
 gb|AEE75781.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=591

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 147/240 (61%), Gaps = 12/240 (5%)
 Frame = +3

Query  63   TEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            TE  E +   Q+P+   T    KGG  T+PFI+       + +  L  +MI YLM +Y +
Sbjct  8    TESKETL---QQPI---TRRRTKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYRL  61

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
             +V G  +++ W A T  +P+ GA L+DS +GRF  I IAS+   +GMV+LWL  ++P  
Sbjct  62   GLVKGQTVLFMWVAATNFMPLVGAFLSDSYLGRFLTIVIASLSSLLGMVVLWLTAMLPQV  121

Query  423  KPPPC----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
            KP PC      +CSSAT+ QL LL T+F L+S+GSGG+  C LAFGADQL + +N  N  
Sbjct  122  KPSPCVATAGTNCSSATSSQLALLYTAFALISIGSGGIRPCSLAFGADQLDNKENPKNER  181

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ES+F WYYA  ++  ++  T +VY+Q++ GWKIG+GI  + ML A   F   SP YVK
Sbjct  182  VLESFFGWYYASSSVAVLIAFTVIVYIQDHLGWKIGFGIPAILMLLAGFLFVFASPLYVK  241



>emb|CDY30141.1| BnaC05g37210D [Brassica napus]
Length=593

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 148/234 (63%), Gaps = 8/234 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ +L   +  PKGG  T+PFI+       + +  L  +MI YLM +Y + +V G  +
Sbjct  9    ESKEMMLPPRTRRPKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYGLGVVKGQTV  68

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---  437
            ++ W A T  +P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC   
Sbjct  69   LFMWVAATNFMPLVGAFLSDSYLGRFLTIAIASLSSFLGMVLLWLTAMLPQVKPSPCIAS  128

Query  438  -SDSCSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
               +CSS  AT+ QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F
Sbjct  129  AGTNCSSPAATSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFF  188

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             WYYA  ++  ++  T +VY+Q++ GW+IG+GI  + ML A++ F   SP YVK
Sbjct  189  GWYYASSSVAVLIAFTVIVYIQDHLGWRIGFGIPAILMLLASIVFAFASPLYVK  242



>gb|AAM20441.1| putative transport protein [Arabidopsis thaliana]
Length=579

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 147/240 (61%), Gaps = 12/240 (5%)
 Frame = +3

Query  63   TEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            TE  E +   Q+P+   T    KGG  T+PFI+       + +  L  +MI YLM +Y +
Sbjct  8    TESKETL---QQPI---TRRRTKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYRL  61

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
             +V G  +++ W A T  +P+ GA L+DS +GRF  I IAS+   +GMV+LWL  ++P  
Sbjct  62   GLVKGQTVLFMWVAATNFMPLVGAFLSDSYLGRFLTIVIASLSSLLGMVVLWLTAMLPQV  121

Query  423  KPPPC----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
            KP PC      +CSSAT+ QL LL T+F L+S+GSGG+  C LAFGADQL + +N  N  
Sbjct  122  KPSPCVATAGTNCSSATSSQLALLYTAFALISIGSGGIRPCSLAFGADQLDNKENPKNER  181

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ES+F WYYA  ++  ++  T +VY+Q++ GWKIG+GI  + ML A   F   SP YVK
Sbjct  182  VLESFFGWYYASSSVAVLIAFTVIVYIQDHLGWKIGFGIPAILMLLAGFLFVFASPLYVK  241



>gb|KFK35804.1| hypothetical protein AALP_AA4G038900 [Arabis alpina]
Length=608

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 144/232 (62%), Gaps = 7/232 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K + +  +  PKGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    ESKQIQLNEAKKPKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGANVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-  446
            Y W A +   P+ GA ++DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC  + 
Sbjct  69   YMWSAASNFTPLLGAFISDSYLGRFITIAIASLSSFLGMVLLWLTAMLPQVKPSPCDPTA  128

Query  447  ----CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
                C  AT  QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGSHCGPATASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YYA  A+  ++  T ++Y+QE+ GWKIG+G+  + ML AAL F L  P YV+
Sbjct  189  YYASSAIAVLIAFTGIIYIQEHLGWKIGFGVPAILMLIAALLFVLAFPLYVR  240



>emb|CDX97728.1| BnaA05g23510D [Brassica napus]
Length=593

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 148/234 (63%), Gaps = 8/234 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ +L   +  PKGG  T+PFI+       + +  L  +MI YLM +Y + +V G  +
Sbjct  9    ESKEMMLPPRTRRPKGGLITMPFIIANEGFEKVASYGLLQNMILYLMSDYGLGVVKGQTV  68

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS  446
            ++ W A T  +P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC  S
Sbjct  69   LFMWVAATNFMPLVGAFLSDSYLGRFLTIAIASLSSFLGMVLLWLTAMLPQVKPSPCIAS  128

Query  447  ----CSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
                CSS  AT+ QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F
Sbjct  129  AGTNCSSPAATSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFF  188

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             WYYA  ++  ++  T +VY+Q++ GW+IG+GI  + ML A++ F   SP YVK
Sbjct  189  GWYYASSSVAVLIAFTVIVYIQDHLGWRIGFGIPAILMLLASIVFVFASPLYVK  242



>ref|XP_004252349.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Solanum lycopersicum]
Length=629

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 141/219 (64%), Gaps = 7/219 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL  + T  +  +M  YLM EY M +    NL+++W + T  +P+ 
Sbjct  68   KGGLVTMPFIIANEALERVATFGVLPNMTFYLMKEYRMGVTNAQNLLFYWSSATNFLPLI  127

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC-----SDSCSSATTFQl  473
            GA +ADS +GRF  IG  SI   +G ++LWL  +IP A+PPPC     S +C SATT Q 
Sbjct  128  GAFIADSYLGRFLTIGFGSIFSLLGTIVLWLTAMIPKARPPPCDLLVSSQACKSATTAQY  187

Query  474  lllctsfvllsvgsggvvsCMLAFGADQLKHIQNN--AGAMESYFSWYYAIFALCEVVGL  647
             +L +SF+L+S+G+GG+  C LAFGA+Q     NN     +E+YF+WYYA   +  ++ +
Sbjct  188  TILISSFMLMSIGAGGIRPCSLAFGANQFDKRDNNNTKRVLETYFNWYYAAVMISVLIAM  247

Query  648  TCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            T +VYLQ++ GWKIG+G+ V+ M F+A  FFL +P Y+K
Sbjct  248  TGIVYLQDHMGWKIGFGVPVIIMFFSAFLFFLATPLYIK  286



>ref|XP_010062498.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
Length=601

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 143/231 (62%), Gaps = 11/231 (5%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            DE+ P         KGG  T+PFI+   A   + +  L  +MI YLM +YH  +  G+N 
Sbjct  5    DEETP------EPTKGGLITMPFIIANEAFEKVASYGLLPNMILYLMRDYHFGVAKGTNF  58

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS  446
            I+FW A T  +P+ GA +ADS +GRF  I + SI    GM LLWL  +IP A+PPPC  S
Sbjct  59   IFFWSAATNFMPLPGAFIADSYLGRFLTIALGSISSLSGMTLLWLTAMIPRARPPPCDQS  118

Query  447  CSSATTF---QllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWY  611
             S+  +    Q++LL ++F L+S+G+GG+  C LAFGADQL  K   NN   +ESYF+WY
Sbjct  119  TSTCESTSTPQMILLISAFALISIGAGGIRPCSLAFGADQLDRKENPNNKRVLESYFNWY  178

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA   +  +V LT +VY Q++ GWK+G+GI  + M F+A  F L SPFYVK
Sbjct  179  YASAFISVLVALTGIVYTQDHLGWKVGFGIPAILMFFSAFLFVLASPFYVK  229



>ref|XP_007135665.1| hypothetical protein PHAVU_010G148000g [Phaseolus vulgaris]
 gb|ESW07659.1| hypothetical protein PHAVU_010G148000g [Phaseolus vulgaris]
Length=582

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 143/242 (59%), Gaps = 12/242 (5%)
 Frame = +3

Query  54   LASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            L+ST+        Q+P         KGGF T+PFI+   AL  + T  L  +M+ YLMG 
Sbjct  7    LSSTQFEMASQHLQQP------QRKKGGFVTMPFIMANEALARVATFGLLPNMVVYLMGT  60

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            Y+  +   + ++    A + I P+ GA +ADS +GRF  +G+ S I F+GM+LLWL  +I
Sbjct  61   YNFHLAKATQVLLLSSATSNITPLIGAFIADSCLGRFLSVGLGSTITFLGMILLWLTAMI  120

Query  414  PHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNN  578
            P A+PPPC+   + C SATT Q + +  S   L     G +SC + FGADQ+  K   NN
Sbjct  121  PQAQPPPCNLETERCKSATTGQ-MAMLISSFALMSFGNGGLSCSMPFGADQVNKKDNPNN  179

Query  579  AGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFY  758
               +E++FSWYYA  A   ++ LT +VY+Q++ GWK+G+G+  V M  + LFFFL SP Y
Sbjct  180  HRVLETFFSWYYAFTAFAVIIALTVIVYIQDHYGWKVGFGVPAVLMFMSTLFFFLASPLY  239

Query  759  VK  764
            VK
Sbjct  240  VK  241



>emb|CDY70561.1| BnaCnng68850D, partial [Brassica napus]
Length=544

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 147/234 (63%), Gaps = 8/234 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ +L      PKGG  T+PFI+       + +  L  +MI YLM +Y + +V G N+
Sbjct  9    ESKEMMLQPRITRPKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYGLGLVKGQNV  68

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS  446
            ++ W A T  +P+ GA L+DS +GRF  I IAS+  F+GM++LWL  ++P  KP PC  S
Sbjct  69   LFMWVAATNFMPLVGAFLSDSYLGRFLTISIASLSSFLGMMVLWLTAMLPQVKPSPCVAS  128

Query  447  ----CSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
                CSS  AT+ QL LL  +F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F
Sbjct  129  TVTKCSSTAATSSQLALLYFAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFF  188

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             WYYA  ++  ++  T +VY+Q++ GW+IG+G+  + ML A + F L SP YVK
Sbjct  189  GWYYASSSVAVLIAFTVIVYIQDHLGWRIGFGVPAILMLLAGILFVLASPLYVK  242



>ref|XP_007137205.1| hypothetical protein PHAVU_009G108400g [Phaseolus vulgaris]
 gb|ESW09199.1| hypothetical protein PHAVU_009G108400g [Phaseolus vulgaris]
Length=568

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 145/226 (64%), Gaps = 3/226 (1%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++PLL   S++ KGGFRTLPFI+   A   + +  L  +MI YL  EY M     +N + 
Sbjct  12   EEPLLSKQSSNAKGGFRTLPFIIANEAFERLASLGLMPNMILYLTREYGMQTAGATNFLL  71

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP--PPCSDS  446
             W A +   P  GA+LADS +GR+ +I   S+   +GMVLLWL T+IP +KP     +DS
Sbjct  72   LWSAASNFTPFIGAVLADSYVGRYSMIAFGSVASLLGMVLLWLTTLIPLSKPLCNQFTDS  131

Query  447  C-SSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGAMESYFSWYYAIF  623
            C +S TT  LL+L +SF L+S+G+GG+ S  LAFG DQL     +AG  ESYFS YYA  
Sbjct  132  CHNSPTTIHLLILHSSFALMSIGAGGIRSSSLAFGVDQLSKSDRDAGIQESYFSCYYAAV  191

Query  624  ALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            ++  ++GLT +VY+Q+  GW +G+GI V+ ML A + FFL SPFYV
Sbjct  192  SMASLIGLTVVVYIQDYMGWAVGFGIPVILMLIATVSFFLASPFYV  237



>ref|XP_009114876.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X1 [Brassica 
rapa]
Length=593

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 147/234 (63%), Gaps = 8/234 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ +L      PKGG  T+PFI+       + +  L  +MI YLM +Y + +V G N+
Sbjct  9    ESKEMMLQPRITRPKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYGLGLVKGQNV  68

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS  446
            ++ W A T  +P+ GA L+DS +GRF  I IAS+  F+GM++LWL  ++P  KP PC  S
Sbjct  69   LFMWVAATNFMPLVGAFLSDSYLGRFLTISIASLSSFLGMMVLWLTAMLPQVKPSPCVAS  128

Query  447  ----CSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
                CSS  AT+ QL LL  +F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F
Sbjct  129  TVTKCSSTEATSSQLALLYFAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFF  188

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             WYYA  ++  ++  T +VY+Q++ GW+IG+G+  + ML A++ F   SP YVK
Sbjct  189  GWYYASSSVAVLIAFTVIVYIQDHLGWRIGFGVPAILMLLASIVFVFASPLYVK  242



>ref|XP_004506898.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506899.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Cicer arietinum]
Length=591

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 143/237 (60%), Gaps = 13/237 (5%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASP---KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            KMG +     V TS S    KGGF T+PFI+    L  + T  L  +MI YLMG Y++ +
Sbjct  14   KMGSQN----VNTSQSQIHIKGGFITMPFIIANETLARVATLGLLPNMIVYLMGSYNIHL  69

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
               + ++    A T  +P+ G+ +ADS +GRF  +G+ SII F+GMVLLWL  +IP A+P
Sbjct  70   SQATQILLLSVATTNFMPLPGSFIADSHLGRFLAVGLGSIITFMGMVLLWLTAMIPQARP  129

Query  429  PPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAME  593
            PPC   +++C  ATT Q + +  S + L     G + C +AFGADQ+      NN  ++E
Sbjct  130  PPCNPATETCKYATTGQ-MAMLISSLALMSIGNGGLQCSIAFGADQVNREDNPNNQRSLE  188

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +FSWYYA  A+  ++  T +VY+Q++ GWK+G+G+    M F+  FFFL SP YVK
Sbjct  189  IFFSWYYASSAISVIIAFTGIVYIQDHFGWKLGFGVPAALMFFSTFFFFLASPLYVK  245



>ref|XP_004141840.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=608

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 147/241 (61%), Gaps = 10/241 (4%)
 Frame = +3

Query  60   STEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ++  M+K  +E+      + +S KGG  T+PFI+ + +L  + +  L  +MI YLM +Y+
Sbjct  5    NSATMQKEEEEE----AISKSSKKGGLLTMPFIIDSESLEKVGSYGLMPNMILYLMKDYN  60

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            +    G+N+++FW A    +P+ GA LADS +GRF  IG  SI  F+GM+LLWL  ++P 
Sbjct  61   LGFAKGNNILFFWSAAINFMPLLGAFLADSYLGRFLTIGFGSIATFLGMLLLWLTAMVPS  120

Query  420  AKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNA  581
             KPP C     ++C S T  Q+ LL  +  L+S+G+GGV  C LAFGADQ+      NN 
Sbjct  121  TKPPACDQLHPETCRSPTAAQMALLAVALTLMSIGAGGVRPCTLAFGADQIDRRDNPNNK  180

Query  582  GAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
              +E +F WYYA  +   ++ LT +VY+Q++ GWK+G+G+    MLFA + FF  S  YV
Sbjct  181  RMLERFFGWYYASASFSVLIALTGIVYIQDHVGWKVGFGVPAGLMLFATVLFFAASSIYV  240

Query  762  K  764
            K
Sbjct  241  K  241



>gb|KFK38969.1| hypothetical protein AALP_AA3G183300 [Arabis alpina]
Length=589

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 149/240 (62%), Gaps = 9/240 (4%)
 Frame = +3

Query  72   MEKMGD--EQKPLLVT--TSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   D  E K +++   T    KGG  T+PFI+       + +  L  +MI YL+ +Y 
Sbjct  1    MENPPDQTESKEMILEPETRTRRKGGLITMPFIIANEGFEKVASYGLLQNMILYLISDYG  60

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            +  V G  +++ W A T  +P+ GA L+DS +GRF  I IAS+  F+GMV+LWL  ++P 
Sbjct  61   LGAVKGQTVLFMWVAATNFMPLVGAFLSDSYLGRFLTISIASLSSFLGMVVLWLTAMLPQ  120

Query  420  AKPPPC-SDSCSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
             KPPPC   +CSS  AT+ QL LL ++F L+S+GSGG+  C LAFGADQL +  N  N  
Sbjct  121  VKPPPCVGTNCSSVTATSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKDNPKNER  180

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +ES+F WYYA  ++  ++  T +VY+Q++ GW+IG+GI  + ML A + F  GSP YVK
Sbjct  181  VLESFFGWYYACSSVAVLIAFTVIVYIQDHLGWRIGFGIPAILMLVAGILFVFGSPLYVK  240



>ref|XP_006359461.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=599

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 143/234 (61%), Gaps = 8/234 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            D   P         KGG  T+PFI+   AL  + T  +  +M  YLM EY M +    NL
Sbjct  21   DPSPPTTTLLLQRSKGGLVTMPFIIANEALERVATFGVLPNMTFYLMKEYSMGVTNAQNL  80

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS--  440
            +++W + T  +P+ GA +ADS +GRF  IG  SI  F+G ++LWL  +IP A+PPPC+  
Sbjct  81   LFYWSSATNFLPLIGAFIADSYLGRFLTIGFGSIFSFLGTIVLWLTAMIPKARPPPCNLL  140

Query  441  ---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAG---AMESYF  602
                +C SATT Q  +L +SF+L+S+G+GG+  C LAFGA+Q      N      +E+YF
Sbjct  141  VSGQACKSATTAQYTILISSFMLMSIGAGGIRPCSLAFGANQFDKRDTNGNIKRVLETYF  200

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +WYYA   +  ++ +T +VYLQ++ GWKIG+G+ VV M F+A  FFL +P Y+K
Sbjct  201  NWYYAAVMISVLIAMTGIVYLQDHMGWKIGFGVPVVIMFFSAFLFFLATPLYIK  254



>gb|KHG12398.1| hypothetical protein F383_17450 [Gossypium arboreum]
Length=583

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 152/239 (64%), Gaps = 10/239 (4%)
 Frame = +3

Query  72   MEKMGDE----QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   DE    ++P L  +S+  KGGFRTLPFI+ T A   + T  L+ +MI YL  E+ 
Sbjct  1    METPSDENNKIREPFL--SSSPSKGGFRTLPFILATEAFERVATLGLSPNMIVYLRREFG  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M+    +N+I+FW A T   P+ GA +ADS MG++++IG  S++ F+GM+LLW   +IP 
Sbjct  59   METAKAANVIFFWSAATNFTPIIGAFIADSYMGKYRMIGFGSVLCFLGMILLWSTAIIPQ  118

Query  420  AKP--PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGA  587
            A+P     + +C + TT QLLLL  S  L+S+G+GG+ S  +AFGADQL    N  N   
Sbjct  119  ARPYCDQFNTTCEAPTTPQLLLLYCSLGLISIGAGGIRSSCMAFGADQLDKRNNPENTKT  178

Query  588  MESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++S+F WYYA      ++ +T +VY+Q+N GW +G+GI V+ M  +A+ FFL S FY+K
Sbjct  179  LQSFFGWYYATVTFSALIAVTLIVYVQDNLGWGMGFGIPVMLMFGSAISFFLASSFYIK  237



>ref|XP_006306954.1| hypothetical protein CARUB_v10008522mg, partial [Capsella rubella]
 gb|EOA39852.1| hypothetical protein CARUB_v10008522mg, partial [Capsella rubella]
Length=664

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/239 (44%), Positives = 145/239 (61%), Gaps = 9/239 (4%)
 Frame = +3

Query  72   MEKMGD--EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            ME   D  E K +        KGG  T+PFI+   A   + +  L  +MI YL+ +Y   
Sbjct  58   MENPPDQTEAKQIQPNGGKRTKGGIITMPFIIANEAFEKVASYGLLPNMILYLIRDYRFG  117

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
            +  G+N++Y W A +   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  K
Sbjct  118  VAKGTNVLYMWSAASNFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVK  177

Query  426  PPPCSDS-----CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
            P PC  +     C SAT  QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N  
Sbjct  178  PSPCDPTAAGSHCGSATASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNER  237

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
             +ES+F WYYA  A+  ++  T +VY+QE+ GWKIG+G+  + ML A+L F L SP YV
Sbjct  238  VLESFFGWYYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPALLMLVASLLFVLASPLYV  296



>ref|XP_009146163.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1 [Brassica rapa]
Length=593

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 148/234 (63%), Gaps = 8/234 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ +L   +  PKGG  T+PFI+       + +  L  +MI YLM +Y + +V G  +
Sbjct  9    ESKEMMLPPRTRRPKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYGLGVVKGQTV  68

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---  437
            ++ W A T  +P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC   
Sbjct  69   LFMWVAATNFMPLVGAFLSDSYLGRFFTIAIASLSSFLGMVLLWLTAMLPQVKPSPCIAS  128

Query  438  -SDSCSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
               +CSS  AT+ QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F
Sbjct  129  AGTNCSSPAATSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFF  188

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             WY+A  ++  ++  T +VY+Q++ GW+IG+GI  + ML A++ F   SP YVK
Sbjct  189  GWYHASSSVAVLIAFTVIVYIQDHLGWRIGFGIPAILMLLASIVFVFASPLYVK  242



>ref|NP_175630.1| nitrate transporter 1.11 [Arabidopsis thaliana]
 sp|Q9M817.1|PTR6_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 1.2; Short=AtNPF1.2; AltName: 
Full=Nitrate transporter 1.11 [Arabidopsis thaliana]
 gb|AAF29404.1|AC022354_3 peptide transporter, putative [Arabidopsis thaliana]
 gb|AEE32766.1| putative peptide transporter [Arabidopsis thaliana]
Length=607

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 142/231 (61%), Gaps = 7/231 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K +        KGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQTNEGKKTKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-  446
            + W A +   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC  + 
Sbjct  69   FMWSAASNFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTA  128

Query  447  ----CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
                C S+T  QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGSHCGSSTASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            YYA  A+  ++  T +VY+QE+ GWKIG+G+  V ML AAL F L SP YV
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPAVLMLIAALLFILASPLYV  239



>ref|XP_011072387.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Sesamum indicum]
Length=592

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 140/231 (61%), Gaps = 11/231 (5%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
             EQ P         KGG  T+PFI+   A   + +  L  +MI YLM EY M +   +NL
Sbjct  19   QEQNP------RKAKGGLITMPFIIANEAFEKVASYGLQPNMIFYLMNEYKMGVTGATNL  72

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS--  440
            I++W A T  +P+ GA LADS +GRF  IG  SI   +GMV LWL  +I  A+PPPC   
Sbjct  73   IFYWSAATNFMPLVGAFLADSFLGRFLTIGFGSIASLLGMVQLWLTAMISRARPPPCDQF  132

Query  441  -DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWY  611
               C  A+  Q  LL +SF L+S+G+GGV  C LAFGADQL + +  NN   +ES+F WY
Sbjct  133  RQHCKLASPAQYSLLLSSFGLMSIGAGGVRPCSLAFGADQLDNKENLNNDRVLESFFGWY  192

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA  +L  ++ LT +VY+Q++ GWK+G+G+  + M F+ L FF+ S  Y+K
Sbjct  193  YASASLSVLIALTGVVYIQDHMGWKVGFGVPAILMFFSTLLFFVASSLYIK  243



>ref|XP_011081806.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Sesamum indicum]
Length=535

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = +3

Query  183  MTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIA  362
            M T  +  +MI YL+ EYHM+M T SN+++ W A    +PV  A +ADS +G+F +IG+ 
Sbjct  1    MATFGVMTNMILYLVNEYHMEMTTASNILFLWTAANNFMPVLCAAIADSYLGKFYIIGLG  60

Query  363  SIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSATTFQllllctsfvllsvgsggvvsC  533
            SI+  +GMVLLW   +I  A+PPPC   SDSCS  T  Q ++LC+S  L++VG+GG+ + 
Sbjct  61   SIVYVMGMVLLWSTALIAQARPPPCDQSSDSCSPPTFLQSMVLCSSLGLIAVGAGGIRAS  120

Query  534  MLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlv  707
             +AFGADQL++ +   N+G  ESYFSWYY ++ +  ++G TC+VY+Q+N GWK+G+    
Sbjct  121  SMAFGADQLENEEGKENSGVGESYFSWYYTLYLIAILMGNTCVVYVQDNMGWKVGFAFPS  180

Query  708  vfmlfaalffflGSPFYVK  764
            V  +F  + FFLGSPFYV+
Sbjct  181  VLTMFGTVSFFLGSPFYVQ  199



>ref|XP_010098095.1| putative peptide transporter [Morus notabilis]
 gb|EXB74532.1| putative peptide transporter [Morus notabilis]
Length=608

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 147/240 (61%), Gaps = 10/240 (4%)
 Frame = +3

Query  60   STEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            S ++ E M ++  P     +  PKGG  T+PFI+   AL  + T  L  +MI YLM +YH
Sbjct  10   SPDVEEDMTNQLIP-----AKRPKGGLITMPFIIVNEALEKVATYGLLPNMILYLMKDYH  64

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            + +  G+++I+ W A    +P+ GA L+DS +GRF  IG  SI  F+GM LLWL  ++P 
Sbjct  65   VGLAKGASIIFLWSAAINFMPLIGAFLSDSYLGRFLTIGFGSIASFMGMTLLWLTAMVPR  124

Query  420  AKPPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
            ++P  C   +  C S  + Q+ +L  SF L+++G+GG+  C LAFGADQ+    N  N  
Sbjct  125  SRPSSCDILTQICKSPASSQMAILVLSFALMAIGAGGIRPCSLAFGADQVDKRDNPKNQR  184

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +E +F+WYYA  A+  ++ LT +VY+QE  GWK+G+G+  + MLFA + FFL S  YVK
Sbjct  185  VLERFFNWYYASAAVSVIIALTAIVYIQEKLGWKLGFGVPALLMLFATVLFFLASSLYVK  244



>ref|XP_006406868.1| hypothetical protein EUTSA_v10020365mg [Eutrema salsugineum]
 gb|ESQ48321.1| hypothetical protein EUTSA_v10020365mg [Eutrema salsugineum]
Length=588

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 149/238 (63%), Gaps = 7/238 (3%)
 Frame = +3

Query  72   MEKMGD--EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            ME   D  E K +L   +  PKGG  T+PFI+   A   + +  L  +M  YL+ +Y + 
Sbjct  1    MENPPDQTESKEILRPRTTRPKGGLLTMPFIIANEAFEKVASYGLVQNMTLYLISDYGLG  60

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
            +V G +++  W A +  +P+ GA L+DS +GRF  I IAS+  F+GMV+LWL  ++P  K
Sbjct  61   VVKGQSVLNMWLASSNFMPLVGAFLSDSYLGRFLTIAIASLSSFLGMVVLWLTAMLPQVK  120

Query  426  PPPCS-DSCSS--ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAM  590
            P PC+  +C S  AT+ QL LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +
Sbjct  121  PSPCAGTNCVSVGATSSQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVL  180

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ES+F WYYA  ++  ++  T +VY+Q++ GW+IG+GI  + ML A + F   SP YVK
Sbjct  181  ESFFGWYYASSSVAVLIAFTVIVYIQDHLGWRIGFGIPAILMLLAGIVFVFASPLYVK  238



>ref|XP_010648805.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Vitis vinifera]
Length=589

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 148/243 (61%), Gaps = 12/243 (5%)
 Frame = +3

Query  72   MEKMGDEQ--------KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLM  227
            ME++G E         K  L   S S  GGFRT+PFI+       +++  L  +MI YLM
Sbjct  1    MEQIGAEDTMGLSSNPKNPLHQPSKSRLGGFRTMPFIIVNEVFERISSLGLMPNMILYLM  60

Query  228  GEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPT  407
              Y+M  V GSN+++ W A+T+ + + GA L+D+ +GRF+VI + S     GM+LLW   
Sbjct  61   RGYNMKAVDGSNVLFIWSAVTHALAIFGAFLSDAYLGRFRVIALGSFSSLTGMILLWFTA  120

Query  408  VIPHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KHIQN  575
            VIP  KP PC    D C+ AT  QL +L +SF L+S+G+G +  C +AFGADQL K   +
Sbjct  121  VIPGMKPQPCEQFKDDCNPATPAQLAVLFSSFGLISIGAGCIRPCSMAFGADQLDKENPD  180

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            +   ++S+F+WYYA  A+  V+ LT +VY+Q++ GW  G+G+  + M F+AL F  GS  
Sbjct  181  SERILDSFFNWYYASSAMSTVISLTIIVYIQDHLGWNFGFGVPAILMFFSALMFLFGSSL  240

Query  756  YVK  764
            YVK
Sbjct  241  YVK  243



>ref|XP_002324234.2| hypothetical protein POPTR_0018s00490g [Populus trichocarpa]
 gb|EEF02799.2| hypothetical protein POPTR_0018s00490g [Populus trichocarpa]
Length=581

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 153/236 (65%), Gaps = 7/236 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ++  G  ++PLL  +S++ KGG R L FI+   A   +    L+ ++I YL  EY +D V
Sbjct  5    LDHKGKIKEPLL--SSSTTKGGLRALIFIIVNEAFERLANYGLSTNLILYLTREYGIDAV  62

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
             G+ ++Y   A T   P  GA LAD+ +GR+ +IG   I   +G++LLWL T+IP A+PP
Sbjct  63   NGAQILYLHSAATSFTPFIGAFLADTYVGRYFMIGFGCIACLLGVILLWLTTIIPGARPP  122

Query  432  PC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMES  596
            PC    DSC SA+T QLLLL +S  L+++G+GG+ S  LAFGA+QL  +     AG +ES
Sbjct  123  PCVQFHDSCESASTLQLLLLYSSLGLMAIGAGGIRSSSLAFGAEQLGKRDTLKRAGILES  182

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +F WYYA  ++   + +TC++Y+Q+N GWK+G+GI VV M+ + L FFL SP YVK
Sbjct  183  FFRWYYATVSVALFLAMTCILYIQDNMGWKVGFGIPVVLMILSTLSFFLASPIYVK  238



>gb|KHM98741.1| Putative peptide transporter [Glycine soja]
Length=603

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 134/225 (60%), Gaps = 7/225 (3%)
 Frame = +3

Query  108  VTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAI  287
            ++     KGG  T+PFI+   AL  + +  L  +MI YLMG Y + +   + ++ + +A 
Sbjct  6    ISQPQKRKGGLVTMPFIIANEALARVASLGLLPNMILYLMGTYRLHLAQATQILLWSHAT  65

Query  288  TYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS----CSS  455
            +   PV GA +ADS +GRF  +G+ S I F+GM LLWL  +IP A+PP CS +    C S
Sbjct  66   SNFTPVVGAFIADSYLGRFLAVGLGSAITFLGMTLLWLTAMIPQARPPTCSSNKAGGCKS  125

Query  456  ATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFAL  629
            AT  Q + +  S + L     G +SC LAFGADQ+  K   NN   +E +FSWYYA  A+
Sbjct  126  ATGGQ-MAILISALALMSVGNGGLSCSLAFGADQVNRKDNPNNRRVLEIFFSWYYASAAI  184

Query  630  CEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              ++ LT +VY+Q++ GWK+GYG+    ML + + F L SP YVK
Sbjct  185  SVIIALTGIVYIQDHLGWKVGYGVPAALMLLSTVSFLLASPLYVK  229



>ref|XP_003530142.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=611

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 133/217 (61%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL  + T  L  +MI YLMG Y++ +   + ++    A T  +P+ 
Sbjct  27   KGGLVTMPFIIANEALARVATLGLLPNMILYLMGNYNLHLGKATKILLLSVATTNFMPLP  86

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA +ADS +GRF  +G+ S I F+GM LLWL  +IP A+PPPC+   + C SAT  Q + 
Sbjct  87   GAFIADSYLGRFLAVGLGSFITFLGMTLLWLTAMIPQARPPPCNSETERCESATPGQ-MA  145

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            +  S + L     G +SC LAFGADQ+  K   NN  A+E +FSWYYA  A+  ++  T 
Sbjct  146  MLISSLALMSIGNGGLSCSLAFGADQVNRKDNPNNQRALEMFFSWYYASSAISVIIAFTG  205

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q++ GWK+G+G+    M  +  FFFL SP YVK
Sbjct  206  IVYIQDHLGWKLGFGVPAALMFLSTFFFFLASPLYVK  242



>gb|AFK45207.1| unknown [Medicago truncatula]
Length=258

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 129/217 (59%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL  M +  L  +MI Y MG Y + +   + ++    A +   PV 
Sbjct  24   KGGLITMPFIIANEALARMASLGLLPNMILYFMGSYRLHLAKATQILLLSSAASNFTPVV  83

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---SCSSATTFQlll  479
            GA +ADS +GRF   G+ S + F+GM +LWL  +IP A+PPPC++    C SATT Q + 
Sbjct  84   GAFIADSYLGRFLGAGLGSFVSFLGMGMLWLTAMIPAARPPPCNNPTKGCKSATTGQ-MA  142

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            +  S   L     G +SC +AFGADQ+  K   NN   +E +FSWYYA   +  ++ LT 
Sbjct  143  MLLSAFGLMSIGNGGLSCSIAFGADQVNRKDNPNNHRVLEIFFSWYYAFTTISIILALTV  202

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+QE+ GWKIG+G+    ML + + FFL SP YVK
Sbjct  203  IVYIQEHLGWKIGFGVPAALMLLSTICFFLASPLYVK  239



>ref|XP_003546477.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=616

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 134/225 (60%), Gaps = 7/225 (3%)
 Frame = +3

Query  108  VTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAI  287
            ++     KGG  T+PFI+   AL  + +  L  +MI YLMG Y + +   + ++ + +A 
Sbjct  19   ISQPQKRKGGLVTMPFIIANEALARVASLGLLPNMILYLMGTYRLHLAQATQILLWSHAT  78

Query  288  TYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS----CSS  455
            +   PV GA +ADS +GRF  +G+ S I F+GM LLWL  +IP A+PP CS +    C S
Sbjct  79   SNFTPVVGAFIADSYLGRFLAVGLGSAITFLGMTLLWLTAMIPQARPPTCSSNKAGGCKS  138

Query  456  ATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFAL  629
            AT  Q + +  S + L     G +SC LAFGADQ+  K   NN   +E +FSWYYA  A+
Sbjct  139  ATGGQ-MAILISALALMSVGNGGLSCSLAFGADQVNRKDNPNNRRVLEIFFSWYYASAAI  197

Query  630  CEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              ++ LT +VY+Q++ GWK+GYG+    ML + + F L SP YVK
Sbjct  198  SVIIALTGIVYIQDHLGWKVGYGVPAALMLLSTVSFLLASPLYVK  242



>ref|XP_006371703.1| hypothetical protein POPTR_0018s00450g [Populus trichocarpa]
 gb|ERP49500.1| hypothetical protein POPTR_0018s00450g [Populus trichocarpa]
Length=584

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 146/229 (64%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC----SD  443
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A+ P C    S+
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGARVPSCAQFSSN  119

Query  444  SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
              + ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CTNDATTPQLLFLYLCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +    + +TC+VY+Q+  GWK+G+G+ VV M+ + L FFL SP YVK
Sbjct  180  TSSASVFISMTCIVYIQDTMGWKVGFGVPVVLMILSTLSFFLASPIYVK  228



>ref|XP_002891678.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67937.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=607

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 140/231 (61%), Gaps = 7/231 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K +        KGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQPNEGKKTKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-  446
            + W A +   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC  + 
Sbjct  69   FMWSAASNFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTA  128

Query  447  ----CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSW  608
                C SAT  QL LL ++F L+S+GSGG+  C LAFGADQL  K    N   +ES+F W
Sbjct  129  AGSHCGSATASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKEKPKNERILESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            YYA  A+  ++  T +VY+QE+ GWKIG+GI  V ML AAL F L SP YV
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWKIGFGIPAVLMLIAALLFILASPLYV  239



>gb|KGN45387.1| hypothetical protein Csa_7G447020 [Cucumis sativus]
Length=623

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 138/223 (62%), Gaps = 6/223 (3%)
 Frame = +3

Query  114  TSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITY  293
            + +S KGG  T+PFI+   +L  + +  L  +MI YLM +Y++    G+N+++FW A   
Sbjct  34   SKSSKKGGLLTMPFIIVNESLEKVGSYGLMPNMILYLMKDYNLGFAKGNNILFFWSAAIN  93

Query  294  IVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS----DSCSSAT  461
             +P+ GA LADS +GRF  IG  SI  F+GM+LLWL  ++P  KPP C     ++C S T
Sbjct  94   FMPLLGAFLADSYLGRFLTIGFGSIATFLGMLLLWLTAMVPSTKPPACDQLHPETCRSPT  153

Query  462  TFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCE  635
              Q+ LL  +  L+S+G+GGV  C LAFGADQ+      NN   +E +F WYYA  +   
Sbjct  154  AAQMALLAVALTLMSIGAGGVRPCTLAFGADQIDRRDNPNNKRMLERFFGWYYASASFSV  213

Query  636  VVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++ LT +VY+Q++ GWK+G+G+    MLFA + FF  S  YVK
Sbjct  214  LIALTGIVYIQDHVGWKVGFGVPAGLMLFATVLFFAASSIYVK  256



>gb|KEH40280.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=568

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 144/234 (62%), Gaps = 8/234 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME    E++PL+  ++A+PKGGFRTLPFI+ T A   M T  +  +MI YL   Y M+  
Sbjct  1    MESAVKEKEPLI--SNANPKGGFRTLPFIIATQAFEKMATFGILPNMILYLTRHYGMEAA  58

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            T +N+I  W A T   P+ GA LADS  GR+  I   S++G +GM+L WL  +IP+    
Sbjct  59   TATNVILRWSAATNFTPIIGAFLADSYFGRYATIAFGSVLGLLGMLLFWLTAMIPNLS--  116

Query  432  PCSD---SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGAMESYF  602
            PC     SC+S TT QL  L +S  L+++G+GGV +  L FG DQL   + +AG +E YF
Sbjct  117  PCDQFTMSCNSPTTSQLAFLYSSLCLIAIGAGGVRASSLPFGIDQLDK-EKDAGIIEGYF  175

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +W YA+     ++G T L Y+QEN GW +G+G+ VVFM  + + FFL S  YVK
Sbjct  176  NWTYALATAAVLIGTTILAYIQENFGWIVGFGLPVVFMFISMVSFFLASSLYVK  229



>ref|XP_010500813.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Camelina sativa]
Length=608

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 138/218 (63%), Gaps = 7/218 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++Y W A +   P+ 
Sbjct  23   KGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVLYMWSAASSFTPLL  82

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS-----CSSATTFQl  473
            GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC  +     C  AT   L
Sbjct  83   GAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTAAGSHCGPATASHL  142

Query  474  lllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGL  647
             LL ++F L+S+GSGG+  C LAFGADQL + +N  N  A+ES+F WYYA  A+  ++  
Sbjct  143  ALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERALESFFGWYYASSAVAVLIAF  202

Query  648  TCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            T +VY+QE+ GWKIG+G+  V ML AAL F L SP YV
Sbjct  203  TGIVYIQEHLGWKIGFGVPAVLMLIAALLFVLASPLYV  240



>ref|XP_009352687.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Pyrus x bretschneideri]
Length=592

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 146/236 (62%), Gaps = 5/236 (2%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M+ +  +Q   +     S KGG RT+PFI+   +   + +  L A+MI YL+ EYH+D  
Sbjct  5    MKVVASDQTKTITKQVTSMKGGLRTMPFIISNESFEKVASFGLQANMIFYLIFEYHLDAA  64

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            TGS++++ W A++   P+ GA LADSL GRF VI + +I+   GM++LWL   +P  +P 
Sbjct  65   TGSSILFLWSALSNFTPIIGAFLADSLWGRFHVISMGTIVSLFGMIVLWLTAKLPQTRPH  124

Query  432  PC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMES  596
             C    + C  A T Q++LL  SF L+S+G+GG+  C LAFG +QL +    NN   ++S
Sbjct  125  HCDPYKEKCVPANTAQVMLLFASFGLMSIGAGGIRPCSLAFGTNQLDNPDNPNNERRLQS  184

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +F+WYYA   +  ++ +T +VY+Q+  GW +G+G+ V  M  + +FFFLGS  YVK
Sbjct  185  FFNWYYASVGVSVMLAVTVIVYIQDQIGWVVGFGVPVGLMFLSTVFFFLGSSLYVK  240



>ref|XP_010668239.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=565

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 146/229 (64%), Gaps = 11/229 (5%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++PLL T+    KGG +TLPFI+   A   + +  L  +MI YLM  Y M++ TGS  IY
Sbjct  3    KEPLLGTS----KGGLKTLPFIIANEAFEKVASYGLLPNMIMYLMASYGMELATGSTFIY  58

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS--  446
            +W A T + PV GA LADS +GRF +IG+ SI   +G +LLWL  +IP A+   C+DS  
Sbjct  59   YWSAATNLAPVIGAFLADSFVGRFWMIGLGSIFSLLGTILLWLTAIIPGAR--SCNDSGS  116

Query  447  -CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
             C S   FQL LL  SF ++S+G+GG+ S  +AFG DQL    N  NAG +E +F+WYY 
Sbjct  117  ECVSPNFFQLTLLALSFGIMSIGAGGIRSSSVAFGTDQLLKRDNFGNAGILERFFNWYYF  176

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +   V  LT +VY+Q+  GWK+G+GI VV ML +A+ FFL SP Y+K
Sbjct  177  AASASVVAALTFVVYIQDKFGWKVGFGIPVVLMLLSAISFFLASPLYIK  225



>ref|XP_002324232.2| hypothetical protein POPTR_0018s00440g [Populus trichocarpa]
 gb|EEF02797.2| hypothetical protein POPTR_0018s00440g [Populus trichocarpa]
Length=573

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 143/228 (63%), Gaps = 10/228 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    ++ KGG RT+PFI+   A   + +  L+ +MI YL  EY MD   G+ L++ 
Sbjct  13   EPLL----SNGKGGIRTIPFILANEAFERLASFGLSTNMIMYLTREYGMDAAQGAQLLFL  68

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDS  446
            + + T   P+ GA+LADS +GR+++IG   +   +GMVLLWL T  P A+ P C   S S
Sbjct  69   FSSATNFTPILGAVLADSYVGRYRMIGFGCMASLLGMVLLWL-TTFPEARQPLCVHFSHS  127

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLK--HIQNNAGAMESYFSWYYAI  620
            C+S +T QL+ L T+F  +++G+GG+ S  LAFGADQL   H    A   ES+F WYY  
Sbjct  128  CNSRSTLQLVHLYTAFGFMAIGAGGIRSSSLAFGADQLSITHNLQRARIRESFFRWYYVT  187

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
                  V +TC+VY+QEN GW +G+G+ VV M+ +AL F L SPFYVK
Sbjct  188  VTASVFVAMTCVVYIQENMGWMVGFGVPVVLMILSALSFSLASPFYVK  235



>ref|XP_011013128.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=584

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 147/229 (64%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDS  446
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A+ P C   S +
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGARVPSCAQFSSN  119

Query  447  CSS-ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
            C++ ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CNNDATTPQLLFLYFCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +    + +TC+VY+QE  GWK+G+G+ VV M  + L FFL SP YVK
Sbjct  180  TSSASVFISMTCVVYIQEAMGWKVGFGVPVVLMFLSTLSFFLASPIYVK  228



>ref|XP_006475659.1| PREDICTED: probable peptide transporter At1g52190-like [Citrus 
sinensis]
Length=585

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 143/221 (65%), Gaps = 5/221 (2%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            + S KGG RT+PFI+   A   +    L A+MI YL+ EYHM    G+N+++ W AI+  
Sbjct  10   TKSKKGGLRTMPFIIANEAFEKVAGVGLHANMIFYLILEYHMSGPEGANVLFLWGAISNF  69

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTF  467
            +P+ GA ++DS +GRF+VI + +    +GM+LLWL  +IP A+PP C+   + C +A   
Sbjct  70   LPIIGASISDSFLGRFRVIALGTFTALLGMILLWLTAIIPAARPPKCNPFIEICPAAKPR  129

Query  468  QllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCEVV  641
            QL  L +SFVL+S+G+GG+  C LAFGADQ  +    NN   ++++F+WYYA   L  + 
Sbjct  130  QLGFLFSSFVLMSIGAGGIRPCSLAFGADQFHNPDNPNNERILQTFFNWYYASVGLSYMA  189

Query  642  GLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +T +VY+Q+ AGW +G+G+ V  MLF+ + F LGS  Y+K
Sbjct  190  SITLIVYIQDKAGWVVGFGVPVGLMLFSTVMFILGSSLYIK  230



>gb|KDO66442.1| hypothetical protein CISIN_1g007910mg [Citrus sinensis]
Length=585

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 143/221 (65%), Gaps = 5/221 (2%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            + S KGG RT+PFI+   A   +    L A+MI YL+ EYHM    G+N+++ W AI+  
Sbjct  10   TKSKKGGLRTMPFIIANEAFEKVAGVGLHANMIFYLILEYHMSGPEGANVLFLWGAISNF  69

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTF  467
            +P+ GA ++DS +GRF+VI + +    +GM+LLWL  +IP A+PP C+   + C +A   
Sbjct  70   LPIIGASISDSFLGRFRVIALGTFTALLGMILLWLTAIIPAARPPKCNPFIEICPAAKPR  129

Query  468  QllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCEVV  641
            QL  L +SFVL+S+G+GG+  C LAFGADQ  +    NN   ++++F+WYYA   L  + 
Sbjct  130  QLGFLFSSFVLMSIGAGGIRPCSLAFGADQFHNPDNPNNERILQTFFNWYYASVGLSYMA  189

Query  642  GLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +T +VY+Q+ AGW +G+G+ V  MLF+ + F LGS  Y+K
Sbjct  190  SITLIVYIQDKAGWVVGFGVPVGLMLFSTVMFLLGSSLYIK  230



>ref|XP_011026621.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=579

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 147/229 (64%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDS  446
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A+ P C   S +
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGARVPSCAQFSTN  119

Query  447  CSS-ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
            C++ ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CNNDATTPQLLFLYFCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +    + +TC+VY+QE  GWK+G+G+ VV M  + L FFL SP YVK
Sbjct  180  TSSASVFISMTCVVYIQEAMGWKVGFGVPVVLMFLSTLSFFLASPIYVK  228



>ref|XP_006451203.1| hypothetical protein CICLE_v10007831mg [Citrus clementina]
 gb|ESR64443.1| hypothetical protein CICLE_v10007831mg [Citrus clementina]
Length=585

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 143/221 (65%), Gaps = 5/221 (2%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            + S KGG RT+PFI+   A   +    L A+MI YL+ EYHM    G+N+++ W AI+  
Sbjct  10   TKSKKGGLRTMPFIIANEAFEKVAGVGLHANMIFYLILEYHMSGPEGANVLFLWGAISNF  69

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTF  467
            +P+ GA ++DS +GRF+VI + +    +GM+LLWL  +IP A+PP C+   + C +A   
Sbjct  70   LPIIGASISDSFLGRFRVIALGTFTALLGMILLWLTAIIPAARPPKCNPFIEICPAAKPR  129

Query  468  QllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCEVV  641
            QL  L +SFVL+S+G+GG+  C LAFGADQ  +    NN   ++++F+WYYA   L  + 
Sbjct  130  QLGFLFSSFVLMSIGAGGIRPCSLAFGADQFHNPDNPNNERILQTFFNWYYASVGLSYMA  189

Query  642  GLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +T +VY+Q+ AGW +G+G+ V  MLF+ L F LGS  Y+K
Sbjct  190  SITLIVYIQDKAGWVVGFGVPVGLMLFSTLMFLLGSSLYIK  230



>ref|XP_002324233.2| hypothetical protein POPTR_0018s00480g, partial [Populus trichocarpa]
 gb|EEF02798.2| hypothetical protein POPTR_0018s00480g, partial [Populus trichocarpa]
Length=552

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 145/229 (63%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCS-  452
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A  P C+   S 
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGATVPSCAQFSSI  119

Query  453  ---SATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
                ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CNNDATTPQLLFLYFCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            I +    + +TC+VY+QE  GWK+G+G+ VV M+ + L FFL SP YVK
Sbjct  180  ISSASVFISMTCVVYIQEAMGWKVGFGVPVVLMILSTLSFFLASPIYVK  228



>ref|XP_011026623.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=579

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 147/229 (64%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDS  446
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A+ P C   S +
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGARVPSCAQFSTN  119

Query  447  CSS-ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
            C++ ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CNNDATTPQLLFLYFCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +    + +TC+VY+QE  GWK+G+G+ VV M  + L FFL SP YVK
Sbjct  180  TSSASVFISMTCVVYIQEAMGWKVGFGVPVVLMFLSTLSFFLASPIYVK  228



>ref|XP_011026620.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Populus 
euphratica]
Length=571

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 148/229 (65%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDS  446
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A+ P C   S +
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGARVPSCAQFSSN  119

Query  447  CSS-ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
            C++ ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CNNDATTPQLLFLYFCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +    + +TC+VY+Q+  GWK+G+G+ VV M+ + L FFL SP YVK
Sbjct  180  TSSASVFISMTCIVYIQDTMGWKVGFGVPVVLMILSTLSFFLASPIYVK  228



>ref|XP_007012104.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY29723.1| Major facilitator superfamily protein [Theobroma cacao]
Length=585

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 148/234 (63%), Gaps = 9/234 (4%)
 Frame = +3

Query  87   DEQK----PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            DE+K    PLL+T S S KGGFRTLPFI+   A   + T  L+ +MI YL  EY M+   
Sbjct  7    DEKKTIREPLLITPSLS-KGGFRTLPFILANEAFERVATLGLSPNMILYLTREYGMETAR  65

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP--  428
             + +I+ W A     P+ GA +ADS +G++++IG+ SI+ F+GMVLLWL  + P A+P  
Sbjct  66   AAKVIFIWTAANNFTPILGAFVADSYVGKYRMIGLGSILSFLGMVLLWLTAMFPQARPYC  125

Query  429  PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
               S  C S T  QLL L  S  L+S+G+GG+ S  L FGADQL    N  NA  ++S+F
Sbjct  126  DQFSSICESPTAPQLLFLYFSLGLMSIGTGGIRSSSLVFGADQLNKGINPENAETLQSFF  185

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            SWYYA  +   ++ +T +VY+Q+N GWK+G+G+ V+ M  +AL F+L S  Y+K
Sbjct  186  SWYYASVSFSALIAVTGIVYIQDNLGWKMGFGVPVMLMFISALSFYLASSLYIK  239



>ref|XP_009787173.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Nicotiana 
sylvestris]
Length=460

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 145/233 (62%), Gaps = 7/233 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASP-KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSN  263
             E++ L+  +  SP KGG +T+PFI+    L  + +  L  +M+ YLM  Y+++ VT ++
Sbjct  5    QEEENLIDYSPKSPTKGGLKTMPFIIVNETLEKVASYGLQPNMVIYLMKGYNLEAVTATS  64

Query  264  LIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS-  440
            ++  W A+++ + + GA ++DS  GRF+V+ I SI    GM +LWL T+IP  +P PC  
Sbjct  65   ILNIWSALSHGLALLGAFVSDSFFGRFRVVAIGSISSLFGMTILWLTTMIPPLRPLPCDQ  124

Query  441  ---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFS  605
               + C+  T  Q  +L  SF +++VG+G V  C +AFGADQL + +N  N   MESYF+
Sbjct  125  FEINECNKPTPAQFFVLLFSFGIIAVGAGFVRPCSIAFGADQLDNKENPKNKRIMESYFN  184

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            WYYA   +  +V  T +VY+Q+  GW+IG+GI  + MLF+   F LGSP Y+K
Sbjct  185  WYYATIGMSTLVATTLIVYIQDAFGWQIGFGIPAILMLFSVSAFLLGSPLYIK  237



>ref|XP_010100643.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB83508.1| putative peptide/nitrate transporter [Morus notabilis]
Length=588

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 152/242 (63%), Gaps = 13/242 (5%)
 Frame = +3

Query  57   ASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEY  236
            AS+EI E    E    +VT     KGG RT+PFI+       + +  L A+M+ YL+ +Y
Sbjct  3    ASSEIEETTQQE----VVTKK---KGGLRTIPFIIANETFEKVASYGLLANMMVYLIEQY  55

Query  237  HMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP  416
            H+  +TG+++++ W A+T + P+ GA L+DS +GRF+VI I ++I   GM++L L  +IP
Sbjct  56   HVSNITGASILFLWVALTNLTPIIGAFLSDSFLGRFRVIVIGTLISLTGMIVLLLTAIIP  115

Query  417  HAKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NN  578
             A+PP C       C S+   Q LLL  SF L+S+G+GG+  C +AFGADQ+   +  NN
Sbjct  116  DARPPECDIKARQKCVSSELNQRLLLYFSFALMSIGAGGIRPCSMAFGADQVNRPENPNN  175

Query  579  AGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFY  758
               ++ +F+WYYA   +  ++ +T +VYLQ+N GW  G+G+ +  MLF+ + FFLGS FY
Sbjct  176  ERVLQIFFNWYYASVGISLMIAVTVIVYLQDNVGWVPGFGVPLGLMLFSTVMFFLGSSFY  235

Query  759  VK  764
            +K
Sbjct  236  IK  237



>ref|XP_003597726.1| hypothetical protein MTR_2g101610 [Medicago truncatula]
 gb|ABD32296.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67977.1| nitrate transporter 1 [Medicago truncatula]
Length=638

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 138/235 (59%), Gaps = 12/235 (5%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            E+M  +QKP         KGG  T+PFI+G  AL  M +  L  +MI YLMG Y + +  
Sbjct  16   EEMVSQQKP------QRSKGGLVTMPFIIGNEALAKMASVGLLPNMILYLMGSYRLHLGI  69

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
             + ++    A +   PV GA +ADS +GRF  +GI S I F+GM LLWL  +IP A+P  
Sbjct  70   STQILLLSSAASNFTPVIGAFIADSYLGRFLGVGIGSSISFLGMSLLWLTAMIPAARPSA  129

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESY  599
            C   S+ C SAT  Q L +  S ++L     G ++C LAFGADQ+  K   NN   +E +
Sbjct  130  CNHPSEGCESATPGQ-LAMLFSALILIAIGNGGITCSLAFGADQVNRKDNPNNYRVLEIF  188

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            FSWYYA   +  ++ LT +VY+Q++ GW+IG+G+    ML + + FFL SP YVK
Sbjct  189  FSWYYAFITIAVIIALTGIVYIQDHLGWRIGFGVPAALMLISTVLFFLASPLYVK  243



>gb|KJB27307.1| hypothetical protein B456_004G290100 [Gossypium raimondii]
Length=583

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 150/239 (63%), Gaps = 10/239 (4%)
 Frame = +3

Query  72   MEKMGDE----QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME   DE    ++P L  +S+  KGGFRTLPFI+ T A   + T  L+ +MI YL  E+ 
Sbjct  1    METPSDENNKIREPFL--SSSPSKGGFRTLPFILATEAFERVATIGLSPNMIVYLRREFG  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            M+    +N+I+FW A T   P+ GA +ADS MG++++IG  S++ F+GM+LLW   +IP 
Sbjct  59   METAKAANVIFFWSAATNFTPIIGAFIADSYMGKYRMIGFGSVLCFLGMILLWSTAIIPQ  118

Query  420  AKP--PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGA  587
            A+P     +  C + TT QLLLL  S  L+S+G+GG+ S  +AFGADQL    N  N   
Sbjct  119  ARPYCDQFNTICEAPTTPQLLLLYCSLGLISIGAGGIRSSCMAFGADQLDKRNNPENTKT  178

Query  588  MESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++S+F WYYA      ++ +T +VY+Q+  GW +G+GI V+ M  +A+ FFL S FY+K
Sbjct  179  LQSFFGWYYATITFSALIAVTLIVYVQDTLGWGMGFGIPVMLMFGSAVSFFLASSFYIK  237



>ref|XP_006371704.1| hypothetical protein POPTR_0018s00460g [Populus trichocarpa]
 gb|ERP49501.1| hypothetical protein POPTR_0018s00460g [Populus trichocarpa]
Length=583

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 145/229 (63%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCS-  452
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A  P C+   S 
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGATVPSCAKFSSI  119

Query  453  ---SATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
                ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CNNDATTPQLLFLYFCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            I +    + +TC+VY+QE  GWK+G+G+ VV M+ + L FFL SP YVK
Sbjct  180  ISSASVFISMTCVVYIQEAMGWKVGFGVPVVLMILSTLSFFLASPIYVK  228



>ref|XP_010049663.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
 gb|KCW82404.1| hypothetical protein EUGRSUZ_C03809 [Eucalyptus grandis]
Length=586

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 145/238 (61%), Gaps = 10/238 (4%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            EI     DE K +      S KGG +T+PFI+    L  +    L  +MI YL+G+YH +
Sbjct  2    EIASDKADEAKQV-----TSKKGGLKTMPFIIANEILEKVAGYGLLPNMIFYLIGKYHFN  56

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
              +G+N+++ W A +   PV GA ++DS +GRF+ IG  S+I  +GM+LLWL  ++  A+
Sbjct  57   AASGANVLFLWSATSNFTPVLGAFISDSFLGRFRTIGFTSVISLLGMILLWLTALLRDAR  116

Query  426  PPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAM  590
            PPPC   S  C   T+ QLL L +SF ++S+G+GG+ SC +AFGADQ+ +  N  N   +
Sbjct  117  PPPCDPRSKPCEFPTSAQLLFLYSSFSIMSIGAGGIRSCSIAFGADQIDNPDNPRNGRIL  176

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             ++F+WYYA   +  ++ +T +V +Q + GW IG+G+    M  + + FFLGS  YVK
Sbjct  177  RTFFNWYYASVGVSIMIAVTVIVVIQNSYGWVIGFGVPAGLMYISVVSFFLGSSLYVK  234



>ref|XP_010050380.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
Length=582

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 131/196 (67%), Gaps = 7/196 (4%)
 Frame = +3

Query  198  LAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGF  377
            L  +M+ YL  EYH++ V  +N+++ W A T  +P+ GA LADS  GR+ +IG  SI   
Sbjct  42   LLPNMVLYLTREYHLENVAAANVLFLWSATTNFLPIIGAFLADSYFGRYAMIGFGSIASL  101

Query  378  VGMVLLWLPTVIPHAKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAF  545
            +GM+LLWL TV P A+PP C     D+C SATT QLLLL +SF L+S+G+GGV S  LAF
Sbjct  102  LGMILLWLTTVFPEARPPSCDEFSKDTCGSATTAQLLLLYSSFGLMSIGAGGVRSSALAF  161

Query  546  GADQLK---HIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfm  716
            GADQ+K   + +N+   ++ YFSWYY       +V +TC+VY+QE AGWK+G+G+ VV M
Sbjct  162  GADQIKTGANSKNSGNLLQKYFSWYYVSVMASAMVAMTCVVYIQETAGWKVGFGVPVVLM  221

Query  717  lfaalffflGSPFYVK  764
              +   FFL SPFY K
Sbjct  222  FISTFSFFLASPFYFK  237



>ref|XP_011026624.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=576

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 147/229 (64%), Gaps = 10/229 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    +SPKGG R L FI+   AL  + +  L+ +MI YL  EY MD  +G+ +++ 
Sbjct  4    EPLL----SSPKGGIRALFFIIANEALERLASFGLSTNMILYLTREYGMDAASGAQILFL  59

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDS  446
            + A    +P+ GA LAD+ +GR+ +IG   I   +GMVLLWL T+IP A+ P C   S  
Sbjct  60   YSAAGNFMPIIGAFLADTYVGRYPMIGFGCIASLLGMVLLWLTTIIPGARVPSCPQFSSG  119

Query  447  CSS-ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
            C++ ATT QLL L     L+S+G+GG+ SC LAFGADQL    +  +AG +ES+FSWYY 
Sbjct  120  CNNDATTPQLLFLYFCLGLMSIGAGGIRSCSLAFGADQLSKRDSLKHAGILESFFSWYYV  179

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              +    + +TC+VY+Q+  GWK+G+G+ VV M+ + L FFL SP YVK
Sbjct  180  TSSASVFISMTCIVYIQDTMGWKVGFGVPVVLMILSTLSFFLASPIYVK  228



>gb|KCW79098.1| hypothetical protein EUGRSUZ_C00542 [Eucalyptus grandis]
Length=537

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 129/192 (67%), Gaps = 7/192 (4%)
 Frame = +3

Query  210  MIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMV  389
            M+ YL  EYH++ V  +N+++ W A T  +P+ GA LADS  GR+ +IG  SI   +GM+
Sbjct  1    MVLYLTREYHLENVAAANVLFLWSATTNFLPIIGAFLADSYFGRYAMIGFGSIASLLGMI  60

Query  390  LLWLPTVIPHAKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQ  557
            LLWL TV P A+PP C     D+C SATT QLLLL +SF L+S+G+GGV S  LAFGADQ
Sbjct  61   LLWLTTVFPEARPPSCDEFSKDTCGSATTAQLLLLYSSFGLMSIGAGGVRSSALAFGADQ  120

Query  558  LK---HIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaa  728
            +K   + +N+   ++ YFSWYY       +V +TC+VY+QE AGWK+G+G+ VV M  + 
Sbjct  121  IKTGANSKNSGNLLQKYFSWYYVSVMASAMVAMTCVVYIQETAGWKVGFGVPVVLMFIST  180

Query  729  lffflGSPFYVK  764
              FFL SPFY K
Sbjct  181  FSFFLASPFYFK  192



>ref|XP_003597725.1| hypothetical protein MTR_2g101590 [Medicago truncatula]
 gb|ABD32298.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67976.1| nitrate transporter 1 [Medicago truncatula]
Length=637

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 137/230 (60%), Gaps = 6/230 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
             ++ ++       KGG  T+PFI+G  AL  M +  L  +MI YLMG Y + +   + ++
Sbjct  14   NEEEMVSQQPQRRKGGLITMPFIIGNEALARMASLGLLPNMILYLMGSYRLHLGISTQIL  73

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---S  440
                A +   PV GA +ADS +GRF  +GI S I F+GM LLWL  +IP A+PP C   S
Sbjct  74   LLSSAASNFTPVIGAFIADSFLGRFLGVGIGSSISFLGMSLLWLTAMIPSARPPACNHPS  133

Query  441  DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYY  614
            + C SAT  Q L +  S ++L     G +SC LAFGADQ+  K   NN   +E +FSWYY
Sbjct  134  EGCESATPGQ-LAMLFSALILIAIGNGGISCSLAFGADQVNRKDNPNNRRVLEIFFSWYY  192

Query  615  AIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            A   +  ++ LT +VY+Q++ GWK+G+G+  + ML + + FFL SP YVK
Sbjct  193  AFTTIAVIIALTGIVYIQDHLGWKVGFGVPAILMLISTVLFFLASPLYVK  242



>ref|XP_010479721.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X3 [Camelina 
sativa]
Length=607

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 140/231 (61%), Gaps = 7/231 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K +        KGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQPNGGKRTKGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---  440
            Y W A +   P+ GA L+DS +GRF  I IAS+  F+GM+LLWL  ++P  KP PC    
Sbjct  69   YMWSAASSFTPLLGAFLSDSYLGRFLTISIASLSSFLGMMLLWLTAMLPQVKPSPCDPTA  128

Query  441  --DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
               +C  AT   L LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGSNCGPATASHLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            YYA  A+  ++  T +VY+QE+ GWKIG+G+  V ML AAL F L SP YV
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPAVLMLIAALLFVLASPLYV  239



>emb|CBI20867.3| unnamed protein product [Vitis vinifera]
Length=1181

 Score =   159 bits (401),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 148/243 (61%), Gaps = 12/243 (5%)
 Frame = +3

Query  72   MEKMGDEQ--------KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLM  227
            ME++G E         K  L   S S  GGFRT+PFI+       +++  L  +MI YLM
Sbjct  1    MEQIGAEDTMGLSSNPKNPLHQPSKSRLGGFRTMPFIIVNEVFERISSLGLMPNMILYLM  60

Query  228  GEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPT  407
              Y+M  V GSN+++ W A+T+ + + GA L+D+ +GRF+VI + S     GM+LLW   
Sbjct  61   RGYNMKAVDGSNVLFIWSAVTHALAIFGAFLSDAYLGRFRVIALGSFSSLTGMILLWFTA  120

Query  408  VIPHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KHIQN  575
            VIP  KP PC    D C+ AT  QL +L +SF L+S+G+G +  C +AFGADQL K   +
Sbjct  121  VIPGMKPQPCEQFKDDCNPATPAQLAVLFSSFGLISIGAGCIRPCSMAFGADQLDKENPD  180

Query  576  NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPF  755
            +   ++S+F+WYYA  A+  V+ LT +VY+Q++ GW  G+G+  + M F+AL F  GS  
Sbjct  181  SERILDSFFNWYYASSAMSTVISLTIIVYIQDHLGWNFGFGVPAILMFFSALMFLFGSSL  240

Query  756  YVK  764
            YVK
Sbjct  241  YVK  243


 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 142/216 (66%), Gaps = 5/216 (2%)
 Frame = +3

Query  132  GGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTG  311
            GGFRT+PFI+   +L  +    +  +MI YLM  YHM+  TGS +++ W A +  + V G
Sbjct  618  GGFRTMPFIIVNQSLEKVAGFGIMPNMIFYLMNGYHMEAATGSTILFTWSAFSKSLAVFG  677

Query  312  AILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSATTFQllll  482
            A+L+D  +GRF+VI   S    +G+ LLWL  +IP  KPPPC   +D+C+SAT  QL +L
Sbjct  678  ALLSDFYLGRFRVIAFGSFSSLLGITLLWLTAMIPWLKPPPCDQLNDNCNSATPAQLAVL  737

Query  483  ctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTCL  656
             TS  L+SVG+G +  C +AFGADQL + +N  N   ++S+F+WYYA   +  V+ LT +
Sbjct  738  FTSLGLISVGAGCIRPCSIAFGADQLDNKENPDNDTVLQSFFNWYYASIGVSTVIALTFI  797

Query  657  VYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             Y+Q++ GWK G+G+ V+ M+F+AL F LGS  Y++
Sbjct  798  AYIQDHLGWKFGFGVPVILMVFSALMFVLGSSLYIR  833



>ref|XP_003531667.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
 gb|KHN47834.1| Putative peptide transporter [Glycine soja]
Length=587

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 138/234 (59%), Gaps = 9/234 (4%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTG  257
            KMG +   L+       KGG  T+PFI+   AL  + T  L  +MI YLMG Y++ +   
Sbjct  13   KMGSQ---LISQPQRCGKGGLVTMPFIIANEALARVATLGLLPNMILYLMGNYNLHLGKA  69

Query  258  SNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC  437
            + ++    A T  +P+ GA ++DS +GRF  +G+ S I F+GM LLWL  +IP A+PP C
Sbjct  70   TKILLLSVATTNFMPLPGAFISDSYLGRFLAVGLGSFITFLGMALLWLTAMIPQARPPAC  129

Query  438  ---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYF  602
               S+ C SAT  Q + +  S + L     G +SC LAFGADQ+  K   NN  A+E +F
Sbjct  130  NSQSERCESATPGQ-MAMLISSLALMSIGNGGLSCSLAFGADQVNRKGNPNNQRALEMFF  188

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            SWYYA  A+  ++  T +VY+Q++ GWK+G+G+    M  +  FFFL SP YVK
Sbjct  189  SWYYASSAISVIIAFTGIVYIQDHLGWKLGFGVPAALMFLSTFFFFLASPLYVK  242



>ref|XP_010462057.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Camelina sativa]
Length=607

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 139/231 (60%), Gaps = 7/231 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K +        KGG  T+PFI+       + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQPNGGKRTKGGIITMPFIIANEGFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---  440
            Y W A +   P+ GA L+DS +GRF  I IAS+  F+GMVLLWL  ++P  KP PC    
Sbjct  69   YMWSAASSFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTA  128

Query  441  --DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
               +C  AT   L LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGSNCGPATASHLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            YYA  A+  ++  T +VY+QE+ GWKIG+G+  V ML AAL F L SP YV
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPAVLMLIAALLFVLASPLYV  239



>ref|XP_009787172.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Nicotiana 
sylvestris]
Length=570

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 145/233 (62%), Gaps = 7/233 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASP-KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSN  263
             E++ L+  +  SP KGG +T+PFI+    L  + +  L  +M+ YLM  Y+++ VT ++
Sbjct  5    QEEENLIDYSPKSPTKGGLKTMPFIIVNETLEKVASYGLQPNMVIYLMKGYNLEAVTATS  64

Query  264  LIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS-  440
            ++  W A+++ + + GA ++DS  GRF+V+ I SI    GM +LWL T+IP  +P PC  
Sbjct  65   ILNIWSALSHGLALLGAFVSDSFFGRFRVVAIGSISSLFGMTILWLTTMIPPLRPLPCDQ  124

Query  441  ---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFS  605
               + C+  T  Q  +L  SF +++VG+G V  C +AFGADQL + +N  N   MESYF+
Sbjct  125  FEINECNKPTPAQFFVLLFSFGIIAVGAGFVRPCSIAFGADQLDNKENPKNKRIMESYFN  184

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            WYYA   +  +V  T +VY+Q+  GW+IG+GI  + MLF+   F LGSP Y+K
Sbjct  185  WYYATIGMSTLVATTLIVYIQDAFGWQIGFGIPAILMLFSVSAFLLGSPLYIK  237



>ref|XP_003597722.1| hypothetical protein MTR_2g101560 [Medicago truncatula]
 gb|ABD32300.1| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67973.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=637

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 139/235 (59%), Gaps = 12/235 (5%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            E+M  +QKP         KGG  T+PFI+   AL  M ++ L  +MI YLMG Y++ + T
Sbjct  16   EEMVSQQKP------ERSKGGLVTMPFIIANEALARMASTGLGPNMILYLMGSYNLHLAT  69

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
             + ++    A     P+  A +ADS +GRF  +GI SII F+GM +LWL  ++P A+PP 
Sbjct  70   ATQILLISSAAGNFTPLVAAFIADSYIGRFLGVGIGSIISFLGMAMLWLTAMVPAAQPPA  129

Query  435  CS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESY  599
            CS   + C SA   Q + +  S ++L     G +SC LAFGADQ+K  +  NN  A+E +
Sbjct  130  CSNPPEGCISAKPGQ-MAMLLSALILIGIGNGGISCSLAFGADQVKRKENSNNNRALEIF  188

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   +  +  L  +VY+Q++ GW+IG+G+    ML + + FFL SP YVK
Sbjct  189  FTWYYASTTIAVIAALFGIVYIQDHLGWRIGFGVPAALMLISTVLFFLASPLYVK  243



>ref|XP_009416500.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Musa acuminata 
subsp. malaccensis]
Length=609

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 144/233 (62%), Gaps = 9/233 (4%)
 Frame = +3

Query  81   MGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGS  260
            + +E+ P+ +      KGG +TLP I+    L  + +  L A+MI YL   Y+M    G+
Sbjct  5    VAEEEAPMPLKG----KGGLKTLPCIMANEILEKVASFGLHANMIVYLTKTYNMSPAAGA  60

Query  261  NLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC-  437
             +++ W A +   P+ GA L+DS +GRF+VI I S +  +GM LLWL  V+P A+PP C 
Sbjct  61   IVLFIWGAASNFTPIFGAFLSDSFLGRFRVIAIGSFVSLIGMALLWLTAVVPGAQPPACG  120

Query  438  --SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFS  605
              +D C+S T+ QL  L  +F ++SVGSGGV  C LAFGADQL  K    N   ++++F+
Sbjct  121  HANDDCASPTSSQLAFLFAAFAVMSVGSGGVRPCSLAFGADQLDQKGAPQNERTLQTFFN  180

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            WYYA   +  +V +T +VY+Q+  GW +G+G+ VV M  +A  F LGSPFY+K
Sbjct  181  WYYASVGISIIVAVTVIVYVQDYKGWAVGFGVPVVLMAISAALFLLGSPFYIK  233



>gb|KDP33700.1| hypothetical protein JCGZ_07271 [Jatropha curcas]
Length=596

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 143/240 (60%), Gaps = 8/240 (3%)
 Frame = +3

Query  69   IMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            +ME   DE+K          KGG RTLPFI+       + +  L A+MI YL  +Y++  
Sbjct  3    VMEMDKDEKKTTQEVKLKRKKGGLRTLPFIISNETFERVASVGLQANMISYLQNDYNLTS  62

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
             TG+ +++ W AI++  P+ GA  +DS +GRF+VI + +I+  +GM+LLWL  +IP A+P
Sbjct  63   ATGATVLFLWGAISHFTPIFGAFFSDSYLGRFRVILLGTIVSLIGMILLWLTAIIPSARP  122

Query  429  PPCSDS------CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
            P C         C+S    Q++ L ++F ++++G+GGV  C LAFGADQ    +N  N  
Sbjct  123  PHCDQKHGNLQGCASPNAAQMVFLLSAFAIMAIGAGGVRPCSLAFGADQFDKPENPKNEK  182

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             ++S+F+WYYA      ++ +  +V +Q+ AGW +G+GI V FM  + + F +GS  ++K
Sbjct  183  TLQSFFNWYYASVGFSVMLSVVFIVAIQDAAGWIVGFGIPVGFMFLSTVLFIMGSSRFIK  242



>ref|XP_011026626.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
 ref|XP_011026627.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
 ref|XP_011026628.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=573

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 145/236 (61%), Gaps = 6/236 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M+   D+++ +     ++ KGG RT+PFI+   A   + +  L+ +MI YL  EY MD  
Sbjct  1    MDCSSDQRQMITEPLLSNRKGGIRTIPFILANEAFERLASFGLSTNMIMYLTKEYGMDAA  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
             G+ +++ + + T   P+ GA+LADS +GR+++IG   +   +GMVLLWL T  P A+ P
Sbjct  61   QGAQVLFLFSSATNFTPILGAVLADSYVGRYRMIGFGCVASLLGMVLLWL-TTFPEARQP  119

Query  432  PC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMES  596
             C   S SC+S +T QL+ L T+F  +++G+GG+ S  LAFGADQL    +   A   ES
Sbjct  120  LCVHLSHSCNSRSTLQLVHLYTAFGFMAIGAGGIRSSSLAFGADQLSITNSLQRARIRES  179

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +F WYY        V +TC+VY+QEN GW +G+G+ V+ M+ + L F L SPFYVK
Sbjct  180  FFRWYYVTVTASVFVAMTCVVYIQENMGWMVGFGVPVMLMILSGLSFSLASPFYVK  235



>ref|XP_010479719.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Camelina 
sativa]
Length=608

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 137/218 (63%), Gaps = 7/218 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   A   + +  L  +MI YL+ +Y   +  G+N++Y W A +   P+ 
Sbjct  23   KGGIITMPFIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVLYMWSAASSFTPLL  82

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS-----DSCSSATTFQl  473
            GA L+DS +GRF  I IAS+  F+GM+LLWL  ++P  KP PC       +C  AT   L
Sbjct  83   GAFLSDSYLGRFLTISIASLSSFLGMMLLWLTAMLPQVKPSPCDPTAAGSNCGPATASHL  142

Query  474  lllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGL  647
             LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F WYYA  A+  ++  
Sbjct  143  ALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGWYYASSAVAVLIAF  202

Query  648  TCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            T +VY+QE+ GWKIG+G+  V ML AAL F L SP YV
Sbjct  203  TGIVYIQEHLGWKIGFGVPAVLMLIAALLFVLASPLYV  240



>ref|XP_006465636.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Citrus sinensis]
Length=558

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = +3

Query  210  MIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMV  389
            MI YLM +YH+ +  G+N+++FW A T  +P+ GA L+DS +GRF  IG+AS    +GM 
Sbjct  1    MILYLMKDYHLGVAKGTNVLFFWTAATNFMPILGAFLSDSYLGRFLTIGLASFCSLLGMF  60

Query  390  LLWLPTVIPHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL  560
            LLWL  +IP  KP PC+    SC S TT Q+ LL +SF  +S+G+GG+  C +AFGADQL
Sbjct  61   LLWLTAMIPKVKPSPCNILTQSCESPTTAQMTLLISSFCFISIGAGGIRPCSIAFGADQL  120

Query  561  --KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalf  734
              K   NN   +ES+F WYYA  A+  V+ LT +VY+Q++ GWK+G+G+  + M+ + L 
Sbjct  121  DRKDNPNNERVLESFFGWYYATSAIAVVIALTAIVYIQDHLGWKVGFGVPAILMVLSLLL  180

Query  735  fflGSPFYVK  764
            FF+ SP YVK
Sbjct  181  FFIASPLYVK  190



>ref|XP_009621369.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=570

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 145/237 (61%), Gaps = 6/237 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M  + +E++ +  +  +  KGG +T+ FI+    L  + +  L  +MI YLM  Y++++V
Sbjct  1    MAIIQEEERLIDHSPKSQTKGGLKTMSFIIVNETLERVASYGLQPNMIIYLMQGYNLEVV  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            T ++++  W A+++ + + GA ++DS  GRF+V+ I SI    GM +LWL T+IP  +P 
Sbjct  61   TATSILNIWSALSHGLALLGAFVSDSFFGRFRVVAIGSISSLFGMAILWLTTIIPQLRPL  120

Query  432  PCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAME  593
            PC     + C+  T  Q  +L  S  +++VG+G V  C +AFGADQL  K   NN   ME
Sbjct  121  PCDQFEINECNRPTPAQFFVLLFSLGIIAVGAGFVRPCSIAFGADQLDNKENTNNNRIME  180

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            SYF+WYYA   +  +V  T +VY+Q+  GW++G+GI V+ MLF+   F LGSP Y+K
Sbjct  181  SYFNWYYATIGMSTLVATTLIVYIQDAFGWQVGFGIPVILMLFSVSAFLLGSPLYIK  237



>ref|XP_003597728.1| hypothetical protein MTR_2g101640 [Medicago truncatula]
 gb|ABD32293.2| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67979.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=632

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 130/217 (60%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL  M +  L  +MI Y MG Y + +   + ++    A +   PV 
Sbjct  24   KGGLITMPFIIANEALARMASLGLLPNMILYFMGSYRLHLAKATQILLLSSAASNFTPVV  83

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---SCSSATTFQlll  479
            GA +ADS +GRF  +G+ S + F+GM +LWL  +IP A+PPPC++    C SATT Q + 
Sbjct  84   GAFIADSYLGRFLGVGLGSFVSFLGMGMLWLTAMIPAARPPPCNNPTKGCKSATTGQ-MA  142

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            +  S   L     G +SC +AFGADQ+  K   NN   +E +FSWYYA   +  ++ LT 
Sbjct  143  MLLSAFGLMSIGNGGLSCSIAFGADQVNRKDNPNNHRVLEIFFSWYYAFTTISIILALTV  202

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+QE+ GWKIG+G+    ML + + FFL SP YVK
Sbjct  203  IVYIQEHLGWKIGFGVPAALMLLSTICFFLASPLYVK  239



>ref|XP_007204860.1| hypothetical protein PRUPE_ppa023390mg [Prunus persica]
 gb|EMJ06059.1| hypothetical protein PRUPE_ppa023390mg [Prunus persica]
Length=588

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME   ++ KP  + TS   KGG RT+P I+   AL  + +  L A+MI YL  EYHM+  
Sbjct  1    MELSSEQSKPAQLVTSK--KGGLRTMPCIISNEALEKVASYGLHANMILYLTSEYHMENA  58

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            TG+++++ W A++   P+ GA L+DS +GRF+VI + +++  +G +LLWL  V P A+P 
Sbjct  59   TGASILFLWSAMSSFTPIIGAFLSDSYLGRFRVITLGTVVSLLGEILLWLTAVFPQARPV  118

Query  432  PCSD----SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAME  593
             C D     C SA T Q++LL  SF L+S+GSGG+  C LAFGADQL    +  N   ++
Sbjct  119  HCDDPSKEKCISANTGQVMLLFASFGLMSIGSGGIKPCSLAFGADQLDKPDSPKNERVLQ  178

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGI  701
            S+F+WYYA   +  +  +T +VY+Q   GW +G+G+
Sbjct  179  SFFNWYYASVGVSVMFAVTVIVYVQVQFGWVVGFGV  214



>ref|XP_010479720.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X2 [Camelina 
sativa]
Length=607

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 139/231 (60%), Gaps = 7/231 (3%)
 Frame = +3

Query  90   EQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLI  269
            E K +        KGG  T+PFI+       + +  L  +MI YL+ +Y   +  G+N++
Sbjct  9    EAKQIQPNGGKRTKGGIITMPFIIANEGFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVL  68

Query  270  YFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---  440
            Y W A +   P+ GA L+DS +GRF  I IAS+  F+GM+LLWL  ++P  KP PC    
Sbjct  69   YMWSAASSFTPLLGAFLSDSYLGRFLTISIASLSSFLGMMLLWLTAMLPQVKPSPCDPTA  128

Query  441  --DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
               +C  AT   L LL ++F L+S+GSGG+  C LAFGADQL + +N  N   +ES+F W
Sbjct  129  AGSNCGPATASHLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGW  188

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            YYA  A+  ++  T +VY+QE+ GWKIG+G+  V ML AAL F L SP YV
Sbjct  189  YYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPAVLMLIAALLFVLASPLYV  239



>ref|XP_004301550.2| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Fragaria vesca 
subsp. vesca]
Length=593

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 135/216 (63%), Gaps = 6/216 (3%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M ++  E+       +    GG RT+PFI+       + +  L A+MI YLM EY+M++ 
Sbjct  1    MMEVSSEKAKTTEEVAGRKLGGLRTMPFIISNETFEKVASFGLQANMILYLMHEYNMELA  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            +G+ +++ W A T   P+ GA LADS  GRF+VI + S++  +GMVLLWL  + P A+PP
Sbjct  61   SGTCILFLWSAATNFTPIMGAFLADSHFGRFRVIALGSVVSLLGMVLLWLTAIFPQARPP  120

Query  432  PCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAME  593
             C     + C   +  QL+LL ++F L+S+GSGG+  C LAFGADQL   +N  +A  + 
Sbjct  121  HCDAKSGEKCVPPSYAQLMLLFSAFGLMSIGSGGIKPCSLAFGADQLYKPENPKSAKILR  180

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGI  701
            S+F+WYYA   +  +V +T +VY+Q++AGW +G+G+
Sbjct  181  SFFNWYYASVGISVMVAVTVIVYIQDSAGWIVGFGV  216



>ref|XP_007135664.1| hypothetical protein PHAVU_010G147900g [Phaseolus vulgaris]
 gb|ESW07658.1| hypothetical protein PHAVU_010G147900g [Phaseolus vulgaris]
Length=616

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 132/217 (61%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL  + T  L  +MI YLMG Y++ +   + ++    A T  +P+ 
Sbjct  26   KGGLVTMPFIIANEALARVATLGLLPNMILYLMGNYNLHLGKATQILLLSVATTNFMPLP  85

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA +ADS +GRF  +G+ S I F+GM LLWL  +IP A+PP C+   + C SA TF  + 
Sbjct  86   GAFIADSYLGRFLSVGLGSFITFLGMALLWLTAMIPEAQPPHCNSETEKCVSA-TFGQMA  144

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            +  S + L     G +SC LAFGADQ+  K   NN  A+E +FSWYYA  A+  ++  T 
Sbjct  145  MLISSLALMSIGNGGLSCSLAFGADQVNRKDNPNNQRALEIFFSWYYASSAISVIIAFTG  204

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q++ GWK+G+G+    M  + + FFL SP YVK
Sbjct  205  IVYIQDHLGWKLGFGVPAALMFLSTVLFFLASPLYVK  241



>ref|XP_009609879.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like, partial [Nicotiana 
tomentosiformis]
Length=318

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 143/236 (61%), Gaps = 13/236 (6%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            MEK G        + S   KGG +T+PF++   AL  + +  L A+MI YL  EYH+   
Sbjct  1    MEKKG--------SYSDDKKGGLKTMPFVIANEALDKVASVGLHANMILYLKNEYHLTNA  52

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            TG++++++W A++   P+ GA L+DS +GR+ VI + ++I  +GMV LWL  ++  A+P 
Sbjct  53   TGASILFWWNALSNFTPIFGAFLSDSYLGRYYVIALGTLISLIGMVALWLTAILKEARPH  112

Query  432  PC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMES  596
            PC   S++C +    Q   L +SF L+++G+GG+  C LAFGADQ  + +  NN   ++S
Sbjct  113  PCKLESENCQNPDFGQFAFLFSSFALMAIGAGGIRPCSLAFGADQFDNPENPNNGRILQS  172

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +F+WYYA   +  ++ +T +VY+Q   GW +G+G+    M  A + F LGS  +++
Sbjct  173  FFNWYYASVGISILISVTVIVYIQTKFGWVVGFGVPAGLMFLATIMFLLGSALFIR  228



>ref|XP_008242634.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Prunus mume]
Length=588

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME   ++ KP  + TS   KGG RT+P I+   AL  + +  L A+MI YL  EYHM+  
Sbjct  1    MELSSEQSKPAQLVTSK--KGGLRTMPCIISNEALEKVASYGLQANMILYLTSEYHMENA  58

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            TG+++++ W A++   P+ GA L+DS +GRF+VI +  ++  +G +LLWL  V P A+P 
Sbjct  59   TGASILFLWSAMSSFTPIIGAFLSDSHLGRFRVITLGIVVSLLGEILLWLTAVFPQARPV  118

Query  432  PCSD----SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAME  593
             C D     C SA T Q++LL  SFVL+S+GSGG+  C LAFGADQL    +  N   ++
Sbjct  119  HCDDPSKEKCVSANTGQVMLLFASFVLMSIGSGGIKPCSLAFGADQLDKPDSPKNERVLQ  178

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGI  701
            S+F+WYYA   +  +  +T +VY+Q   GW +G+G+
Sbjct  179  SFFNWYYASVGVSVMFAVTVIVYVQVKFGWVVGFGV  214



>ref|XP_004498697.1| PREDICTED: probable peptide transporter At1g52190-like, partial 
[Cicer arietinum]
Length=520

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 139/217 (64%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KG  RT+PFI+   +L  + +  +  +MI YL  +Y+M +   +N++Y W A++ I+ + 
Sbjct  24   KGALRTMPFIIVNESLEKVASYGIMPNMILYLRDDYNMAIAKATNVLYTWSAMSNILSIF  83

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA L+DS +GRF VI I S+   +G+ +LWL T+IP  K P CS     C+SAT+ QL L
Sbjct  84   GAFLSDSYLGRFSVIIIGSLSSLLGLTILWLTTMIPMLK-PSCSSLIQVCNSATSSQLAL  142

Query  480  lctsfvllsvgsggvvsCMLAFGADQ--LKHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            L  S  L+S+G+G V  C +AFGADQ  +K   N+   ++SYF+WYY       ++ L+ 
Sbjct  143  LFISLGLISIGAGCVRPCSIAFGADQFAIKENSNDGRILDSYFNWYYTSIGASTIIALSV  202

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+QEN GWKIG+G+  V ML +A  F LGSP+YVK
Sbjct  203  IVYIQENLGWKIGFGVPAVLMLISAFSFILGSPYYVK  239



>dbj|BAG91471.1| unnamed protein product [Oryza sativa Japonica Group]
Length=591

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 142/238 (60%), Gaps = 11/238 (5%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME    E+     TTS   KGG RT+PFI+       + T  L A+MI YL   YHM   
Sbjct  1    MEASAMEEALSKKTTS---KGGLRTIPFIISNEVFEKVATFGLHANMILYLTERYHMTAA  57

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP-HAKP  428
            TG+ ++YFW A++  +P+ GA+L+DS +GRF+VI + S++   GM LLWL  ++P   + 
Sbjct  58   TGTVVLYFWNALSNFLPIFGAVLSDSCLGRFRVIALGSVVSLAGMCLLWLTAILPADRRT  117

Query  429  PPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN---NAGAM  590
            P C    D C     +QL LL  SFVL+SVGSGG+  C LAFGADQL    N   N   +
Sbjct  118  PECEARRDDC-QLVPWQLPLLFASFVLMSVGSGGIRPCALAFGADQLDRRDNSARNVRTL  176

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +++F+WYY +  L  V+  T +VY+Q+  GW IG+ + VV ML A     LGSPFY+K
Sbjct  177  QTFFNWYYTVLGLSIVLASTVIVYIQQAKGWVIGFAVPVVLMLTALTLLLLGSPFYLK  234



>ref|NP_001044324.1| Os01g0761500 [Oryza sativa Japonica Group]
 dbj|BAB61219.1| putative peptide transporter [Oryza sativa Japonica Group]
 dbj|BAB92364.1| putative nitrate transporter [Oryza sativa Japonica Group]
 dbj|BAF06238.1| Os01g0761500 [Oryza sativa Japonica Group]
Length=590

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 142/238 (60%), Gaps = 11/238 (5%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME    E+     TTS   KGG RT+PFI+       + T  L A+MI YL   YHM   
Sbjct  1    MEASAMEEALSKKTTS---KGGLRTIPFIISNEVFEKVATFGLHANMILYLTERYHMTAA  57

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP-HAKP  428
            TG+ ++YFW A++  +P+ GA+L+DS +GRF+VI + S++   GM LLWL  ++P   + 
Sbjct  58   TGTVVLYFWNALSNFLPIFGAVLSDSCLGRFRVIALGSVVSLAGMCLLWLTAILPADRRT  117

Query  429  PPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN---NAGAM  590
            P C    D C     +QL LL  SFVL+SVGSGG+  C LAFGADQL    N   N   +
Sbjct  118  PECEARRDDC-QLVPWQLPLLFASFVLMSVGSGGIRPCALAFGADQLDRRDNSARNVRTL  176

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +++F+WYY +  L  V+  T +VY+Q+  GW IG+ + VV ML A     LGSPFY+K
Sbjct  177  QTFFNWYYTVLGLSIVLASTVIVYIQQAKGWVIGFAVPVVLMLTALTLLLLGSPFYLK  234



>gb|EAY75908.1| hypothetical protein OsI_03828 [Oryza sativa Indica Group]
 gb|EAZ13622.1| hypothetical protein OsJ_03538 [Oryza sativa Japonica Group]
Length=585

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 138/226 (61%), Gaps = 8/226 (4%)
 Frame = +3

Query  108  VTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAI  287
            ++   + KGG RT+PFI+       + T  L A+MI YL   YHM   TG+ ++YFW A+
Sbjct  5    LSKKTTSKGGLRTIPFIISNEVFEKVATFGLHANMILYLTERYHMTAATGTVVLYFWNAL  64

Query  288  TYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP-HAKPPPCS---DSCSS  455
            +  +P+ GA+L+DS +GRF+VI + S++   GM LLWL  ++P   + P C    D C  
Sbjct  65   SNFLPIFGAVLSDSCLGRFRVIALGSVVSLAGMCLLWLTAILPADRRTPECEARRDDC-Q  123

Query  456  ATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN---NAGAMESYFSWYYAIFA  626
               +QL LL  SFVL+SVGSGG+  C LAFGADQL    N   N   ++++F+WYY +  
Sbjct  124  LVPWQLPLLFASFVLMSVGSGGIRPCALAFGADQLDRRDNSARNVRTLQTFFNWYYTVLG  183

Query  627  LCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            L  V+  T +VY+Q+  GW IG+ + VV ML A     LGSPFY+K
Sbjct  184  LSIVLASTVIVYIQQAKGWVIGFAVPVVLMLTALTLLLLGSPFYLK  229



>gb|KHN04222.1| Putative peptide transporter [Glycine soja]
Length=579

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 129/211 (61%), Gaps = 6/211 (3%)
 Frame = +3

Query  147  LPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILAD  326
            +PFI+   AL  + T  L  +MI YLMG Y++ +   + ++    A T  +P+ GA +AD
Sbjct  1    MPFIIANEALARVATLGLLPNMILYLMGNYNLHLGKATKILLLSVATTNFMPLPGAFIAD  60

Query  327  SLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQllllctsfv  497
            S +GRF  +G+ S I F+GM LLWL  +IP A+PPPC+   + C SAT  Q + +  S +
Sbjct  61   SYLGRFLAVGLGSFITFLGMTLLWLTAMIPQARPPPCNSETERCESATPGQ-MAMLISSL  119

Query  498  llsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQE  671
             L     G +SC LAFGADQ+  K   NN  A+E +FSWYYA  A+  ++  T +VY+Q+
Sbjct  120  ALMSIGNGGLSCSLAFGADQVNRKDNPNNQRALEMFFSWYYASSAISVIIAFTGIVYIQD  179

Query  672  NAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            + GWK+G+G+    M  +  FFFL SP YVK
Sbjct  180  HLGWKLGFGVPAALMFLSTFFFFLASPLYVK  210



>ref|XP_011090957.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X2 [Sesamum indicum]
Length=543

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 136/233 (58%), Gaps = 32/233 (14%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EK    ++ LL  T    KGGFRTLPFI+G  AL  M T  L  +M  YLM EYHM M T
Sbjct  3    EKNTMLEEHLLERTDQ--KGGFRTLPFIIGIEALEKMATFGLMPNMTLYLMKEYHMGMTT  60

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
             SNL++FW A T  +P+ GA++ADS +GRF  IGI S+I  +GM+LLW  TVIP A+PPP
Sbjct  61   ASNLLFFWSAATNFMPLLGALVADSFLGRFYTIGIGSVISLMGMILLWSTTVIPQARPPP  120

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGAMESYFS  605
            C   ++SCSS TTFQ + LCT+F L+SVG+GG+ S  LAFGADQL+       +      
Sbjct  121  CKQFNNSCSSPTTFQFMYLCTAFGLISVGAGGIRSSSLAFGADQLEKGDFKKSS------  174

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
                                 +N GW +G+ +  V ML     FFL S FYVK
Sbjct  175  ---------------------DNMGWGVGFAVPAVLMLIGVSIFFLASRFYVK  206



>ref|XP_003529761.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=606

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 128/217 (59%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL S+    L  +MI YLMG Y   +   + ++    A + + P+ 
Sbjct  26   KGGIVTMPFIIANEALASVAKIGLLPNMILYLMGSYKFHLAKATQVLLLSSATSNLTPLI  85

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA +ADS +GRF  +G  S I F+GM LL L  +IP A+PPPC+   + C  AT  Q + 
Sbjct  86   GAFIADSCLGRFLSVGFGSSISFLGMALLCLTAIIPQARPPPCNPATERCKPATAGQ-MT  144

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            +  S   L     G +SC +AFGADQ+  K   NN  A+E++FSWYYA  A   ++ LT 
Sbjct  145  MLISSFALMSIGNGGLSCSIAFGADQVNKKDNPNNQRALETFFSWYYASTAFSVIIALTV  204

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q++ GWK+G+G+    M  +  FFFL SP YVK
Sbjct  205  IVYIQDHFGWKVGFGVPAALMFMSTFFFFLASPLYVK  241



>ref|XP_008675020.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Zea mays]
 ref|XP_008675021.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Zea mays]
Length=639

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/237 (41%), Positives = 136/237 (57%), Gaps = 11/237 (5%)
 Frame = +3

Query  87   DEQKPLLVTTSASP--------KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            D ++ L   T+ SP        KGGFR LPFI     L  +    L  +MI YL  +YH+
Sbjct  62   DMERSLATGTTESPQEECFKGNKGGFRALPFIFSNEMLEKVAGFGLNTNMITYLTDKYHL  121

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
              V+   +++ W AI+   P+ GA+LAD  +GRF  + + S+   +GMV LWL   +P A
Sbjct  122  STVSSQTMLFVWSAISNFTPIPGAVLADMYLGRFMAVALGSVACLIGMVFLWLSATVPGA  181

Query  423  KPPPCS-DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KH-IQNNAGAME  593
            +PPPCS D C+   T  L  L   F  LS+G+GGV  C +AFGADQ  +H  Q  A  ++
Sbjct  182  RPPPCSGDQCAPPGTRHLAWLLAGFAFLSLGAGGVRPCSMAFGADQFSRHPRQRRASILQ  241

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            SYF+ YYA   +   V +T +VYLQ+N GW +G+ + +  ML +A+ F LGS  Y+K
Sbjct  242  SYFNAYYASIGVAFTVAVTAIVYLQDNVGWSVGFAVPMGLMLLSAVSFLLGSSLYIK  298



>ref|XP_004239355.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Solanum 
lycopersicum]
Length=575

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 139/229 (61%), Gaps = 5/229 (2%)
 Frame = +3

Query  93   QKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIY  272
            ++   +    + KGG RT+PFI+   +   + +  L  +MI YLM  Y+M   TG++++ 
Sbjct  2    ERETELAEEKTRKGGLRTMPFIILNESFERIASYGLVMNMIIYLMAYYNMSAATGTSILA  61

Query  273  FWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---D  443
             W A++  + + GAI+ADS  GRF+ +   SI   +GM++LWL  +IP  K  PCS    
Sbjct  62   LWAALSNGLAIVGAIVADSYCGRFKAVAFGSISTLIGMIILWLTAMIPQLKSLPCSHFQH  121

Query  444  SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYA  617
             C+  TT QL +L +SFV +S+G+G V  C + FGADQL   +N  N   ++SYF+WYYA
Sbjct  122  VCNGTTTIQLAVLFSSFVFMSIGTGFVRPCSIIFGADQLGEKENHENQRVLDSYFNWYYA  181

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
               +  ++ +T +VY+Q+  GWK+G+GI V+ M  +   F +GSP YVK
Sbjct  182  STGISTILAVTVIVYIQDRYGWKVGFGIPVILMFLSVSMFLIGSPLYVK  230



>ref|XP_010051584.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Eucalyptus grandis]
 gb|KCW82406.1| hypothetical protein EUGRSUZ_C03811 [Eucalyptus grandis]
Length=574

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 147/238 (62%), Gaps = 10/238 (4%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            EI     +E K +        KGG + +PFI+    L  +    L  +MI YL+ +Y  +
Sbjct  2    EIALDRANEAKQV-----TRKKGGLKAIPFIIANEILEKVAAVGLQPNMILYLINKYQFN  56

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
              +G+N+++ W AI+  +P  GA L+DS +GRF+VIG  S+I  +GM LLWL  ++ +A+
Sbjct  57   AASGANVLFLWSAISSFMPALGAFLSDSYLGRFRVIGFGSVISLLGMTLLWLTALLRNAR  116

Query  426  PPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAM  590
            PPPC   S  C S+T+ QLLLL +SF LLS+G+GG+ SC LAFGADQ+ +  N  N   +
Sbjct  117  PPPCDPRSKPCDSSTSAQLLLLFSSFALLSIGAGGIRSCALAFGADQIDNPNNPKNRRIL  176

Query  591  ESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +++F+WYYA   +  ++ +T +V +Q+  GW IG+G+    M  + + FFLGS  YVK
Sbjct  177  QTFFNWYYASVGVSIMIAVTVIVGIQDLHGWVIGFGVPAGLMFISVVSFFLGSSLYVK  234



>ref|XP_006585587.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Glycine max]
Length=585

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 128/217 (59%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL S+    L  +MI YLMG Y   +   + +     A + + P+ 
Sbjct  34   KGGIVTMPFIMANEALASVANIGLQPNMILYLMGSYRFHLAKATQVFLLSSATSNLTPLI  93

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA +ADS +GRF  +G+ S I F+GM LL L  +IP ++PPPC+   + C  AT  Q + 
Sbjct  94   GAFIADSCLGRFLAVGLGSAISFLGMALLCLTAMIPQSRPPPCNPATERCKPATAGQ-MA  152

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            +  S   L     G +SC +AFGADQ+  K   NN  A+E++FSWYYA  A   ++ LT 
Sbjct  153  MLISSFALMSIGNGGLSCSIAFGADQVNKKDNPNNQRALETFFSWYYASTAFSVIIALTV  212

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q++ GWK+G+G+    M  +  FFFL SP YVK
Sbjct  213  IVYIQDHFGWKVGFGVPAALMFMSTFFFFLASPLYVK  249



>ref|XP_009788943.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Nicotiana sylvestris]
 ref|XP_009788944.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Nicotiana sylvestris]
Length=581

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 148/241 (61%), Gaps = 13/241 (5%)
 Frame = +3

Query  57   ASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEY  236
            +S++++E  GD         S S KGG +T+PFI+   AL       L+A+MI YL  EY
Sbjct  6    SSSDLVETSGD--------VSNSKKGGLKTMPFIIANEALERAAGVGLSANMILYLTKEY  57

Query  237  HMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP  416
            H +  TG++++++W +I   +P+ GA+LADS +GR+ VI + +++  +GMV+LWL  ++ 
Sbjct  58   HWENATGASILFWWGSIANFMPIFGALLADSYLGRYFVIALGTVVSLMGMVVLWLTAILK  117

Query  417  HAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NA  581
             AKP  C+    +CS     Q+ LL  SF L+S+G+G ++ C LAFGADQ    +N  N 
Sbjct  118  EAKPHSCNLEAGNCSKPDFGQVALLFASFALMSIGAGCIMPCALAFGADQFNKPENPDNG  177

Query  582  GAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
              ++S+F+WYYA   +  ++ +T +VY+Q   GW +G+G+    ML AA  F LGS  ++
Sbjct  178  RILQSFFNWYYASVCISTLISMTVIVYIQAQFGWIVGFGVSACLMLLAAATFLLGSKLFI  237

Query  762  K  764
            +
Sbjct  238  R  238



>ref|XP_011026625.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Populus euphratica]
Length=568

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 144/228 (63%), Gaps = 10/228 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL     + KGG RTLPFI+   A  S+    L  ++I YL  EY +D   G+++++ 
Sbjct  13   EPLL----RNRKGGIRTLPFILANEAFESLANYGLFPNLILYLTSEYRIDAAKGAHILFL  68

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS---  446
              +     P+ GA LAD+ +GR+++IG   +   +GMVLLWL T  P A+PPPC  S   
Sbjct  69   LSSAINFTPILGAFLADTYVGRYRMIGFGCLASLLGMVLLWL-TTFPEARPPPCVQSSYN  127

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAI  620
            C SATT QLL L T+F  +++G+GG+ S  LAFGADQL   +   +A   ES+FSWYY I
Sbjct  128  CKSATTLQLLHLYTAFCFMAIGAGGIRSSSLAFGADQLGTSNSLKHARIRESFFSWYYGI  187

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             A    +G+T +VY+Q+N GW +G+G+ VV M+ ++L FF+ SP YVK
Sbjct  188  VAASVFLGMTFVVYIQDNIGWMVGFGVPVVLMILSSLSFFVASPSYVK  235



>gb|KHN47833.1| Putative peptide transporter [Glycine soja]
Length=593

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 128/217 (59%), Gaps = 6/217 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG  T+PFI+   AL S+    L  +MI YLMG Y   +   + +     A + + P+ 
Sbjct  13   KGGIVTMPFIMANEALASVANIGLQPNMILYLMGSYRFHLAKATQVFLLSSATSNLTPLI  72

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GA +ADS +GRF  +G+ S I F+GM LL L  +IP ++PPPC+   + C  AT  Q + 
Sbjct  73   GAFIADSCLGRFLAVGLGSAISFLGMALLCLTAMIPQSRPPPCNPATERCKPATAGQ-MA  131

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            +  S   L     G +SC +AFGADQ+  K   NN  A+E++FSWYYA  A   ++ LT 
Sbjct  132  MLISSFALMSIGNGGLSCSIAFGADQVNKKDNPNNQRALETFFSWYYASTAFSVIIALTV  191

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q++ GWK+G+G+    M  +  FFFL SP YVK
Sbjct  192  IVYIQDHFGWKVGFGVPAALMFMSTFFFFLASPLYVK  228



>ref|XP_003546946.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=584

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 124/193 (64%), Gaps = 5/193 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGGF T+PFI+   AL  + +  L  +M+ YL+G+Y + ++  + ++++W+A T   PV 
Sbjct  27   KGGFITMPFIIANEALAKLASVGLMPNMVLYLIGDYRLRVLKATKIMFYWFAATNFAPVI  86

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCSSATTFQllllct  488
            GA +AD+ +GRF  IG+ SI+ F+GM ++WL T++P A+  PCS    SATT Q + +  
Sbjct  87   GAFVADAYLGRFLAIGLGSILSFLGMAVMWLTTMVPEAR--PCSHCEESATTPQ-MAILL  143

Query  489  sfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVY  662
            S   L    GG +SC LAFGADQL  K   NN   +ES+ SWY A  A+  V  LT +VY
Sbjct  144  SCFALISIGGGGISCSLAFGADQLNQKSKPNNPRVLESFISWYIASQAIAVVFSLTGIVY  203

Query  663  LQENAGWKIGYGI  701
            +Q++ GWK+G+G+
Sbjct  204  IQDHFGWKLGFGV  216



>ref|XP_003531668.2| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Glycine max]
Length=610

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 137/242 (57%), Gaps = 12/242 (5%)
 Frame = +3

Query  54   LASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            L ++E+  +M  +  P         KGG  T+PFI+   AL S+    L  +MI YLMG 
Sbjct  15   LCTSEV--EMASQHSP----QPQKKKGGIVTMPFIMANEALASVANIGLQPNMILYLMGS  68

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            Y   +   + +     A + + P+ GA +ADS +GRF  +G+ S I F+GM LL L  +I
Sbjct  69   YRFHLAKATQVFLLSSATSNLTPLIGAFIADSCLGRFLAVGLGSAISFLGMALLCLTAMI  128

Query  414  PHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNN  578
            P ++PPPC+   + C  AT  Q + +  S   L     G +SC +AFGADQ+  K   NN
Sbjct  129  PQSRPPPCNPATERCKPATAGQ-MAMLISSFALMSIGNGGLSCSIAFGADQVNKKDNPNN  187

Query  579  AGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFY  758
              A+E++FSWYYA  A   ++ LT +VY+Q++ GWK+G+G+    M  +  FFFL SP Y
Sbjct  188  QRALETFFSWYYASTAFSVIIALTVIVYIQDHFGWKVGFGVPAALMFMSTFFFFLASPLY  247

Query  759  VK  764
            VK
Sbjct  248  VK  249



>gb|KHM98742.1| Putative peptide transporter [Glycine soja]
Length=566

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 124/193 (64%), Gaps = 5/193 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGGF T+PFI+   AL  + +  L  +M+ YL+G+Y + ++  + ++++W+A T   PV 
Sbjct  9    KGGFITMPFIIANEALAKLASVGLMPNMVLYLIGDYRLRVLKATKIMFYWFAATNFAPVI  68

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCSSATTFQllllct  488
            GA +AD+ +GRF  IG+ SI+ F+GM ++WL T++P A+  PCS    SATT Q + +  
Sbjct  69   GAFVADAYLGRFLAIGLGSILSFLGMAVMWLTTMVPEAR--PCSHCEESATTPQ-MAILL  125

Query  489  sfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVY  662
            S   L    GG +SC LAFGADQL  K   NN   +ES+ SWY A  A+  V  LT +VY
Sbjct  126  SCFALISIGGGGISCSLAFGADQLNQKSKPNNPRVLESFISWYIASQAIAVVFSLTGIVY  185

Query  663  LQENAGWKIGYGI  701
            +Q++ GWK+G+G+
Sbjct  186  IQDHFGWKLGFGV  198



>gb|KHN10296.1| Putative peptide transporter [Glycine soja]
Length=555

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 132/210 (63%), Gaps = 4/210 (2%)
 Frame = +3

Query  147  LPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILAD  326
            +PFI+   +L  + +  +  +MI YL  EY M +  G+++IY W A + I+ + GA L+D
Sbjct  1    MPFIIVNESLEKVASYGIMPNMILYLRDEYRMSIAKGTSVIYTWTAASDILSIFGAFLSD  60

Query  327  SLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD--SCSSATTFQllllctsfvl  500
            S +GRF VI I S    +G+ +LWL  +IP  KP   SD   C+SAT  QL LL  S  L
Sbjct  61   SYLGRFLVIAIGSFSSLLGLTMLWLTAMIPDLKPTRESDMLGCNSATAVQLALLFFSMGL  120

Query  501  lsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQEN  674
            +S+G+G V  C +AFGADQL  K   N+   ++SYF+WYY   A+  ++ L+ +VY+QEN
Sbjct  121  ISIGAGCVRPCSIAFGADQLTIKERSNDERLLDSYFNWYYTSIAISSMIALSVIVYIQEN  180

Query  675  AGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             GWKIG+G+  + M  +A  F LGSPFYVK
Sbjct  181  LGWKIGFGLPALLMFISAASFILGSPFYVK  210



>tpg|DAA57517.1| TPA: hypothetical protein ZEAMMB73_958340 [Zea mays]
Length=577

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 135/235 (57%), Gaps = 11/235 (5%)
 Frame = +3

Query  93   QKPLLVTTSASP--------KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            ++ L   T+ SP        KGGFR LPFI     L  +    L  +MI YL  +YH+  
Sbjct  2    ERSLATGTTESPQEECFKGNKGGFRALPFIFSNEMLEKVAGFGLNTNMITYLTDKYHLST  61

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
            V+   +++ W AI+   P+ GA+LAD  +GRF  + + S+   +GMV LWL   +P A+P
Sbjct  62   VSSQTMLFVWSAISNFTPIPGAVLADMYLGRFMAVALGSVACLIGMVFLWLSATVPGARP  121

Query  429  PPCS-DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KH-IQNNAGAMESY  599
            PPCS D C+   T  L  L   F  LS+G+GGV  C +AFGADQ  +H  Q  A  ++SY
Sbjct  122  PPCSGDQCAPPGTRHLAWLLAGFAFLSLGAGGVRPCSMAFGADQFSRHPRQRRASILQSY  181

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+ YYA   +   V +T +VYLQ+N GW +G+ + +  ML +A+ F LGS  Y+K
Sbjct  182  FNAYYASIGVAFTVAVTAIVYLQDNVGWSVGFAVPMGLMLLSAVSFLLGSSLYIK  236



>ref|XP_003630771.1| hypothetical protein MTR_8g103250, partial [Medicago truncatula]
Length=518

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 140/217 (65%), Gaps = 5/217 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG+RT+PFI+       +    L  +M+ YL+ EYH +  T + +I+ W A +  +P+ 
Sbjct  18   KGGYRTMPFIIANETFEKVANVGLHVNMVLYLLNEYHAEPSTAAIIIFLWNAGSNFMPLF  77

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS--DSCSSATTFQllll  482
            GA+L+DS +GRF+VI   +II  +G+++LWL  +I HA+PP C+  +SC+SAT  Q L L
Sbjct  78   GALLSDSCLGRFRVIAWGTIIDLLGLIVLWLTAIIRHARPPECNNGESCTSATGMQFLFL  137

Query  483  ctsfvllsvgsggvvsCMLAFGADQL---KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
             +S  L++ G+GG+  C LAF ADQ+   K  Q N   M+S+F+WYY    +  +V +  
Sbjct  138  FSSLALMAFGAGGIRPCSLAFAADQINNTKKTQKNERIMKSFFNWYYVSVGVSVMVSMVF  197

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q  AGW IG+GI V  MLF+++ FFLGS  YVK
Sbjct  198  IVYIQVKAGWVIGFGIPVGLMLFSSVVFFLGSFMYVK  234



>ref|XP_011040515.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Populus euphratica]
Length=596

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 150/245 (61%), Gaps = 10/245 (4%)
 Frame = +3

Query  54   LASTEIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            ++  E ME   DE++       AS KGG RT+PFI+       +    L A+MI YL  E
Sbjct  1    MSGEERMEIAVDEKEA--TQKVASKKGGLRTMPFIIANETFEKVAGVGLQANMILYLRNE  58

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            Y++   +G  ++  W A++Y +P+ GA ++DS +GRF VI   ++I  +GM++LWL  +I
Sbjct  59   YNLSNASGGYILSLWVAVSYFMPILGAFISDSYLGRFTVIAYGTVISLLGMIVLWLTALI  118

Query  414  PHAKPPPCSDS------CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN  575
            PHA+PP C+ +      C S    Q LLL +SF LL++G+GG+  C LAFGA+Q+    N
Sbjct  119  PHARPPHCAQTDDDLKDCVSPKLGQFLLLFSSFALLAIGAGGIRPCSLAFGANQIDDPTN  178

Query  576  --NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGS  749
              N   ++++F+WYYA   +  ++ +  +V +Q+ AGW +G+G+ V FML + +FFFLGS
Sbjct  179  PKNQRTLQTFFNWYYASVGISIMISVLVIVAIQDEAGWAVGFGVAVGFMLLSTIFFFLGS  238

Query  750  PFYVK  764
              YVK
Sbjct  239  SLYVK  243



>emb|CDO98012.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 139/233 (60%), Gaps = 5/233 (2%)
 Frame = +3

Query  81   MGDEQK-PLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTG  257
            +GDE    +   T+ S KGG  T+PFI+       + +  L  +MI Y+M  YH+     
Sbjct  29   IGDENDTDMERLTARSRKGGLITIPFIIANEGFEKVASYGLLPNMILYMMNVYHLGFAKA  88

Query  258  SNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC  437
            + +++ W A T   P+ GA LADS MGR   I +  I+  +GM+LLWL  +IP AKPP C
Sbjct  89   NYILFLWSAATNFTPIIGAFLADSYMGRCLTISLGCIVSLLGMMLLWLTAMIPGAKPPTC  148

Query  438  SD--SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFS  605
            S    C SAT  QL  L  SF L+S+G+GG+ S  +AFGADQL    N  N  A+ESYF 
Sbjct  149  SPPLPCKSATPAQLFFLIASFGLMSIGAGGIRSASMAFGADQLDKRDNAGNQRALESYFG  208

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             YYA   L  +V LT +VY+Q++ GWK+G+G+ V+ M  + L FFL SP Y+K
Sbjct  209  LYYAATTLSVLVALTGIVYIQDHMGWKVGFGVPVILMFLSVLIFFLASPIYIK  261



>gb|KHN41645.1| Putative peptide transporter [Glycine soja]
Length=573

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 142/233 (61%), Gaps = 3/233 (1%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME    EQK          KGG+RT+PFI+       +    L  +MI YL+ EYH D  
Sbjct  1    MEMSSMEQKKA-TELVERKKGGYRTIPFIIANETFEKVANVGLHVNMILYLLQEYHFDPA  59

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            TG+ +I+ W A++   P+ GA L+DS +GRF+VI +  +I  VG+V+LWL  +  HA+P 
Sbjct  60   TGAIIIFLWNALSNFFPIFGAFLSDSWLGRFRVIALGIVIDLVGLVVLWLTAIFRHARPQ  119

Query  432  PCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFS  605
               + C++ TT QLL L +S  L+++G+GG+  C LAF ADQ+ + +N  N   M+S F+
Sbjct  120  CDVEPCANPTTLQLLFLFSSLALMALGAGGIRPCTLAFTADQINNPENPHNERTMKSLFN  179

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            WYYA   +   V +T +VY+Q  AGW +G+GI VV M F+A+ FFLGS  Y K
Sbjct  180  WYYASVGISVTVSMTFIVYIQVKAGWVVGFGIPVVLMTFSAIMFFLGSCLYKK  232



>ref|XP_003524398.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=573

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 141/233 (61%), Gaps = 3/233 (1%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME    EQK          KGG+RT+PFI+       +    L  +MI YL+ EYH D  
Sbjct  1    MEMSSMEQKKA-TELVERKKGGYRTIPFIIANETFEKVANVGLHVNMILYLLQEYHFDPA  59

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            TG+ +I+ W A++   P+ GA L+DS +GRF+VI +  +I  VG+V+LWL  +  HA+P 
Sbjct  60   TGAIIIFLWNALSNFFPIFGAFLSDSWLGRFRVIALGIVIDLVGLVVLWLTAIFRHARPQ  119

Query  432  PCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFS  605
               + C++ TT QLL L +S  L+++G+GG+  C LAF ADQ+ + +N  N   M+S F+
Sbjct  120  CDVEPCANPTTLQLLFLFSSLALMALGAGGIRPCTLAFTADQINNPENPHNERTMKSLFN  179

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            WYYA   +   V +T +VY+Q  AGW +G+GI V  M F+A+ FFLGS  Y K
Sbjct  180  WYYASVGISVTVSMTFIVYIQVKAGWVVGFGIPVALMTFSAIMFFLGSCLYKK  232



>ref|XP_006475661.1| PREDICTED: probable peptide/nitrate transporter At3g16180-like 
isoform X2 [Citrus sinensis]
Length=299

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 144/247 (58%), Gaps = 14/247 (6%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTS-------ASPKGG-FRTLPFIVGTMALVSMTTSSLAADMIKY  221
            E M+   D +K +  +         + P+GG  RT+PFI+   +   + +  L  +MI Y
Sbjct  2    EEMKPQRDSEKKMEASPHQQIKQPPSKPEGGSLRTMPFIIVNESFEKVASYGLLPNMIFY  61

Query  222  LMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWL  401
            LM  YH++   G++++  W +I+  + + GA LADS MGRF VI + S    +G   LW 
Sbjct  62   LMNGYHVEAANGASMLSIWSSISNFLAIVGAFLADSYMGRFWVILLGSFSSLLGTTTLWS  121

Query  402  PTVIPHAKPPPC----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHI  569
              +IP  KP PC    S +CSSAT  Q  +L +SF L+S+G+G V  C +AFGADQL + 
Sbjct  122  TAMIPQLKPAPCNQLVSSNCSSATPAQFAILLSSFALISIGAGCVRPCSIAFGADQLDNK  181

Query  570  QN--NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalfffl  743
             N  N   +E++F+WYYA  ++  ++  T +VY+Q++ GWKIG+G+  + M+ + L F  
Sbjct  182  DNPKNKRVLETFFNWYYASTSVSGMLAFTIIVYIQDHLGWKIGFGVRAILMVLSTLMFLF  241

Query  744  GSPFYVK  764
            GS  Y+K
Sbjct  242  GSHLYIK  248



>ref|XP_006355949.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=585

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 144/236 (61%), Gaps = 5/236 (2%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME   ++++ LL  +  S KGG +T+PFI+   +   + +  L  +MI Y+   Y+MD  
Sbjct  1    MENNPEKEEFLLNHSQNSTKGGLKTIPFIIVNESCEKVASFGLQPNMIIYITKFYNMDAA  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
              S LI  W AI+ ++ + GA ++DS +GRF+ + I +I   +GM++LWL T+ P  +P 
Sbjct  61   RASVLISLWSAISNVLSILGAFISDSYIGRFRAVAIGTISSLIGMLVLWLTTIFPQLRPL  120

Query  432  PC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMES  596
            PC      C+  T  QL  +  SF L+S+G+G V  C LA GADQL++ +N  N   ++S
Sbjct  121  PCGQYQHDCNGTTAAQLAAILFSFGLISIGAGFVRPCSLALGADQLENKENLDNERLIDS  180

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YF+W+YA   +  ++ +T +VY+Q++ GW++G+G+  + M+ +   F +GSP Y+K
Sbjct  181  YFNWFYASEGVSVLLAVTVIVYIQDHFGWQVGFGVPALLMVLSLSVFLIGSPHYIK  236



>ref|XP_010320609.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=585

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 144/236 (61%), Gaps = 5/236 (2%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M    +E++ LL  +  S KGG +T+PFI+   +   + +  L  +MI Y+   Y+MD  
Sbjct  1    MGNKPEEEEFLLNHSQNSTKGGVKTIPFIIVNESCERVASFGLQPNMILYITKFYNMDAA  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
              S L+  W A++  + + GA ++DS +GRF+ I I +I   +GM+LLWL T+ P  +P 
Sbjct  61   RASVLLNLWSALSNGLAIFGAFISDSYIGRFRAIAIGTISSLIGMILLWLTTIFPQLRPL  120

Query  432  PCSD---SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMES  596
            PC      C++AT+ QL ++  SF L+++G+G V  C +AFGADQL++ +N  N   M++
Sbjct  121  PCGQYQLDCNAATSTQLAVILCSFGLIAIGAGFVRPCSVAFGADQLENKRNPDNERVMDT  180

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YF+W+YA   +   V +T +VY+Q   GW++G+G+  + M+ +   + +GSP Y+K
Sbjct  181  YFNWFYASVGISISVAITVIVYIQVQFGWQVGFGVPALLMVLSVSVYLIGSPLYIK  236



>ref|XP_007160322.1| hypothetical protein PHAVU_002G311900g [Phaseolus vulgaris]
 gb|ESW32316.1| hypothetical protein PHAVU_002G311900g [Phaseolus vulgaris]
Length=575

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 135/214 (63%), Gaps = 2/214 (1%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGGFRT+PFI+       +    L  +MI YL+ EYH D  T + +++ W A++  +P+ 
Sbjct  16   KGGFRTMPFIIANETFERVANVGLHVNMILYLLQEYHFDPATAAIIVFLWNAMSNFMPIF  75

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCSSATTFQllllct  488
            GA ++DS +GRF+VI + +II  VG+V+LWL  VI  A+P    + C++ T FQLL L +
Sbjct  76   GAFISDSWLGRFRVISLGTIIDLVGLVVLWLTAVIRSARPECHEEPCANPTPFQLLFLFS  135

Query  489  sfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTCLVY  662
            S  L+++G+GG+  C LAF ADQ+ + +N  N   M+S+F+WYY    +   + +  +VY
Sbjct  136  SLALMALGAGGIRPCTLAFTADQINNPENPKNESTMKSFFNWYYVSVGISVSISVIFIVY  195

Query  663  LQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +Q   GW +G+GI V  M F+A+ FF GS  Y+K
Sbjct  196  IQVKEGWGVGFGIPVGLMSFSAIMFFSGSSLYIK  229



>ref|XP_006355950.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=586

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/231 (37%), Positives = 141/231 (61%), Gaps = 5/231 (2%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
             E++ LL  +  S KGG +T+PFI+   +   + +  L  +MI Y+   Y+MD    S L
Sbjct  7    QEEEFLLNHSQNSTKGGLKTIPFIIVNESCERLASFGLQPNMIIYITKFYNMDAARASVL  66

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD-  443
            I  W AI+ ++ + GA ++DS +GRF+ + I +I   +GM++LWL T+ P  +P PC   
Sbjct  67   INLWSAISNVLSILGAFISDSFIGRFRAVAIGTISSLIGMLVLWLTTIFPQLRPLPCGQD  126

Query  444  --SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWY  611
               C+  T  QL  +  SF L+S+G+G V  C +A GADQL++ +N  N   ++SYF+W+
Sbjct  127  QLDCNGTTAAQLAAILCSFGLISIGAGFVRPCSIALGADQLENKENLDNERLIDSYFNWF  186

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA   +  V+ +T +VY+Q++ GW++G+G+  + M+ +   F +GSP Y+K
Sbjct  187  YASVGVSIVLAVTLIVYIQDHFGWQVGFGVPALLMVLSVSVFLIGSPHYIK  237



>ref|XP_003597729.1| hypothetical protein MTR_2g101650 [Medicago truncatula]
 gb|ABD32292.2| TGF-beta receptor, type I/II extracellular region [Medicago truncatula]
 gb|AES67980.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=592

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 126/218 (58%), Gaps = 7/218 (3%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMD  245
            E++E        L+       KGGF T+PFI+   AL  + +  L  +MI YL  +Y + 
Sbjct  4    ELLEGADPVHDELIHDDKKRRKGGFITMPFIIANEALAKLASVGLIPNMILYLTEDYRIR  63

Query  246  MVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAK  425
            +V  + +++ W A T   P   A +ADS MGRF  IG+ SI+ F+GM ++WL  +IP A+
Sbjct  64   VVKATKIMFLWLAATNFSPSVAAFVADSYMGRFLAIGLGSILSFLGMAVMWLTAMIPQAR  123

Query  426  PPPC----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGA  587
            PP C    +++C SAT+ Q + +  S   L    GG +SC L+FGADQL  K    N   
Sbjct  124  PPSCNHHSTENCQSATSSQ-IAIIFSCFALISIGGGGISCSLSFGADQLSKKTDPKNQRV  182

Query  588  MESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGI  701
            +ES+ SWY A  A+  V  +T ++Y+Q++ GWK+G+G+
Sbjct  183  LESFISWYIASQAIAVVFSMTAIIYIQDHLGWKLGFGV  220



>ref|XP_009774737.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like, partial [Nicotiana 
sylvestris]
Length=576

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 137/221 (62%), Gaps = 5/221 (2%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            S   KGG +T+PF++   AL  + +  L A+MI YL  EYH+   TG++++++W AI+  
Sbjct  8    SDHKKGGLKTMPFVIANEALDKVASVGLHANMILYLKNEYHLSNATGASILFWWNAISNF  67

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSATTF  467
             P+ GA L+DS +GR+ VI + + I  +GMV LWL  ++  A+P PC   S++C      
Sbjct  68   TPIFGAFLSDSYLGRYYVIALGTFISLIGMVALWLTAILKEARPHPCKLESENCQKPDIG  127

Query  468  QllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCEVV  641
            QL+ L +SF L+++G+GG+  C LAFGADQ  +    NN   ++S+F+WYYA   +  ++
Sbjct  128  QLVFLFSSFALMAIGAGGIRPCSLAFGADQFDNPDNPNNGRILQSFFNWYYASVGISILI  187

Query  642  GLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +T +VY+Q   GW +G+G+    M  A + F LGS  +++
Sbjct  188  SVTVIVYIQTQFGWVVGFGVPTGLMFLATIMFLLGSALFIR  228



>gb|KEH21351.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=580

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG+RT+PFI+       +    L  +M+ YL+ EYH +  T + +I+ W A +  +P+ 
Sbjct  18   KGGYRTMPFIIANETFEKVANVGLHVNMVLYLLNEYHAEPSTAAIIIFLWNAGSNFMPLF  77

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS--DSCSSATTFQllll  482
            GA+L+DS +GRF+VI   +II  +G+++LWL  +I HA+PP C+  +SC+SAT  Q L L
Sbjct  78   GALLSDSCLGRFRVIAWGTIIDLLGLIVLWLTAIIRHARPPECNNGESCTSATGMQFLFL  137

Query  483  ctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTCL  656
             +S  L++ G+GG+  C LAF ADQ+ + +N  N   M+S+F+WYY    +  +V +  +
Sbjct  138  FSSLALMAFGAGGIRPCSLAFAADQINNPKNPKNERIMKSFFNWYYVSVGVSVMVSMVFI  197

Query  657  VYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            VY+Q  AGW IG+GI V  MLF+++ FFLGS  YVK
Sbjct  198  VYIQVKAGWVIGFGIPVGLMLFSSVVFFLGSFMYVK  233



>ref|XP_004503821.1| PREDICTED: probable peptide transporter At1g52190-like [Cicer 
arietinum]
Length=574

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 138/214 (64%), Gaps = 3/214 (1%)
 Frame = +3

Query  132  GGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTG  311
            GG+RT+PFI+       +    L  +MI YL+ EYH+D  T + +I+ W A +  +P+ G
Sbjct  14   GGYRTMPFIIANETFEKVANVGLHVNMILYLLNEYHVDPSTAAIIIFLWNAGSNFMPLFG  73

Query  312  AILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS-DSCSSATTFQllllct  488
            A L+DS  GRF+VI  A+II  +G+++LWL   I HA+PP C+ +SC++ T  Q L L +
Sbjct  74   AFLSDSCFGRFRVIAWATIIDLLGLIVLWLTAKIRHARPPDCNGESCTTPTVLQFLFLFS  133

Query  489  sfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTCLVY  662
            S  L+S G+GG+  C LAF ADQ+ + +N  N   M+S+F+WYY    +  ++ +  +VY
Sbjct  134  SLALMSFGAGGIRPCSLAFAADQINNPKNPHNERIMKSFFNWYYVSVGISVMLSVIFIVY  193

Query  663  LQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +Q  AGW +G+GI V  MLF+++ FFLGS  YVK
Sbjct  194  IQVKAGWVVGFGIPVALMLFSSVMFFLGSFMYVK  227



>ref|XP_007203564.1| hypothetical protein PRUPE_ppa026167mg [Prunus persica]
 gb|EMJ04763.1| hypothetical protein PRUPE_ppa026167mg [Prunus persica]
Length=596

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 137/220 (62%), Gaps = 6/220 (3%)
 Frame = +3

Query  123  SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVP  302
            S +GG RT+P I+   AL  + +  L A+MI YL+ EY+MD  TG+++++ W AI+   P
Sbjct  16   SKRGGLRTMPCIISNEALERVASIGLHANMILYLLYEYNMDAATGASILFLWSAISNFTP  75

Query  303  VTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS----DSCSSATTFQ  470
            + GA L+DS +GRF  I   S++  +G  +LW   +IPHA+P  C+    + C SA T Q
Sbjct  76   IVGAFLSDSHLGRFCTIAWGSVVSLLGTTMLWSTAIIPHARPVHCNNPLKEKCVSANTAQ  135

Query  471  llllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVG  644
            L+LL  SF L S+GSG +  C +AFGADQ+    N  N   ++S+F+WYYA   +  +  
Sbjct  136  LMLLLASFGLQSIGSGAIKPCSMAFGADQMDKPDNPKNERVLQSFFNWYYASVGVFVMFS  195

Query  645  LTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +T ++Y+Q   GW +G+GI V  M  +AL FFLGS  YVK
Sbjct  196  VTAIIYVQTQFGWVVGFGIPVGLMFLSALLFFLGSSLYVK  235



>ref|XP_006586332.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine 
max]
Length=647

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 143/220 (65%), Gaps = 8/220 (4%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSS------LAADMIKYLMGEYHMDMVTGSNLIYFWYAIT  290
            KGG+RT+PFI+G     +  T        L  +MI YL+ EYH D  TG+ +++ W A+T
Sbjct  86   KGGWRTMPFIIGDDPFQANETFEKVAVVGLRVNMILYLLQEYHFDPATGTIIMFLWNALT  145

Query  291  YIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCSSATTFQ  470
             ++P+  A L+DS +GRF+VI + ++I  VG+V+LWL T+I HA+P   ++ C++ T  Q
Sbjct  146  NLLPIFCAFLSDSCLGRFRVIAMGTVIHLVGLVVLWLTTIIRHARPQCDTEPCANPTVPQ  205

Query  471  llllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVG  644
            LL+L +S  L+++G+ G+ SC LAF ADQ+ + +N  N   M+S+F+WYY   A+   + 
Sbjct  206  LLILFSSLTLMALGASGIRSCTLAFTADQIYNPENPQNERTMKSFFNWYYLSVAISVTIS  265

Query  645  LTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +  +VY+Q  AGW +G+GI +  +  +A+ FFLG+  YVK
Sbjct  266  MAFIVYIQVKAGWVVGFGISMGIVSLSAIMFFLGTSIYVK  305



>ref|XP_008242632.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Prunus mume]
Length=596

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 137/218 (63%), Gaps = 6/218 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG RT+P I+   AL  + +  L A+MI YL+ EY+M+  TG+++++ W AI+   P+ 
Sbjct  18   KGGLRTMPCIIANEALERVASIGLHANMILYLLYEYNMEAATGASILFLWSAISNFTPIF  77

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS----DSCSSATTFQll  476
            GA L+DS +GRF+ I   SI+  +G  +LW   +IPHA+P  C+    + C SA T QL+
Sbjct  78   GAFLSDSHLGRFRTIAWGSIVSLLGTTMLWSTAIIPHARPVHCNNPLKEKCVSANTAQLM  137

Query  477  llctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLT  650
            LL  SF L S+GSG +  C +AFGADQ+    N  N   ++S+F+WYYA   +  +  +T
Sbjct  138  LLLASFGLQSIGSGAIKPCSMAFGADQMDKPDNPKNERVLQSFFNWYYASVGVFVMFSVT  197

Query  651  CLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             ++Y+Q   GW +G+GI V  M  +AL FFLGS  YVK
Sbjct  198  AIIYVQTQFGWVVGFGIPVGLMFLSALLFFLGSSLYVK  235



>ref|XP_004164040.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis 
sativus]
Length=581

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/235 (43%), Positives = 143/235 (61%), Gaps = 5/235 (2%)
 Frame = +3

Query  69   IMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            + E  G E+ PLL  T  + KGGFRTLPFI+   AL  + +  L+  MI YL   Y M  
Sbjct  7    VDENRGMEE-PLLSDTD-NRKGGFRTLPFIIANGALEKLASQGLSPSMILYLTKVYGMKS  64

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
               SN+I+ W A +   P+  A LADS  GRF +I   SI  F+GM +LWL  +IP A+P
Sbjct  65   AHASNVIFLWSAASNFTPIICAFLADSYFGRFPMIAAGSIFSFLGMFVLWLTAMIPQARP  124

Query  429  --PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KHIQNNAGAMESY  599
                 S  C + +T QLLLL +S+ ++SVGSG + +  LAFGADQL +  ++N+G ++SY
Sbjct  125  FCDEISGHCDAPSTSQLLLLYSSYAIMSVGSGCLQASYLAFGADQLYRKNKSNSGILDSY  184

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+  Y   AL  +VG++C+VY+Q+  GW +G+G+ V  M  A + F   SP Y+K
Sbjct  185  FNVCYISAALGTLVGMSCIVYIQDRMGWGMGFGVPVALMFLATITFLSASPLYLK  239



>gb|KGN62823.1| hypothetical protein Csa_2G374650 [Cucumis sativus]
Length=581

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/235 (43%), Positives = 143/235 (61%), Gaps = 5/235 (2%)
 Frame = +3

Query  69   IMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            + E  G E+ PLL  T  + KGGFRTLPFI+   AL  + +  L+  MI YL   Y M  
Sbjct  7    VDENRGMEE-PLLSDTD-NRKGGFRTLPFIIANGALEKLASQGLSPSMILYLTKVYGMKS  64

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
               SN+I+ W A +   P+  A LADS  GRF +I   SI  F+GM +LWL  +IP A+P
Sbjct  65   AHSSNVIFLWSAASNFTPIICAFLADSYFGRFPMIAAGSIFSFLGMFVLWLTAMIPQARP  124

Query  429  --PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KHIQNNAGAMESY  599
                 S  C + +T QLLLL +S+ ++SVGSG + +  LAFGADQL +  ++N+G ++SY
Sbjct  125  FCDEISGHCDAPSTSQLLLLYSSYAIMSVGSGCLQASYLAFGADQLYRKNKSNSGILDSY  184

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+  Y   AL  +VG++C+VY+Q+  GW +G+G+ V  M  A + F   SP Y+K
Sbjct  185  FNVCYISAALGTLVGMSCIVYIQDRMGWGMGFGVPVALMFLATITFLSASPLYLK  239



>ref|XP_009628192.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like, partial [Nicotiana 
tomentosiformis]
Length=328

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 132/219 (60%), Gaps = 11/219 (5%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSAS----PKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME+ G      LV TS       KGG +T+PFI+   AL  + +  L+A+MI YL  EYH
Sbjct  1    MERKGSSSD--LVKTSEDVLDGKKGGLKTMPFIIANEALERLASVGLSANMIMYLKNEYH  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            +    G   +++W AI+   PV GA+L+DS +GR+ VI + + I F+GMV+LWL  +I  
Sbjct  59   LTNARGQITLFWWGAISNFTPVFGALLSDSYLGRYYVIALGTFISFLGMVVLWLTAIIKE  118

Query  420  AKPPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAG  584
            A+P  C   S +C      QL LL +SF L+++G+GG+  C LAFGADQ  +  N  N  
Sbjct  119  ARPHRCKLDSGNCLKPDIGQLALLLSSFALMAIGAGGIRPCSLAFGADQFDNPANPTNGR  178

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGI  701
             ++S+F+WYYA   +  ++ +T +VY+Q   GW +G+G+
Sbjct  179  ILQSFFNWYYASVCISVLISVTVIVYIQTQFGWVVGFGV  217



>ref|XP_002318679.2| hypothetical protein POPTR_0012s08940g [Populus trichocarpa]
 gb|EEE96899.2| hypothetical protein POPTR_0012s08940g [Populus trichocarpa]
Length=589

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 149/239 (62%), Gaps = 10/239 (4%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            ME   DE++       AS KGG RT+PFI+       +    L A+MI YL  EY++   
Sbjct  1    MEIAVDEKQA--TQKVASKKGGLRTMPFIIANETFEKVAGVGLQANMILYLRNEYNLSNA  58

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            +G+ ++  W AI+Y +P+ GA ++DS +GRF VI   ++I  +GM++LWL  +IPHA+PP
Sbjct  59   SGAYILSLWGAISYFMPILGAFISDSYLGRFSVIAYGTVISLLGMIVLWLTALIPHARPP  118

Query  432  PCSDS------CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGA  587
             C+ +      C S    Q LLL +SF LL++G+GG+  C LAFGA+Q+ +  N  N   
Sbjct  119  HCAQTDDDLKDCVSPKLGQFLLLFSSFALLAIGAGGIRPCSLAFGANQIDNPTNPKNQRT  178

Query  588  MESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            ++++F+WYYA   +  ++ +  +V +Q+ AGW +G+G+ V FML + +FFFLGS  YVK
Sbjct  179  LQTFFNWYYASVGISIMISVLVIVAIQDAAGWVVGFGVAVGFMLLSTIFFFLGSSLYVK  237



>gb|KHN41359.1| Putative peptide transporter [Glycine soja]
Length=572

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = +3

Query  111  TTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAIT  290
            ++S   KGG RT+PFI+    L  + +  +  +MI YL  +Y M +  G+++IY W A +
Sbjct  17   SSSQIRKGGLRTMPFIIVNECLEKVASYGIMPNMILYLRDDYLMPIAKGTSVIYTWTAAS  76

Query  291  YIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---SCSSAT  461
             ++ + GA L+DS +GRF VI I S    +G+ +LWL  + P  K P C      C+S T
Sbjct  77   DVLSLFGAFLSDSYLGRFLVIAIGSFSSLLGLTMLWLTAMFPDLK-PSCESYMLDCNSGT  135

Query  462  TFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCE  635
              Q  LL  S  L+S+G+G V  C +AFGADQL  K   N+   ++SYF+WYY   A+  
Sbjct  136  PAQQALLFLSMGLISIGAGCVRPCSIAFGADQLNIKERSNDEKLLDSYFNWYYTSIAIST  195

Query  636  VVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            V+ L+ +VY+QEN GWKIG+G+  + M  +A+ F LG PFYVK
Sbjct  196  VIALSVIVYIQENLGWKIGFGLPALLMFISAVSFILGLPFYVK  238



>ref|XP_006363540.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=573

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 141/236 (60%), Gaps = 5/236 (2%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M    ++++ LL  +  S KGG  T+PFI+   +   + +  L  +MI YL   YHM+  
Sbjct  1    MGNKSEQEELLLNHSKNSRKGGLITMPFIIVNESCEKLASYGLLPNMIIYLTTFYHMEAA  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            + S L+  W A++  + + GA L+DS +GRF+ + I +I   +GM +LWL T+IP  +P 
Sbjct  61   SASVLLALWTALSNGLGLFGAFLSDSYLGRFRAVAIGTISSLIGMCILWLTTIIPQLRPL  120

Query  432  PCSDS---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMES  596
            PC      C   T  QL +L  SF L+S+G+G    C +AFGADQL++ +N  N   ++S
Sbjct  121  PCGQHQHGCDGTTAVQLAILLCSFGLISIGTGFNRPCSIAFGADQLENKENPDNERLIDS  180

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YF+WYYA   +  V+ +T +VY+Q++ GW+IG+ +  + M+ +   F +GSP Y+K
Sbjct  181  YFNWYYASVGISLVLAVTVIVYIQDHFGWQIGFAVPALLMIISVSIFLIGSPLYIK  236



>ref|XP_009795447.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Nicotiana 
sylvestris]
Length=597

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG RT+PFI+   +   + +  L  +MI YLM  Y M   TG++++  W A++  + + 
Sbjct  16   KGGLRTMPFIIVNESFERVASYGLQTNMIIYLMAFYQMSAATGASILGIWTALSNGLAIV  75

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---SCSSATTFQlll  479
            GAI++DS +GRF+ + I SI   +GM++LWL  +IP  K  PC      C+ AT  QL +
Sbjct  76   GAIISDSYLGRFRAVAIGSIFTLIGMIILWLTAMIPQLKSLPCYQFLHVCNGATAVQLAV  135

Query  480  lctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTC  653
            L +SF  +SVG+G V  C + FGADQL+  +N  N   ++SYF+WYYA   +  +  +T 
Sbjct  136  LFSSFGFMSVGAGFVRPCSIMFGADQLEKKENPENQRLVDSYFNWYYASIGISTIFAVTI  195

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q+  GW++G+GI V+ M F+   F +GSP Y+K
Sbjct  196  IVYIQDRYGWQVGFGIPVILMFFSVSMFLIGSPLYIK  232



>ref|XP_009795448.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Nicotiana 
sylvestris]
Length=581

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG RT+PFI+   +   + +  L  +MI YLM  Y M   TG++++  W A++  + + 
Sbjct  16   KGGLRTMPFIIVNESFERVASYGLQTNMIIYLMAFYQMSAATGASILGIWTALSNGLAIV  75

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---SCSSATTFQlll  479
            GAI++DS +GRF+ + I SI   +GM++LWL  +IP  K  PC      C+ AT  QL +
Sbjct  76   GAIISDSYLGRFRAVAIGSIFTLIGMIILWLTAMIPQLKSLPCYQFLHVCNGATAVQLAV  135

Query  480  lctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTC  653
            L +SF  +SVG+G V  C + FGADQL+  +N  N   ++SYF+WYYA   +  +  +T 
Sbjct  136  LFSSFGFMSVGAGFVRPCSIMFGADQLEKKENPENQRLVDSYFNWYYASIGISTIFAVTI  195

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q+  GW++G+GI V+ M F+   F +GSP Y+K
Sbjct  196  IVYIQDRYGWQVGFGIPVILMFFSVSMFLIGSPLYIK  232



>ref|XP_006355956.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=584

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 144/234 (62%), Gaps = 9/234 (4%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTG  257
            KMG E +       ++ KGG RT+PFI+   +   + +  L  +MI YLM  Y+M   TG
Sbjct  4    KMGTESQ----VEVSTRKGGLRTMPFIILNESFERVASFGLQMNMIIYLMTYYNMSAATG  59

Query  258  SNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC  437
            ++++  W A++  + + GAI AD  +GR++ +   SI   +GM++LWL  +IP  K  PC
Sbjct  60   TSILGLWGALSNGLALFGAITADFYLGRYRAVAYGSISTLIGMIILWLTAMIPQLKSSPC  119

Query  438  SD---SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
            S     C+  T  QL +L +SFV +S+G+G V+ C + FGADQL++ +N  N   +ESYF
Sbjct  120  SQIQHVCNGVTALQLAVLFSSFVFMSIGAGFVIPCSIIFGADQLENKKNPENERILESYF  179

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +WYYA   +  ++ +T +VY+Q+N GWK+G+G+  + M  + L F +GSP Y+K
Sbjct  180  NWYYASSGISLILAVTVIVYIQDNYGWKVGFGVPAILMFLSVLMFQIGSPLYIK  233



>ref|XP_006833367.1| hypothetical protein AMTR_s00109p00101980 [Amborella trichopoda]
 gb|ERM98645.1| hypothetical protein AMTR_s00109p00101980 [Amborella trichopoda]
Length=578

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/220 (40%), Positives = 140/220 (64%), Gaps = 5/220 (2%)
 Frame = +3

Query  120  ASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIV  299
            A  KGG +T+PFI+       + +  L A+MI YLM EY+++ V+ + +++ W A +  +
Sbjct  15   AERKGGMKTMPFIIANETFEKVASYGLQANMILYLMTEYNLNPVSAAKILFTWSATSNFM  74

Query  300  PVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC--SDSCSSATTFQl  473
            P+ GA ++DS +GRF+VI + SI   +GM++LWL   IP+ +PP C    +C   +  Q+
Sbjct  75   PIIGAFVSDSYLGRFRVITLGSIATLLGMIILWLTAAIPNTRPPSCPTQKTCFLPSPSQI  134

Query  474  lllctsfvllsvgsggvvsCMLAFGADQLKHIQNN---AGAMESYFSWYYAIFALCEVVG  644
             +L TSF L+S+G+GG+  C LAFGADQL   +++      ++ +F+WYY    L  ++ 
Sbjct  135  AILLTSFALMSIGTGGIRPCSLAFGADQLAQSKSDPKTGRTLQRFFNWYYVSVGLSVMIA  194

Query  645  LTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +T +VY+Q+  GW +G+G+ V+ M  +  FF LGSPFYVK
Sbjct  195  VTVIVYIQDVKGWIVGFGVPVILMALSTAFFTLGSPFYVK  234



>ref|XP_008793166.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Phoenix dactylifera]
Length=582

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 139/235 (59%), Gaps = 13/235 (6%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            EKM ++Q           KGG +T+PFI+    L  + +  L A+M  YL  EYHM   T
Sbjct  4    EKMSEQQ--------LKRKGGLKTIPFIMTNEILERVASIGLTANMTIYLTKEYHMTPAT  55

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
             + ++  W A+T  +P+ GA L+DS +GRF+VI I S+    GMVLLWL   +P AKPP 
Sbjct  56   SAIVLLIWGAVTNFLPIFGAFLSDSYLGRFRVIAIGSVACLNGMVLLWLTAELPGAKPPA  115

Query  435  CS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C      C S +  QL LL ++F L+SVG+GG+  C LAFGADQ     N  N   ++++
Sbjct  116  CDLALHKCQSPSHSQLALLYSAFALISVGTGGIRPCSLAFGADQFNRPDNPQNERTLQTF  175

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   +  ++ +T ++Y+Q+  GW++G+G+ VV M  + + F LG   YVK
Sbjct  176  FNWYYASVGVSVIIAVTVIIYIQDKKGWRVGFGVPVVLMALSIICFLLGYFLYVK  230



>ref|XP_006353565.1| PREDICTED: probable peptide/nitrate transporter At3g16180-like 
[Solanum tuberosum]
Length=590

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 143/241 (59%), Gaps = 10/241 (4%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTS---ASPK--GGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEY  236
            MEK+ D    +    S   +S K  GG +T+PFI+   AL  + +  L ++MI YL  EY
Sbjct  1    MEKIEDNNSDIFKINSEDVSSDKKLGGLKTMPFIIANEALEKVASVGLISNMILYLKNEY  60

Query  237  HMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP  416
            H+   +G+ ++++W A++   P+ GA LADS +GRF VI + + I  +GMV+LWL   + 
Sbjct  61   HLTNASGATILFWWNAMSNFTPIFGAFLADSYLGRFYVIALGTFITLIGMVVLWLTATLK  120

Query  417  HAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNA  581
             A+P  C     +C   T  Q   L +SF L+S+G+GG+  C LAFGADQ  +++  NN 
Sbjct  121  EARPHACKLELGNCLKPTIAQFAFLFSSFALMSIGAGGIRPCSLAFGADQFDNLKNPNNG  180

Query  582  GAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
              ++S+F+WYYA   +  ++ +T +VY+Q   GW +G+G+    M  A +FF LGS  ++
Sbjct  181  RILQSFFNWYYAAVGISVLISVTVIVYIQTQFGWVVGFGVPAGLMFLATIFFLLGSTIFI  240

Query  762  K  764
            K
Sbjct  241  K  241



>ref|XP_009628173.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
 ref|XP_009628174.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Nicotiana tomentosiformis]
Length=580

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 142/235 (60%), Gaps = 11/235 (5%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASP-KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            KMG +     +    +P KGG RT+PFI+   +   + +  L  +MI YLM  Y M   T
Sbjct  2    KMGRD-----IELEENPRKGGLRTMPFIIVNESFERVASYGLQTNMIIYLMTFYQMSAAT  56

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPP  434
            G++++  W A++  + + GAI++DS +GRF+ + I SI   VGM++LWL  +IP  KP P
Sbjct  57   GASILGIWTALSNGLAIVGAIISDSYLGRFRAVAIGSIFTLVGMIILWLTAMIPQLKPLP  116

Query  435  C---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESY  599
            C      C+ AT  QL++L +SF  +SVG+G V  C + FGADQ +  +N  N   ++SY
Sbjct  117  CPQFQHICNGATAVQLVILFSSFGFMSVGAGFVRPCSIIFGADQFEKKENTENQRLVDSY  176

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+WYYA   +  +  +T +VY+Q+  GW++G+GI V+ M F+   F +G P Y+K
Sbjct  177  FNWYYASIGISTIFAVTIIVYIQDRYGWQVGFGIPVILMFFSVSMFLIGYPLYIK  231



>ref|XP_004237077.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=573

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 139/232 (60%), Gaps = 6/232 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSA-SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSN  263
             EQ+ LL+  S  S KGG  T+PFI+   +   + +  L  +MI YL   YHM+  + S 
Sbjct  5    QEQEELLLNHSKNSRKGGLITMPFIIVNESCEKLASYGLLPNMIIYLTTFYHMEAASASV  64

Query  264  LIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD  443
            LI  W A++  + + GA L+DS +GRF+ + I +I   +G  +LWL T++P  +P PC  
Sbjct  65   LIALWTALSNGLGLFGAFLSDSYLGRFRAVAIGTISSLIGTCILWLTTIMPQLRPLPCGQ  124

Query  444  S---CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSW  608
                C   T  QL +L  S  L+S+G+G    C +AFGADQL++ +N  N   ++SYF+W
Sbjct  125  HQHVCDGTTAAQLAILLCSLGLMSIGTGFNRPCSIAFGADQLENKENPDNERLIDSYFNW  184

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YYA   +  V+ +T +VY+Q++ GW+IG+G+  + ML +   F +GSP Y+K
Sbjct  185  YYASVGVSLVLAVTVIVYIQDHFGWQIGFGVPALLMLISVSIFLIGSPLYIK  236



>ref|XP_010924574.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Elaeis guineensis]
Length=581

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 136/220 (62%), Gaps = 8/220 (4%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG +T+PFI+       + +  L  +MI YL   YHM  VT  ++++ W AI+Y +P+ 
Sbjct  9    KGGLKTIPFIMTNEIFEKVASFGLMPNMIIYLTEVYHMTPVTAGSVLFIWGAISYFLPIF  68

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS------CSSATTFQ  470
            GA L+D+ +GRF VI IAS+    GMVLLWL  ++P A PP C  +      C S +  Q
Sbjct  69   GAFLSDAYLGRFLVIAIASVACLQGMVLLWLTAMLPGANPPACDPADLVLGKCQSPSNSQ  128

Query  471  llllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVG  644
            L LL +SF L+S+G+GG+  C LAFGADQ     N  N   ++++F+WYYA   +  ++ 
Sbjct  129  LALLFSSFALISIGTGGIRPCSLAFGADQFDRKDNPQNERTLQTFFNWYYATIGISFIIA  188

Query  645  LTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             T +VY+Q+  GWK+G+G+ VV M  + +FF LGS  Y+K
Sbjct  189  STVIVYIQDKMGWKVGFGVPVVLMALSIVFFLLGSFLYIK  228



>ref|XP_010668218.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Beta vulgaris subsp. 
vulgaris]
Length=598

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 132/222 (59%), Gaps = 5/222 (2%)
 Frame = +3

Query  111  TTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAIT  290
            T     KGG  T+PFI+   A   +++  L  +MI YLM  YH+D   G+ ++  W A++
Sbjct  32   TPKTRKKGGLITMPFIIVNEAFEKVSSYGLLPNMIFYLMNVYHLDAAKGTIILSLWSALS  91

Query  291  YIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS---CSSAT  461
              + + G  L+DS +GRF+VI   +    +G+ LLWL ++IP  KP  C +S   C SAT
Sbjct  92   NAMAIFGGFLSDSYLGRFRVIAFGTFCSLLGVTLLWLTSMIPALKPSACPNSREGCGSAT  151

Query  462  TFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCE  635
              Q L+L  SF L+S+G+G V  C +AFGADQ+  K   NN   ++S+F+WYYA   L  
Sbjct  152  PAQFLVLYASFGLISIGAGCVRPCSIAFGADQVNDKENPNNERVLDSFFNWYYASTGLST  211

Query  636  VVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
            ++ LT +VY+QE  GW IG+G+  + M+ +   F  GSP YV
Sbjct  212  ILALTVIVYIQEQFGWSIGFGVPAILMVLSLAAFLFGSPLYV  253



>ref|XP_004239357.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=585

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/236 (36%), Positives = 142/236 (60%), Gaps = 5/236 (2%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M    +E++ LL  +  S KGG +T+PFI+   +   + +  L  +MI Y+   Y+++  
Sbjct  1    MGNNTEEKEFLLNHSQNSTKGGLKTIPFIIVNESCERLASFGLQPNMIIYITKFYNINAA  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
              S LI  W A++ ++ + GA ++DS +GRF+ + I +I   +GM++LWL T+ P  +P 
Sbjct  61   HASVLINLWSAVSNVLSILGAFISDSYIGRFRAVAIGTISSLIGMLVLWLTTIFPQLRPL  120

Query  432  PC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMES  596
            PC      C+  T  QL  +  SF L+S+G+G V  C +A GADQL++ +N  N   M+S
Sbjct  121  PCGQYQHDCNGTTAAQLAAILCSFGLISIGAGLVRPCSIALGADQLENKENPDNERLMDS  180

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YF+W+YA   +  V  +T +VY+Q++ GW++G+G+  + M+ +   F +GSP Y+K
Sbjct  181  YFNWFYASIGVAIVFAVTVIVYIQDHFGWQVGFGVPALLMVLSVSVFLIGSPHYIK  236



>ref|XP_004238696.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 [Solanum lycopersicum]
Length=583

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 140/231 (61%), Gaps = 5/231 (2%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ LL       KGG RT+PFI+   +   + +  L + MI YLM  Y+M   TG+++
Sbjct  2    ESERELLFVEENPRKGGLRTIPFIIVNESFERVASFGLQSKMIIYLMTYYNMSAATGTSI  61

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD-  443
            +  W A++  + + GAI+AD  +GR++ +   SI   +GM++LWL  +IP  K   CS+ 
Sbjct  62   LGLWNALSNGLALFGAIIADFYLGRYRAVAYGSISTLIGMIILWLTAMIPQLKSLSCSEI  121

Query  444  --SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWY  611
               C+  TT QL +L +S   +S+G+G V  C + FGADQL++ +N  N   +ESYF+WY
Sbjct  122  HHVCNGPTTLQLAVLFSSLGFMSIGAGFVRPCSIIFGADQLENKKNPENQRILESYFNWY  181

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA   +  ++ +T +VY+Q+  GWK+G+G+  + M  + L F +GSP Y+K
Sbjct  182  YASSGVSTILAVTLIVYIQDLYGWKVGFGVPAILMFLSVLTFQIGSPLYIK  232



>ref|XP_004239356.2| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=580

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 135/217 (62%), Gaps = 5/217 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGGFRT+PFI+   +   + +  L  +M+ YLM  Y+M   TG++++  W A++  + + 
Sbjct  13   KGGFRTMPFIIVNESFERVASYGLQFNMLMYLMTYYNMSAATGTSILALWAALSNGLAIV  72

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQlll  479
            GAI+AD   GRF+ +   SI   +GM++LWL  +IP  K  PCS     C+  T F   +
Sbjct  73   GAIIADYYWGRFRAVAFGSISTLIGMIILWLTAMIPQLKSLPCSHFQHVCNGPTAFLFAV  132

Query  480  lctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTC  653
            L +S V +SVG+G V  C + FGADQL++ QN  N   ++SYF+WYYA   +  ++ +T 
Sbjct  133  LFSSLVFMSVGAGFVRPCSIIFGADQLENKQNPENGRILDSYFNWYYASSGISTILAVTI  192

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+Q+  GWK+G+G+ V+ M  + L F +GSP Y+K
Sbjct  193  IVYIQDLYGWKVGFGVPVILMFLSVLMFQIGSPLYIK  229



>ref|XP_006451204.1| hypothetical protein CICLE_v10007800mg [Citrus clementina]
 gb|ESR64444.1| hypothetical protein CICLE_v10007800mg [Citrus clementina]
Length=598

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 142/247 (57%), Gaps = 14/247 (6%)
 Frame = +3

Query  66   EIMEKMGDEQKPLLVTTSASPK--------GGFRTLPFIVGTMALVSMTTSSLAADMIKY  221
            E M+   D +K +  +     K        GG RT+PFI+   +   + +  L  +MI Y
Sbjct  2    EEMKPQRDSEKKMEASPHQQIKQPPSKPEGGGLRTMPFIIVNESFEKVASYGLLPNMIFY  61

Query  222  LMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWL  401
            LM  YH++   G++++  W +I+  + + GA LADS MGRF VI + S    +G   LW 
Sbjct  62   LMNGYHVEAANGASMLSIWSSISNFLAIVGAFLADSYMGRFWVILLGSFSSLLGTTTLWS  121

Query  402  PTVIPHAKPPPC----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHI  569
              +IP  KP PC    S +CSSAT  Q  +L +SF L+S+G+G V  C +AFGADQL + 
Sbjct  122  TAMIPQLKPAPCNQLVSSNCSSATPAQFAILLSSFALISIGAGCVRPCSIAFGADQLDNK  181

Query  570  QN--NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalfffl  743
             N  N   +E++F+WYYA  ++  ++  T +VY+Q++ GWKIG+G+  + M+ + L F  
Sbjct  182  DNPKNKRVLETFFNWYYASTSVSGMLAFTIIVYIQDHLGWKIGFGVPAILMVLSTLMFLF  241

Query  744  GSPFYVK  764
            GS  Y+K
Sbjct  242  GSHLYIK  248



>ref|XP_006355952.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=582

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 143/231 (62%), Gaps = 6/231 (3%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            + ++ LLV  +   KGG RT+PFI+   +   + +  L  ++I YLM  Y+M   TG+++
Sbjct  2    ESERELLVEENPR-KGGLRTMPFIIVNESFERVASFGLQTNLIIYLMTYYNMSAATGTSI  60

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD-  443
            +  W A++  + + GAI AD  +GR++ +   SI   +GM++LWL  +IP  K  PCS  
Sbjct  61   LGLWGALSNGLALFGAITADFYLGRYRAVAYGSISTLIGMIILWLTAMIPQLKSSPCSQI  120

Query  444  --SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWY  611
               C+  T  QL +L +SFV +S+G+G V  C + FGADQL++ +N  N   +ESYF+WY
Sbjct  121  QHVCNGVTALQLAVLFSSFVFMSIGAGFVRPCSIIFGADQLENKKNPENERILESYFNWY  180

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA   +  ++ +T +VY+Q++ GWK+G+G+  + M  + L F +GSP Y+K
Sbjct  181  YASSGISTILAVTLIVYIQDSYGWKVGFGVPAILMFLSVLMFQIGSPLYIK  231



>ref|XP_006355951.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=585

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 143/231 (62%), Gaps = 5/231 (2%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
            +E++ LL  +  S KGG +T+PFI+   +   + +  L  +MI Y+   Y+MD    S L
Sbjct  6    EEEEFLLNHSQNSTKGGVKTIPFIIVNESCERVASFGLQPNMILYITKFYNMDAARASVL  65

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD-  443
            +  W A++  + + GA ++DS +GRF+ I I +I   +GM++LWL  + P  +P PC   
Sbjct  66   LNLWSALSNGLAIFGAFISDSYIGRFRAIAIGTISSLIGMIVLWLTAIFPQIRPLPCGQD  125

Query  444  --SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWY  611
               C++AT  QL ++ +SF L+S+G+G V  C +AFGADQL++ +N  N   M++YF+W+
Sbjct  126  QLDCNAATAPQLAVILSSFGLISIGAGFVRPCSVAFGADQLENKENPDNERVMDTYFNWF  185

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA   +   V +T +VY+Q   GW++G+G+ V+ M+ A   + +GSP Y+K
Sbjct  186  YASVGISISVAITVIVYIQVQFGWQVGFGVPVLLMVLAVSIYLIGSPLYIK  236



>dbj|BAB02684.1| peptide/amino acid transporter-like protein [Arabidopsis thaliana]
Length=541

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 125/191 (65%), Gaps = 6/191 (3%)
 Frame = +3

Query  210  MIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMV  389
            MI YLM +Y + +V G  +++ W A T  +P+ GA L+DS +GRF  I IAS+   +GMV
Sbjct  1    MILYLMSDYRLGLVKGQTVLFMWVAATNFMPLVGAFLSDSYLGRFLTIVIASLSSLLGMV  60

Query  390  LLWLPTVIPHAKPPPC----SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQ  557
            +LWL  ++P  KP PC      +CSSAT+ QL LL T+F L+S+GSGG+  C LAFGADQ
Sbjct  61   VLWLTAMLPQVKPSPCVATAGTNCSSATSSQLALLYTAFALISIGSGGIRPCSLAFGADQ  120

Query  558  LKHIQN--NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaal  731
            L + +N  N   +ES+F WYYA  ++  ++  T +VY+Q++ GWKIG+GI  + ML A  
Sbjct  121  LDNKENPKNERVLESFFGWYYASSSVAVLIAFTVIVYIQDHLGWKIGFGIPAILMLLAGF  180

Query  732  ffflGSPFYVK  764
             F   SP YVK
Sbjct  181  LFVFASPLYVK  191



>gb|KHN04221.1| Putative peptide transporter [Glycine soja]
Length=575

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 124/211 (59%), Gaps = 6/211 (3%)
 Frame = +3

Query  147  LPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILAD  326
            +PFI+   AL S+    L  +MI YLMG Y   +   + ++    A + + P+ GA +AD
Sbjct  1    MPFIIANEALASVAKIGLLPNMILYLMGSYKFHLAKATQVLLLSSATSNLTPLIGAFIAD  60

Query  327  SLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS---DSCSSATTFQllllctsfv  497
            S +GRF  +G  S I F+GM LL L  +IP A+PPPC+   + C  AT  Q + +  S  
Sbjct  61   SCLGRFLSVGFGSSISFLGMALLCLTAIIPQARPPPCNPATERCKPATAGQ-MTMLISSF  119

Query  498  llsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQE  671
             L     G +SC +AFGADQ+  K   NN  A+E++FSWYYA  A   ++ LT +VY+Q+
Sbjct  120  ALMSIGNGGLSCSIAFGADQVNKKDNPNNQRALETFFSWYYASTAFSVIIALTVIVYIQD  179

Query  672  NAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            + GWK+G+G+    M  +  FFFL SP YVK
Sbjct  180  HFGWKVGFGVPAALMFMSTFFFFLASPLYVK  210



>ref|XP_004252058.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Solanum lycopersicum]
Length=586

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 144/242 (60%), Gaps = 11/242 (5%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTS----ASPK--GGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGE  233
            MEK   E    +V T+    +S K  GG RT+PFI+   AL  + +  L ++MI YL  E
Sbjct  1    MEKKIKENNSEIVKTNFEDVSSDKKLGGLRTMPFIIANEALEKVASVGLISNMILYLKNE  60

Query  234  YHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVI  413
            YH+   +G+ ++++W A++   P+ GA LADS +GRF VI + + I  +GMV+LWL   +
Sbjct  61   YHITNASGATILFWWNAMSNFTPIFGAFLADSYLGRFYVIALGTFITLIGMVVLWLTATL  120

Query  414  PHAKPPPCS---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NN  578
              A+P  C     +C   T  Q   L +SFVL+S+G+GG+  C LAFGADQ  + +  NN
Sbjct  121  KEARPHGCKLELGNCLQPTIAQYAFLFSSFVLMSIGAGGIRPCSLAFGADQFDNPKNPNN  180

Query  579  AGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFY  758
               ++S+F+WYYA   +  ++ +T +VY+Q   GW +G+G+    M  A +FF LGS  +
Sbjct  181  GRILQSFFNWYYAAVGISVLISVTIIVYIQTQFGWVVGFGVPAGLMFLATIFFLLGSTIF  240

Query  759  VK  764
            +K
Sbjct  241  IK  242



>gb|KDO66443.1| hypothetical protein CISIN_1g007637mg [Citrus sinensis]
Length=595

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 136/222 (61%), Gaps = 7/222 (3%)
 Frame = +3

Query  120  ASPKGG-FRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            + P+GG  RT+PFI+   +   + +  L  +MI YLM  YH++   G++++  W +I+  
Sbjct  24   SKPEGGSLRTMPFIIVNESFEKVASYGLLPNMIFYLMNGYHVEAANGASMLSIWSSISNF  83

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC----SDSCSSATT  464
            + + GA LADS MGRF VI + S    +G   LW   +IP  KP PC    S +CSSAT 
Sbjct  84   LAIVGAFLADSYMGRFWVILLGSFSSLLGTTTLWSTAMIPQLKPAPCNQLVSSNCSSATP  143

Query  465  FQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEV  638
             Q  +L +SF L+S+G+G V  C +AFGADQL +  N  N   +E++F+WYYA  ++  +
Sbjct  144  AQFAILLSSFALISIGAGCVRPCSIAFGADQLDNKDNPKNKRVLETFFNWYYASTSVSGM  203

Query  639  VGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +  T +VY+Q++ GWKIG+G+  + M+ + L F  GS  Y+K
Sbjct  204  LAFTIIVYIQDHLGWKIGFGVRAILMVLSTLMFLFGSHLYIK  245



>gb|KJB27309.1| hypothetical protein B456_004G290200 [Gossypium raimondii]
Length=577

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 143/232 (62%), Gaps = 8/232 (3%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            ++ G   +P L  TS+  KGGFRTLPFI+   A   +    +  +MI YL GE+ M+  T
Sbjct  6    DEHGKLSEPFL--TSSPSKGGFRTLPFILAMEAFERVAIVGITTNMIVYLTGEFGMETAT  63

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP--  428
             +++I+ W A T   P+ GA +ADS MG++ +IGI +IIGF+GM+LLW   +IP A+P  
Sbjct  64   AASVIFVWSAATGFTPIIGAFIADSYMGKYPMIGIGTIIGFLGMILLWSTAMIPQARPYC  123

Query  429  PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGAMESYFSW  608
               +  C + T  QLLLL  S  L+S+G+GG+ S  +A G DQL    N+ G    +F+W
Sbjct  124  DQFNTICEAPTIPQLLLLYFSLGLISIGAGGIRSSFMAIGVDQLDERNNSHG----FFNW  179

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             Y       ++ +T +VY+Q+N GWK+G+G+ V+ M  +A+ FFL S FY+K
Sbjct  180  CYVTLMFSSLIAVTLIVYIQDNMGWKMGFGVPVMLMFLSAVAFFLPSSFYIK  231



>ref|XP_009774738.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Nicotiana sylvestris]
Length=583

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 132/219 (60%), Gaps = 11/219 (5%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSAS----PKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYH  239
            ME+ G      LV TS       KGG +T+PFI+   AL  + +  L+A+MI YL  EYH
Sbjct  1    MERKGSSSD--LVKTSEDVSNGKKGGLKTMPFIIANEALERLASVGLSANMIMYLKNEYH  58

Query  240  MDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPH  419
            +    G   + +W AI+   P+ GA L+DS +GR+ VI + + I F+GMV+LWL  +I  
Sbjct  59   LTNARGQITLLWWGAISNFTPIFGAFLSDSYLGRYYVIALGTFISFLGMVVLWLTAIIKE  118

Query  420  AKPPPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAG  584
            A+P  C   S +C      QL LL +SF L+++G+GG+  C LAFGADQ+ + +  NN  
Sbjct  119  ARPHRCKLDSGNCQKPDIGQLALLLSSFALMAIGAGGIRPCSLAFGADQVDNPENPNNGR  178

Query  585  AMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGI  701
             ++S+F+WYYA   +  ++ +T +VY+Q   GW +G+G+
Sbjct  179  ILQSFFNWYYASVCISVLIAVTVIVYIQTQFGWVVGFGV  217



>emb|CDP21642.1| unnamed protein product, partial [Coffea canephora]
Length=575

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 144/236 (61%), Gaps = 5/236 (2%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMV  251
            M+   +E+  L  +     KGG +T+PFI+   A   + +  L  +MI YL   YH   V
Sbjct  1    MDINPEEESLLGHSPPRRTKGGLKTMPFIIVNEAFERLASQGLMPNMILYLTRIYHFQTV  60

Query  252  TGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPP  431
            T S++++ W A++  + + GA L+DS +GRF+VI + S    +GM+LLWL  V+P  +P 
Sbjct  61   TASSILFIWSALSNGLALFGAFLSDSYLGRFRVIFLGSFSSLLGMILLWLTAVVPQLQPL  120

Query  432  PCSD---SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMES  596
             C      CS+    Q++ L +SF+L+SVG+G +  C +AFGADQ  + Q  NN   +++
Sbjct  121  SCDQLKHKCSAPNGAQIIPLLSSFLLMSVGAGCIRPCSIAFGADQFDNKQNPNNERVLDT  180

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YF+WYYA   +  V+ +T +VY+Q++ GW +G+GI  + M+F+AL F +GS  YVK
Sbjct  181  YFNWYYASTGISTVLAMTVIVYIQDHLGWSVGFGIPAILMVFSALMFLIGSSLYVK  236



>ref|XP_007150639.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
 gb|ESW22633.1| hypothetical protein PHAVU_005G169300g [Phaseolus vulgaris]
Length=580

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 132/215 (61%), Gaps = 4/215 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGGF T+PFI+   AL  + +  L  +M+ YLM  Y M  V  + +++ W A T   PV 
Sbjct  18   KGGFITMPFIIANEALAKVASVGLVPNMVLYLMEYYRMGAVKATKILFLWSAATNFGPVV  77

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP-PPCSDSCSSATTFQllllc  485
             A  AD+ +GRF  IG+ SI+ F+GMV++WL  +IP A+P    S++C SATT Q +++ 
Sbjct  78   AAFGADAYLGRFVAIGLGSILSFLGMVVMWLTAMIPEARPCRHSSENCKSATTPQ-IIIL  136

Query  486  tsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLV  659
             S   L    GG +SC LAFGADQL  K+   N   +ES+ SWY A   +  V  LT +V
Sbjct  137  LSCFALISIGGGGISCSLAFGADQLSQKNKTKNQRVLESFISWYIASQTIAVVFSLTGIV  196

Query  660  YLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            Y+Q++ GWK+G+G+    MLF+ L FFL SP YVK
Sbjct  197  YIQDHFGWKLGFGVPAALMLFSTLSFFLISPRYVK  231



>ref|XP_004238703.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Solanum lycopersicum]
Length=586

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/231 (36%), Positives = 140/231 (61%), Gaps = 5/231 (2%)
 Frame = +3

Query  87   DEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNL  266
             E++ LL  +  S KGG +T+PFI+   +   + +  L  +MI Y+   Y+++    S L
Sbjct  7    QEEEFLLNHSQNSTKGGLKTIPFIIVNESCERLASFGLQPNMIIYITKFYNINAAHASVL  66

Query  267  IYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---  437
            I  W A++ ++ + GA ++DS +GRF+ + I +I   +GM++LWL T+ P  +P PC   
Sbjct  67   INLWSAVSNVLSILGAFISDSYIGRFRAVAIGTISSLIGMLVLWLTTIFPQLRPLPCGQY  126

Query  438  SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWY  611
               C+  T  QL  +  SF L+S+G+G V  C +A GADQL + +N  N   ++SYFSW+
Sbjct  127  QHDCNGTTAAQLAAILCSFGLISIGAGFVRPCSIALGADQLGNKENLDNERLLDSYFSWF  186

Query  612  YAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YA   +  V+ +T +VY+Q++ GW++G+G+  + M+ +   F +GSP Y+K
Sbjct  187  YASVGVSIVLAVTVIVYIQDHFGWQVGFGVPALLMVLSVSVFLVGSPHYIK  237



>ref|XP_004486755.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Cicer arietinum]
Length=638

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 129/224 (58%), Gaps = 6/224 (3%)
 Frame = +3

Query  108  VTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAI  287
            ++     KGG  T+PFI+   AL  M +  L  +MI YLMG Y + + T + ++    A 
Sbjct  21   ISQPQRSKGGLITMPFIIANEALARMASLGLLPNMILYLMGTYRLHLGTATQILLLSSAA  80

Query  288  TYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSA  458
            +   PV GA LADS +GRF  +G+ S + F+GM LLWL  +I  A PP C   +  C SA
Sbjct  81   SNFTPVVGAFLADSYLGRFMGVGLGSAVSFLGMTLLWLTAMIKQAHPPACIHPTQGCKSA  140

Query  459  TTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALC  632
            T+ Q + +  S   L     G +SC LAFGADQ+  K   NN   +E +FSWYYA   + 
Sbjct  141  TSGQ-MAMLLSAFGLMSIGNGGLSCSLAFGADQVNRKDNPNNHRVLEIFFSWYYAFTTIS  199

Query  633  EVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             ++ L  +VY+Q++ GWKIG+G+    ML + L FFL SP YVK
Sbjct  200  IIIALIGIVYIQDHLGWKIGFGVPAALMLLSTLLFFLASPLYVK  243



>ref|XP_002324231.1| hypothetical protein POPTR_0018s00430g [Populus trichocarpa]
 gb|EEF02796.1| hypothetical protein POPTR_0018s00430g [Populus trichocarpa]
Length=568

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 146/228 (64%), Gaps = 10/228 (4%)
 Frame = +3

Query  96   KPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYF  275
            +PLL    ++ KGG RTLPFI+   A  S+    L  ++I YL  EY +D   G+++++ 
Sbjct  13   EPLL----SNRKGGIRTLPFILANEAFESLANYGLFPNLILYLTREYRIDAAKGAHVLFL  68

Query  276  WYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDS  446
              +     P+ GA LAD+ +GR+++IG   +   +GMVLLWL T  P A+PPPC   S  
Sbjct  69   LSSAINFTPILGAFLADTYVGRYRMIGFGCMASLLGMVLLWL-TTFPEARPPPCVQFSYD  127

Query  447  CSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAI  620
            C SATT QLLLL T+F  L++G+GG+ S  LAFGADQL   +   +A   ES+FSWYY I
Sbjct  128  CKSATTLQLLLLYTAFCFLAIGAGGIRSSSLAFGADQLGTSNSLEHARIRESFFSWYYGI  187

Query  621  FALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             A    +G+T +VY+Q+N GW +G+G+ VV M+ ++L FF+ SP YVK
Sbjct  188  VAASVFLGMTFVVYIQDNIGWMVGFGVPVVLMILSSLSFFVASPSYVK  235



>ref|XP_006355953.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X1 [Solanum tuberosum]
Length=580

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 139/234 (59%), Gaps = 9/234 (4%)
 Frame = +3

Query  78   KMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTG  257
            KMG E +  + T     KGG RT+PFI+   +   + +     ++I YLM  Y+M   TG
Sbjct  4    KMGTESQVEVNTR----KGGLRTMPFIILNESFERIASYGSQTNLIIYLMTYYNMSAATG  59

Query  258  SNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC  437
            ++++  W A++  + + GAI+ADS  GRF  +   +I  F+GMV+LWL ++IP      C
Sbjct  60   TSILGIWGALSSGLAIVGAIIADSYWGRFNAVAYGTIFTFIGMVILWLTSMIPQLTTLAC  119

Query  438  SD---SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYF  602
            S     C+  T FQL +L TSF   S+G+G V  C + FGADQL+   N  N   +ESYF
Sbjct  120  SQFQHVCNGPTAFQLAVLFTSFAFTSIGAGFVRPCSIMFGADQLEQKGNPENKKIVESYF  179

Query  603  SWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +WYYA   +  ++ +T ++Y+Q+  GW+IG+GI V+ M+ +   F +GSP Y+K
Sbjct  180  NWYYASTGVATMIAVTVIIYIQDRFGWQIGFGIPVILMVLSVSTFLIGSPLYIK  233



>gb|KHG18966.1| hypothetical protein F383_07419 [Gossypium arboreum]
Length=577

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 140/232 (60%), Gaps = 8/232 (3%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            ++ G   +P L  TS+  KGGFRTLPFI+   A   +    +  +MI YL  E+ M+  T
Sbjct  6    DEHGKLSEPFL--TSSPSKGGFRTLPFILAMEAFERVAIVGITTNMIVYLTEEFGMETAT  63

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP--  428
             +N+I+ W A T   P+ GA +ADS MG++ +IGI +IIGF+GM+LLW   +IP A+P  
Sbjct  64   AANVIFVWSAATGFTPIIGAFIADSYMGKYPMIGIGTIIGFLGMILLWSTAMIPQARPYC  123

Query  429  PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGAMESYFSW  608
               +  C +    QL+LL  S  L+S+G+GG+ S  +AFG DQL    N+     S+F+W
Sbjct  124  DQFNTICEAPAIPQLVLLYFSLGLISIGAGGIRSPFMAFGVDQLDERNNS----HSFFNW  179

Query  609  YYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             Y       ++ +T +VY+Q+N GWK+G G+ V+ M  +A  FFL S FY+K
Sbjct  180  CYVTLMFSSLIAVTLIVYIQDNMGWKMGLGVPVMLMFLSAFSFFLASSFYIK  231



>gb|KHN16613.1| Putative peptide transporter [Glycine soja]
Length=550

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 135/208 (65%), Gaps = 2/208 (1%)
 Frame = +3

Query  147  LPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILAD  326
            +PFI+       +    L  +MI YL+ EYH D  TG+ +++ W A+T ++P+  A L+D
Sbjct  1    MPFIIANETFEKVAVVGLRVNMILYLLQEYHFDPATGTIIMFLWNALTNLLPIFCAFLSD  60

Query  327  SLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCSSATTFQllllctsfvlls  506
            S +GRF+VI + ++I  VG+V+LWL T+I HA+P   ++ C++ T  QLL+L +S  L++
Sbjct  61   SCLGRFRVIAMGTVIHLVGLVVLWLTTIIRHARPQCDTEPCANPTVPQLLILFSSLTLMA  120

Query  507  vgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAG  680
            +G+ G+ SC LAF ADQ+ + +N  N   M+S+F+WYY   A+   + +  +VY+Q  AG
Sbjct  121  LGASGIRSCTLAFTADQIYNPENPQNERTMKSFFNWYYLSVAISVTISMAFIVYIQVKAG  180

Query  681  WKIGYGIlvvfmlfaalffflGSPFYVK  764
            W +G+GI +  +  +A+ FFLG+  YVK
Sbjct  181  WVVGFGISMGIVSLSAIMFFLGTSIYVK  208



>ref|XP_010519892.1| PREDICTED: protein NRT1/ PTR FAMILY 1.3 [Tarenaya hassleriana]
Length=581

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 130/229 (57%), Gaps = 17/229 (7%)
 Frame = +3

Query  126  PKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPV  305
            PKGGFRT+PFI+G  AL  +    +  +MI Y+  EY M     +N ++ W A T   P+
Sbjct  18   PKGGFRTIPFILGNQALEKVAYYGVIPNMIVYMTREYGMGAAEAANALFLWSAATNFFPL  77

Query  306  TGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDS----CSSATTFQl  473
             GA L+D   GRF V+G+ S I  +GM+LLW  T+ P A+ P C  S    C S T  QL
Sbjct  78   LGAFLSDCYSGRFLVVGLGSSISLLGMLLLWSTTLFPQAR-PQCDKSTTPTCQSTTPDQL  136

Query  474  lllctsfvllsvgsggvvsCMLAFGADQLKHIQNN------------AGAMESYFSWYYA  617
             LL +SF L +VG+GG+ S  LAF ADQLK    +              A+ES F+WYY 
Sbjct  137  FLLYSSFALTAVGAGGIRSSCLAFAADQLKPAAEDDRDKISAGGSIARSALESLFNWYYI  196

Query  618  IFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
               +   +  TCLVY+Q + GWK+G+G+ V  M  + + FF  SPFYVK
Sbjct  197  SIMVASFISQTCLVYIQTSFGWKVGFGVPVAMMALSVVLFFAASPFYVK  245



>emb|CDP03303.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 139/223 (62%), Gaps = 5/223 (2%)
 Frame = +3

Query  108  VTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAI  287
            V   +  KGG  T+PFI+   A   + +  L  +MI YL GEYH D  TG++++++W AI
Sbjct  11   VQQVSKRKGGLITMPFIIANEAFERVASVGLHINMILYLTGEYHFDNATGASILFWWAAI  70

Query  288  TYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSA  458
            +  +P  GA L+DS +GRF+VI + +++  +G   LWL  ++P A+PP C    D+C+  
Sbjct  71   SNFLPTFGAFLSDSYLGRFRVIALGTVVSLLGQAALWLTALLPEARPPHCPHYPDNCAKP  130

Query  459  TTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALC  632
               QL LL ++F L+S+G+GG+  C LAFGADQ  + +N  N   ++S+F+WYYA  A+ 
Sbjct  131  NAGQLALLFSAFALMSIGAGGIRPCSLAFGADQFDNPENPKNQRILQSFFNWYYASVAIS  190

Query  633  EVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYV  761
             ++ +  +VY+Q   GW +G+G+ V  ML + + F LGS  YV
Sbjct  191  VIIAIIVIVYIQNKLGWVLGFGVPVALMLVSTITFLLGSKLYV  233



>ref|XP_006355955.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Solanum tuberosum]
Length=577

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 133/219 (61%), Gaps = 5/219 (2%)
 Frame = +3

Query  123  SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVP  302
            S KGG RT+PFI+   +   + +     ++I YLM  Y+M   TG++++  W A++  + 
Sbjct  12   SRKGGLRTMPFIIVNESFERIASYGSQTNLIIYLMTYYNMSAATGTSILGIWGALSSGLA  71

Query  303  VTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---SCSSATTFQl  473
            + GAI+ADS  GRF  +   +I  F+GMV+LWL ++IP      CS     C+  T FQL
Sbjct  72   IVGAIIADSYWGRFNAVAYGTIFTFIGMVILWLTSMIPQLTTLACSQFQHVCNGPTAFQL  131

Query  474  lllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFSWYYAIFALCEVVGL  647
             +L TSF   S+G+G V  C + FGADQL+   N  N   +ESYF+WYYA   +  ++ +
Sbjct  132  AVLFTSFAFTSIGAGFVRPCSIMFGADQLEQKGNPENKKIVESYFNWYYASTGVATMIAV  191

Query  648  TCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            T ++Y+Q+  GW+IG+GI V+ M+ +   F +GSP Y+K
Sbjct  192  TVIIYIQDRFGWQIGFGIPVILMVLSVSTFLIGSPLYIK  230



>ref|XP_006355954.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X2 [Solanum tuberosum]
Length=579

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 133/219 (61%), Gaps = 5/219 (2%)
 Frame = +3

Query  123  SPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVP  302
            S KGG RT+PFI+   +   + +  L A++I YLM  Y+M    G++++  W A++  + 
Sbjct  12   SRKGGLRTMPFIIVNESFERVASYGLQANLIIYLMTYYNMTAAAGTSILGIWTALSNGLA  71

Query  303  VTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSATTFQl  473
            + GAI++DS  GRF+ + I SI   +GM++LWL  +IP  K  PC      C+  T FQL
Sbjct  72   IVGAIISDSYCGRFKAVVIGSISTLIGMIILWLTAMIPQLKSLPCPKFQHVCNGTTAFQL  131

Query  474  lllctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGL  647
             +L +SF  +SVG+G +  C + FG DQL  K    N   ++SYF+WYYA   +  ++ +
Sbjct  132  AVLFSSFGFMSVGAGFIRPCSIIFGVDQLEKKGKPENKRLVDSYFNWYYASIGVSTILAV  191

Query  648  TCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            T +VY+QE  GWK+G GI V+ M  +   F +GSP+Y+K
Sbjct  192  TTVVYIQERYGWKVGLGIPVILMFLSVSMFLIGSPWYIK  230



>gb|AFK41192.1| unknown [Lotus japonicus]
Length=219

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 118/191 (62%), Gaps = 4/191 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG RT+PFI+    L  +++  +  +MI YL  +YHM +   +N++Y W A++ I+ + 
Sbjct  26   KGGLRTMPFIIVNECLEKVSSYGILPNMILYLRDDYHMPIAKATNVLYTWSAMSNILSIF  85

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCSSATTFQllllct  488
            GA L+DS +GRF VI I S    +G+ +LWL  +IP  +P    + C+SAT  QLLLL  
Sbjct  86   GAFLSDSYLGRFSVIFIGSFSSLLGVTILWLTAMIPVLRPS--CELCNSATATQLLLLFL  143

Query  489  sfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVY  662
            SF L+S+G+G +  C +AFGADQL  K    N   ++SYF+WYY       +V L  + Y
Sbjct  144  SFRLISIGAGCIRPCSIAFGADQLTIKENSKNERLLDSYFNWYYTSIGASTIVALGVITY  203

Query  663  LQENAGWKIGY  695
            +QEN GWK G+
Sbjct  204  IQENLGWKFGF  214



>emb|CDP21169.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 122/195 (63%), Gaps = 4/195 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG +T+PFI+  +A   + +  L  +MI YL   YH +  T S +++ W A++  + + 
Sbjct  20   KGGLKTMPFILVNVAFERLASQGLMPNMILYLTKVYHFETATASTILFIWAALSDGLALF  79

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD--SCSSATTFQllll  482
            GA LADS  G F+VI + S+   +GMV+LWL +++P  KP PC    +CS+    +++ L
Sbjct  80   GAFLADSYFGGFRVIALGSMSSLLGMVILWLTSMVPPLKPLPCDQLHNCSAPNGVRIVSL  139

Query  483  ctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCL  656
             +SF+L+SVG+G +  C +AFGA Q   K   NN   ++SYF+WYYA   +  VV +T +
Sbjct  140  LSSFLLISVGAGCIRPCSIAFGAGQFDNKKNPNNERVIQSYFNWYYASATISTVVAMTVI  199

Query  657  VYLQENAGWKIGYGI  701
            VY+Q+  GW +G+GI
Sbjct  200  VYIQDRLGWSVGFGI  214



>ref|XP_003588616.1| LATD/NIP [Medicago truncatula]
 gb|ACY29538.1| LATD/NIP [Medicago truncatula]
 gb|AES58867.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=591

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 136/219 (62%), Gaps = 8/219 (4%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG RT+PFI+    L  + +  +  +MI YL  +Y+M +   S ++  W A++ ++ + 
Sbjct  28   KGGLRTMPFIIVNECLEKVASYGIMPNMILYLRDDYNMPIAKASYVLSTWSAMSNVLSIF  87

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS--DSCSSATTFQllll  482
            GA L+DS +GRF VI I S    +G+ +LWL  +IP  KP   S  + C+SAT+ Q  +L
Sbjct  88   GAFLSDSYLGRFNVITIGSFSSLLGLTVLWLTAMIPVLKPTCASLFEICNSATSSQQAVL  147

Query  483  ctsfvllsvgsggvvsCMLAFGADQLKHIQNNAGA-----MESYFSWYYAIFALCEVVGL  647
              S  L+S+G+G V  C +AFGA+QL  I+ N+G      ++SYF+WYY   ++  ++ L
Sbjct  148  FLSLGLISIGAGCVRPCSIAFGAEQLT-IKGNSGDGNGRILDSYFNWYYTSISVSTIIAL  206

Query  648  TCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            + + Y+QEN GWKIG+G+  V ML + + F +GSP YVK
Sbjct  207  SVIAYIQENLGWKIGFGVPAVLMLVSVISFIIGSPLYVK  245



>ref|XP_002458529.1| hypothetical protein SORBIDRAFT_03g035260 [Sorghum bicolor]
 gb|EES03649.1| hypothetical protein SORBIDRAFT_03g035260 [Sorghum bicolor]
Length=576

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 126/215 (59%), Gaps = 3/215 (1%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGGFR LPFI     L  +    L  +MI YL  +YH+  VT   +++ W AI+   P+ 
Sbjct  23   KGGFRALPFIFANEMLEKVAGFGLNTNMITYLTDKYHLSTVTSQTMLFVWGAISNFAPIP  82

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS-DSCSSATTFQllllc  485
            GAI+AD  +GRF  + + S+   +GMV LWL   +P A+PPPC+ D C+      L  L 
Sbjct  83   GAIVADMYLGRFMAVALGSVACLIGMVFLWLTATVPGARPPPCNGDQCAPPGARHLAWLL  142

Query  486  tsfvllsvgsggvvsCMLAFGADQL-KH-IQNNAGAMESYFSWYYAIFALCEVVGLTCLV  659
              F  LS+G+GGV  C +AFGADQ  +H  Q     +++YF+ YYA   +  +V +T +V
Sbjct  143  AGFAFLSLGAGGVRPCSMAFGADQFSRHPKQRRLRILQAYFNAYYASIGVAFMVAVTAIV  202

Query  660  YLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YLQ+N  W +G+ + +  ML + + FFLGS  Y+K
Sbjct  203  YLQDNVSWNVGFAVPMGLMLLSTVSFFLGSGLYIK  237



>ref|XP_004238701.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X1 [Solanum lycopersicum]
Length=579

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 131/217 (60%), Gaps = 5/217 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG RT+PFI+   +   + +  L A++I YLM  Y M    G++++  W A++  + + 
Sbjct  14   KGGLRTMPFIIVNESFERVASYGLQANLIIYLMTYYKMTAAAGTSILGIWTALSNGLAIV  73

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPC---SDSCSSATTFQlll  479
            GAI++DS  GRF+ +   SI   +GM++LWL ++IP  K  PC      C+  T  QL +
Sbjct  74   GAIISDSYCGRFKAVAFGSISTLIGMIILWLTSMIPQLKSLPCPQFQHVCNGTTAVQLAV  133

Query  480  lctsfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTC  653
            L +SF  +SVG+G +  C + FGADQL  K    N   ++SYF+WYYA   +  ++ +T 
Sbjct  134  LFSSFGFMSVGAGFIRPCSIMFGADQLEKKGKPENKKLVDSYFNWYYASIGVSTILAVTT  193

Query  654  LVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +VY+QE  GWKIG GI VV M  +   F +GSP+Y+K
Sbjct  194  VVYIQERFGWKIGLGIPVVLMFLSVSMFLIGSPWYIK  230



>ref|XP_009621370.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=560

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 124/195 (64%), Gaps = 6/195 (3%)
 Frame = +3

Query  198  LAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGF  377
            L  +MI YLM  Y++++VT ++++  W A+++ + + GA ++DS  GRF+V+ I SI   
Sbjct  33   LQPNMIIYLMQGYNLEVVTATSILNIWSALSHGLALLGAFVSDSFFGRFRVVAIGSISSL  92

Query  378  VGMVLLWLPTVIPHAKPPPCS----DSCSSATTFQllllctsfvllsvgsggvvsCMLAF  545
             GM +LWL T+IP  +P PC     + C+  T  Q  +L  S  +++VG+G V  C +AF
Sbjct  93   FGMAILWLTTIIPQLRPLPCDQFEINECNRPTPAQFFVLLFSLGIIAVGAGFVRPCSIAF  152

Query  546  GADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfml  719
            GADQL  K   NN   MESYF+WYYA   +  +V  T +VY+Q+  GW++G+GI V+ ML
Sbjct  153  GADQLDNKENTNNNRIMESYFNWYYATIGMSTLVATTLIVYIQDAFGWQVGFGIPVILML  212

Query  720  faalffflGSPFYVK  764
            F+   F LGSP Y+K
Sbjct  213  FSVSAFLLGSPLYIK  227



>ref|XP_002458530.1| hypothetical protein SORBIDRAFT_03g035270 [Sorghum bicolor]
 gb|EES03650.1| hypothetical protein SORBIDRAFT_03g035270 [Sorghum bicolor]
Length=582

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 132/221 (60%), Gaps = 5/221 (2%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            +A  KGG RT+PFI+       + T  L A+MI YL+  Y M     + ++YFW AI+  
Sbjct  14   TARRKGGLRTIPFIISNEIFEKVATFGLTANMILYLIERYLMSSAVATEVLYFWNAISNF  73

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIP-HAKPPPC-SDSCSSATTFQ  470
            +P+ G +LAD  +GRF+VI + S +   GM LL L  ++P + K P C + S      +Q
Sbjct  74   LPIFGGVLADVRLGRFRVIALGSCVSLCGMCLLCLTAILPVYKKTPECAAGSGCVVLPWQ  133

Query  471  llllctsfvllsvgsggvvsCMLAFGADQLKHIQN---NAGAMESYFSWYYAIFALCEVV  641
            L LL TSF L+S+GSGG+  C LAFGADQL    N   N   ++++F+WYY +  L  V 
Sbjct  134  LPLLFTSFALMSLGSGGIRPCTLAFGADQLDKRDNSAKNVRTLQTFFNWYYTVLGLSIVF  193

Query  642  GLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              T +VY+Q+  GW +G+ + VV M+ A   F LGSPFYVK
Sbjct  194  AATVIVYIQQARGWVVGFAVPVVLMVTALTLFLLGSPFYVK  234



>ref|XP_008445026.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]
Length=581

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 137/235 (58%), Gaps = 5/235 (2%)
 Frame = +3

Query  69   IMEKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            + E  G E+ PLL  T    KGG RTLPFI+       + +  L+  MI YL   Y M  
Sbjct  7    VDENRGMEE-PLLSDTD-DGKGGLRTLPFIIANGTFEKVASHGLSPSMILYLTEVYGMKS  64

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
               SN+I+ W A T   P+  A LADS  GRF +I   SI  F+GM +LWL  +IP  +P
Sbjct  65   AHASNVIFLWSAATNFTPIICAFLADSYFGRFSMIAAGSIFSFLGMFVLWLTAIIPQVRP  124

Query  429  --PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KHIQNNAGAMESY  599
                 +  C + +T QLLLL +S+ ++S+GSG + +  LAFGADQL K  ++N+G + SY
Sbjct  125  FCDKINGYCDAPSTPQLLLLYSSYAIMSIGSGCLQASHLAFGADQLYKESKSNSGILNSY  184

Query  600  FSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            F+  Y   A+  ++G++C+VY+Q+  GW IG+G+ V  ML A + F   S  Y+K
Sbjct  185  FNICYISIAVGTLIGMSCIVYIQDRMGWGIGFGVSVALMLLATITFLSASSLYLK  239



>ref|XP_007161541.1| hypothetical protein PHAVU_001G078000g [Phaseolus vulgaris]
 gb|ESW33535.1| hypothetical protein PHAVU_001G078000g [Phaseolus vulgaris]
Length=586

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 130/214 (61%), Gaps = 6/214 (3%)
 Frame = +3

Query  138  FRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVTGAI  317
             RT+PFI+    L  + +  +  +MI YL+  Y M +V G+ ++  W A++ ++ + GA 
Sbjct  29   LRTMPFIIVNECLEKVASYGIMPNMILYLINGYGMAIVEGTKVMNTWSAMSNVLSIFGAF  88

Query  318  LADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSD---SCSSATTFQllllct  488
            L+DS  GRF VI I S    +G+ +LWL  +IP  +   C      CSSAT  QL +L  
Sbjct  89   LSDSYFGRFLVISIGSFSSLLGLTILWLTAMIPGLR-TSCESFMLDCSSATGAQLAVLFI  147

Query  489  sfvllsvgsggvvsCMLAFGADQL--KHIQNNAGAMESYFSWYYAIFALCEVVGLTCLVY  662
            S  L+S+G+G +  C +AFGADQL  +   NN   ++SYF+WYY   AL  V+ L+ +VY
Sbjct  148  SLGLISIGAGCIRPCSIAFGADQLTIRERSNNGRLLDSYFNWYYTSIALSTVLALSVIVY  207

Query  663  LQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            +QEN GWKIG+G+  V M  +A+ F LGSP YVK
Sbjct  208  IQENLGWKIGFGVPAVLMFISAVSFILGSPIYVK  241



>ref|XP_006371707.1| hypothetical protein POPTR_0018s00500g, partial [Populus trichocarpa]
 gb|ERP49504.1| hypothetical protein POPTR_0018s00500g, partial [Populus trichocarpa]
Length=504

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 137/237 (58%), Gaps = 16/237 (7%)
 Frame = +3

Query  72   MEKMGDEQKPLLVTTSAS-PKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDM  248
            ME    E+K +L+       KGG RT+PFI+   A   + +  L  +MI YLM  Y ++ 
Sbjct  1    MENTIAEEKMILIPKDKDRKKGGLRTMPFIIVNEAFERVASYGLMPNMIFYLMNNYRLEA  60

Query  249  VTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP  428
              GS +++ W A++  +   GA L+DS MGR+ VI + S    +GM+LLWL  +IP  +P
Sbjct  61   ANGSTILFLWSAMSNGLSNFGAFLSDSFMGRYLVISLGSFCSLLGMILLWLTAMIPQLQP  120

Query  429  PPC---SDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAME  593
            PPC   +++CSSAT  Q+ +L  SF L+S+G+G +  C  AFGADQL + +  NN   ++
Sbjct  121  PPCDRFTETCSSATAGQMAILFFSFGLISIGAGCIRPCSNAFGADQLDNEENPNNESVLQ  180

Query  594  SYFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
                       L  ++  T +VY+Q+N GWK+G+ +  + M  +AL F +GS  Y+K
Sbjct  181  R----------LSTIIAFTVIVYIQDNLGWKVGFAVPAILMFLSALMFLVGSSQYIK  227



>ref|XP_006364284.1| PREDICTED: probable peptide transporter At1g52190-like [Solanum 
tuberosum]
Length=578

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 135/218 (62%), Gaps = 6/218 (3%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGG +T+PFI+    L  + +  L  +M+ YLM  Y++++VT ++L+  W A+++ + + 
Sbjct  22   KGGLKTMPFIIVNETLEKVASYGLQPNMVIYLMKVYNLEIVTATSLLSLWSALSHGLALL  81

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS----DSCSSATTFQll  476
            GA ++DS +GRF V+ I SI    GM +LWL T++P  +P  C     + C   T  QLL
Sbjct  82   GAFVSDSFLGRFTVVAIGSISSLFGMTILWLTTMVPQLRPSRCDHFEINECDRPTPAQLL  141

Query  477  llctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCEVVGLT  650
            +L  SF  +++G+G V  C +AFGADQL + +  NN   MESYF+WYYA   +  +V  T
Sbjct  142  VLLFSFGTIALGAGFVRPCSIAFGADQLDNKENPNNKRIMESYFNWYYATIGMSTIVATT  201

Query  651  CLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
             +VY+Q+  GW+IG+GI  + M F+   F LGS  Y+K
Sbjct  202  LIVYIQDAFGWRIGFGIPAILMFFSVSAFLLGSSMYIK  239



>ref|XP_004238698.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Solanum lycopersicum]
Length=579

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 137/233 (59%), Gaps = 9/233 (4%)
 Frame = +3

Query  81   MGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGS  260
            MG E +  + T     KGG RT+PFI+   A   + +     ++I YLM  Y+M   TG+
Sbjct  1    MGTESQVEVNTR----KGGLRTMPFIIMNEAFEMIASYGSQTNLIIYLMTYYNMSAATGT  56

Query  261  NLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS  440
            ++I  W A +  + + GAI+AD   GRF  +   +I  F+GMV+LWL ++IP      CS
Sbjct  57   SIIGIWGAFSSGLAIVGAIIADCYWGRFNAVAYGTIFTFIGMVILWLTSMIPQLTTLACS  116

Query  441  D---SCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFS  605
                 C+  T FQL +L +SFV  S+G+G V  C + FGADQL+   N  N   +ESYF+
Sbjct  117  QLQHVCNGPTAFQLAVLFSSFVFTSIGAGFVRPCSIMFGADQLEQKGNPKNEKIIESYFN  176

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            WYYA   +  ++ +T ++Y+Q+  GW++G+G+ V+ M+ +   F +GSP Y+K
Sbjct  177  WYYASTGVSTMIAVTVIIYIQDRYGWQVGFGVPVILMVLSISTFLIGSPLYIK  229



>ref|XP_004970046.1| PREDICTED: probable peptide transporter At1g52190-like isoform 
X3 [Setaria italica]
Length=567

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 126/216 (58%), Gaps = 4/216 (2%)
 Frame = +3

Query  129  KGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYIVPVT  308
            KGGFR LPFI     L  +    L  +MI YL  +YH+  VT   +++ W A +   P+ 
Sbjct  21   KGGFRALPFIFSNEMLEKVAGFGLNTNMITYLTNKYHLSTVTSQTMLFVWSAASNFAPIP  80

Query  309  GAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS--DSCSSATTFQllll  482
            GA++AD  +GRF  + + SI   +G+V LWL   IP A+PPPCS  + C+      L  L
Sbjct  81   GAVVADMYLGRFMAVALGSISCLIGIVFLWLSATIPGARPPPCSSGEHCAPPGARHLAWL  140

Query  483  ctsfvllsvgsggvvsCMLAFGADQL-KH-IQNNAGAMESYFSWYYAIFALCEVVGLTCL  656
               F  LSVG+GGV  C +AFGADQ  +H  +  +  +++YF+ YYA   +   V +T +
Sbjct  141  LAGFAFLSVGAGGVRPCSMAFGADQFSRHPKERRSRILQAYFNAYYASIGVAFSVAVTAI  200

Query  657  VYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            VYLQ+N GW +G+ + +  ML + + FFLGS  Y+K
Sbjct  201  VYLQDNVGWSVGFAVPMGLMLLSTVSFFLGSGLYIK  236



>ref|XP_010920688.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like isoform X1 [Elaeis 
guineensis]
Length=570

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 119/197 (60%), Gaps = 2/197 (1%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            ++  KGG +TLPFI+       ++   + A+M+ YL   YHM    G ++++ + A+  I
Sbjct  7    NSREKGGIKTLPFIMANEIFEKVSGQGVMANMMIYLRDTYHMGAAAGQSVLFIYGAVASI  66

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCSSATTFQll  476
            +PV GA LADS  GR++VI I S+   +G +L+WL  ++P AKPP C+ +C S T  QL 
Sbjct  67   LPVFGAFLADSYCGRYRVILIGSVACLLGTILVWLTAMLPGAKPPACASACQSPTPSQLA  126

Query  477  llctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMESYFSWYYAIFALCEVVGLT  650
            LL   F LL +G GGV  C +AFGADQ    +       +++YF+WYYA      +VG T
Sbjct  127  LLFCGFALLGIGEGGVRPCSIAFGADQFSQRKGPEKQKILQTYFNWYYASVGFSFMVGST  186

Query  651  CLVYLQENAGWKIGYGI  701
             +V +Q++ GWK+GY +
Sbjct  187  VIVAIQDHFGWKVGYAV  203



>dbj|BAK04396.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 133/225 (59%), Gaps = 9/225 (4%)
 Frame = +3

Query  117  SASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGSNLIYFWYAITYI  296
            +A  KGG RT+PFI+       + T  L A+MI YL   Y M   TG+ ++Y W A+T  
Sbjct  15   AARRKGGLRTIPFIISNEIFEKVATYGLHANMIIYLRKRYGMSAATGTMVLYLWTAMTNF  74

Query  297  VPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCSDSCS---SATTF  467
            +P+ GA+L+D  +GRF+VI + S++   GM LL +  ++P  K  P  D  S   S  T 
Sbjct  75   LPIFGAVLSDVFLGRFRVIALGSVVSLSGMCLLLVTAILPVYKKTPGCDPASPKPSGCTM  134

Query  468  ---QllllctsfvllsvgsggvvsCMLAFGADQLKHIQN---NAGAMESYFSWYYAIFAL  629
               Q+ +L TSF+L+S+G+GG+  C LAFGADQL    N   N   ++++F+WYY +  L
Sbjct  135  LPSQMPILFTSFLLMSLGAGGIRPCTLAFGADQLDKRDNSTKNVRRLQTFFNWYYTVLGL  194

Query  630  CEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              V+  T +VY+QE+ GW IG+ + VV M  A   F +GS  Y+K
Sbjct  195  SLVISATVIVYIQEHKGWVIGFAVPVVLMFIALTLFLVGSSLYLK  239



>ref|XP_004238699.1| PREDICTED: protein NRT1/ PTR FAMILY 1.2 isoform X3 [Solanum lycopersicum]
Length=576

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 137/233 (59%), Gaps = 9/233 (4%)
 Frame = +3

Query  81   MGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVTGS  260
            MG E +  + T     KGG RT+PFI+   +   + +     +MI YLM  Y+M   TG+
Sbjct  1    MGTESQAEINTR----KGGLRTMPFIILNESFERIASYGSQTNMIIYLMTYYNMSAATGT  56

Query  261  NLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKPPPCS  440
            ++I  W A++  + + GAI+AD   GR+  +   +I  F+GMV+LWL ++IP      CS
Sbjct  57   SIIGIWGALSSGLAIVGAIIADCYWGRYNAVAYGTIFTFIGMVILWLTSMIPQLTTLACS  116

Query  441  ---DSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQN--NAGAMESYFS  605
                 C+  T FQL +L TSFV  S+G+G V  C + FGADQL+   N  N   +ESYF+
Sbjct  117  HFQHVCNGPTAFQLAVLFTSFVFTSIGAGFVRPCSIMFGADQLEQKGNPENKKIVESYFN  176

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            WYYA   +  ++ +T ++Y+Q+  GW+IG+GI V+ M+ +   F +GS  Y+K
Sbjct  177  WYYASTGVATMIAVTVIIYIQDRYGWQIGFGIPVILMVLSVSTFLIGSSLYIK  229



>gb|KGN62822.1| hypothetical protein Csa_2G374640 [Cucumis sativus]
Length=581

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 141/233 (61%), Gaps = 5/233 (2%)
 Frame = +3

Query  75   EKMGDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHMDMVT  254
            E  G E+ PLL  T    KGG RTLPFI+ + AL  + +  L+  MI YL   Y M  V 
Sbjct  9    ENRGMEE-PLLSGTDDC-KGGIRTLPFIIASGALEKLASMGLSPSMILYLTEVYGMKSVQ  66

Query  255  GSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHAKP--  428
             S++I+ W A TY  P+  A LADS  GRF +I   SI   +GM +LWL  +IP A+P  
Sbjct  67   ASSVIFLWTAATYFTPIICAFLADSYFGRFMMIVAGSIFSCLGMFVLWLTAMIPQARPFC  126

Query  429  PPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQL-KHIQNNAGAMESYFS  605
               S  C++ +T QLL L +S+ ++S+GSG + S   AFGADQL K  ++N+G ++ YF+
Sbjct  127  DEISGHCNAPSTPQLLFLYSSYAIMSIGSGCLQSSNFAFGADQLYKENKSNSGILDIYFN  186

Query  606  WYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
              Y   ++  +VG++C+VY+Q+  GW++G+G+ +  ML A + F   S  Y+K
Sbjct  187  LCYISVSVGTLVGMSCIVYIQDRMGWEMGFGVPIALMLLATVTFLSASSLYLK  239



>ref|XP_008793165.1| PREDICTED: protein NRT1/ PTR FAMILY 1.1-like [Phoenix dactylifera]
Length=610

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 137/236 (58%), Gaps = 9/236 (4%)
 Frame = +3

Query  75   EKM----GDEQKPLLVTTSASPKGGFRTLPFIVGTMALVSMTTSSLAADMIKYLMGEYHM  242
            EKM    G E++          KGG +T+PFI+       ++   +  +M+ YL  EYHM
Sbjct  34   EKMEVSHGQEEQS---QQHTREKGGLKTMPFIIANEVFEKVSGQGVLLNMMIYLRNEYHM  90

Query  243  DMVTGSNLIYFWYAITYIVPVTGAILADSLMGRFQVIGIASIIGFVGMVLLWLPTVIPHA  422
            +  T  ++++   A    +P+ GA L+DS +GRF+VI I S    +G VL+WL  ++P A
Sbjct  91   NAATEQSVLFVRGACASFLPILGAFLSDSYLGRFRVILIGSFACLLGTVLIWLTAMLPGA  150

Query  423  KPPPCSDSCSSATTFQllllctsfvllsvgsggvvsCMLAFGADQLKHIQ--NNAGAMES  596
            +PP C  +C SAT  QL LL ++F  L++G GG++ C LAFGADQ   +        +++
Sbjct  151  RPPACDLACQSATPSQLALLFSAFAFLAIGDGGIMPCSLAFGADQFSRMNGPEKQKILQT  210

Query  597  YFSWYYAIFALCEVVGLTCLVYLQENAGWKIGYGIlvvfmlfaalffflGSPFYVK  764
            YF+WYYA      +V  T +V +Q+N GWK+G+ + +V +L +A+FF   S  Y+K
Sbjct  211  YFNWYYASVGFSFMVASTAVVAIQDNFGWKVGFAVPLVLILLSAVFFAAASSLYIK  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890