BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041M10

Length=803
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP14264.1|  unnamed protein product                                124   1e-31   Coffea canephora [robusta coffee]
ref|XP_011093914.1|  PREDICTED: organic cation/carnitine transpor...    131   2e-31   Sesamum indicum [beniseed]
ref|XP_011093913.1|  PREDICTED: organic cation/carnitine transpor...    131   2e-31   Sesamum indicum [beniseed]
gb|EYU25780.1|  hypothetical protein MIMGU_mgv1a005148mg                130   5e-31   Erythranthe guttata [common monkey flower]
ref|XP_006372262.1|  hypothetical protein POPTR_0018s14760g             129   6e-31   
ref|XP_006425191.1|  hypothetical protein CICLE_v10028224mg             126   2e-30   
ref|XP_006353741.1|  PREDICTED: organic cation/carnitine transpor...    128   2e-30   Solanum tuberosum [potatoes]
ref|XP_006488615.1|  PREDICTED: organic cation/carnitine transpor...    128   3e-30   Citrus sinensis [apfelsine]
ref|XP_010034101.1|  PREDICTED: organic cation/carnitine transpor...    127   3e-30   Eucalyptus grandis [rose gum]
ref|XP_010323959.1|  PREDICTED: organic cation/carnitine transpor...    127   4e-30   Solanum lycopersicum
ref|XP_006453135.1|  hypothetical protein CICLE_v10008131mg             127   4e-30   Citrus clementina [clementine]
ref|XP_006425190.1|  hypothetical protein CICLE_v10028224mg             126   5e-30   
gb|KDO67078.1|  hypothetical protein CISIN_1g010268mg                   126   7e-30   Citrus sinensis [apfelsine]
gb|KDO67076.1|  hypothetical protein CISIN_1g010268mg                   126   9e-30   Citrus sinensis [apfelsine]
ref|XP_006425192.1|  hypothetical protein CICLE_v10028224mg             126   1e-29   Citrus clementina [clementine]
ref|XP_011017563.1|  PREDICTED: organic cation/carnitine transpor...    126   1e-29   Populus euphratica
ref|XP_011017555.1|  PREDICTED: organic cation/carnitine transpor...    126   1e-29   Populus euphratica
ref|XP_009800312.1|  PREDICTED: organic cation/carnitine transpor...    125   1e-29   Nicotiana sylvestris
ref|XP_006453137.1|  hypothetical protein CICLE_v10008136mg             125   1e-29   Citrus clementina [clementine]
ref|XP_008361990.1|  PREDICTED: organic cation/carnitine transpor...    119   3e-29   
gb|AFW68692.1|  hypothetical protein ZEAMMB73_097319                    118   3e-29   
ref|XP_009620262.1|  PREDICTED: organic cation/carnitine transpor...    123   8e-29   Nicotiana tomentosiformis
ref|XP_011093921.1|  PREDICTED: organic cation/carnitine transpor...    123   1e-28   Sesamum indicum [beniseed]
ref|XP_006474361.1|  PREDICTED: organic cation/carnitine transpor...    123   1e-28   Citrus sinensis [apfelsine]
ref|XP_006299899.1|  hypothetical protein CARUB_v10016107mg             123   1e-28   Capsella rubella
ref|XP_007023588.1|  Major facilitator superfamily protein isoform 6    122   1e-28   
ref|NP_187911.1|  nicotinate transporter                                123   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007023583.1|  Major facilitator superfamily protein isoform 1    123   2e-28   
ref|XP_006652797.1|  PREDICTED: organic cation/carnitine transpor...    122   2e-28   Oryza brachyantha
ref|XP_010675318.1|  PREDICTED: organic cation/carnitine transpor...    122   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007023587.1|  Major facilitator superfamily protein isoform 5    122   2e-28   
ref|XP_007023584.1|  Major facilitator superfamily protein isoform 2    122   2e-28   
dbj|BAB02515.1|  transporter-like protein                               122   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001174085.1|  Os04g0609200                                       115   2e-28   
ref|XP_010675316.1|  PREDICTED: organic cation/carnitine transpor...    122   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006407270.1|  hypothetical protein EUTSA_v10020555mg             122   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_011031259.1|  PREDICTED: organic cation/carnitine transpor...    122   4e-28   Populus euphratica
gb|KDO73399.1|  hypothetical protein CISIN_1g011416mg                   121   4e-28   Citrus sinensis [apfelsine]
ref|XP_006453139.1|  hypothetical protein CICLE_v10008130mg             121   4e-28   Citrus clementina [clementine]
ref|XP_002310345.2|  transporter-related family protein                 121   4e-28   
ref|XP_011093916.1|  PREDICTED: organic cation/carnitine transpor...    121   4e-28   Sesamum indicum [beniseed]
ref|XP_009346014.1|  PREDICTED: organic cation/carnitine transpor...    121   4e-28   Pyrus x bretschneideri [bai li]
ref|XP_007014586.1|  Major facilitator superfamily protein, putat...    121   4e-28   
ref|XP_002882803.1|  hypothetical protein ARALYDRAFT_318077             121   5e-28   Arabidopsis lyrata subsp. lyrata
gb|KDO73403.1|  hypothetical protein CISIN_1g011416mg                   121   5e-28   Citrus sinensis [apfelsine]
ref|XP_010240388.1|  PREDICTED: organic cation/carnitine transpor...    121   5e-28   Brachypodium distachyon [annual false brome]
ref|XP_007014587.1|  Major facilitator superfamily protein, putat...    121   5e-28   
ref|XP_002273636.1|  PREDICTED: organic cation/carnitine transpor...    120   8e-28   Vitis vinifera
ref|XP_010278453.1|  PREDICTED: organic cation/carnitine transpor...    120   8e-28   Nelumbo nucifera [Indian lotus]
emb|CAN64534.1|  hypothetical protein VITISV_042940                     120   1e-27   Vitis vinifera
gb|AFW68693.1|  hypothetical protein ZEAMMB73_097319                    113   1e-27   
dbj|BAJ87199.1|  predicted protein                                      120   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009397373.1|  PREDICTED: organic cation/carnitine transpor...    119   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006380837.1|  hypothetical protein POPTR_0007s15120g             119   2e-27   
ref|XP_011031262.1|  PREDICTED: organic cation/carnitine transpor...    120   2e-27   Populus euphratica
ref|XP_010928750.1|  PREDICTED: organic cation/carnitine transpor...    119   2e-27   Elaeis guineensis
ref|XP_007215272.1|  hypothetical protein PRUPE_ppa004702mg             119   3e-27   Prunus persica
ref|XP_006380836.1|  hypothetical protein POPTR_0007s15120g             119   3e-27   
ref|XP_009620247.1|  PREDICTED: organic cation/carnitine transpor...    119   3e-27   Nicotiana tomentosiformis
ref|XP_006380838.1|  hypothetical protein POPTR_0007s15120g             119   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002527821.1|  sugar transporter, putative                        119   3e-27   
ref|XP_006380840.1|  transporter-related family protein                 119   4e-27   
ref|XP_002310344.2|  hypothetical protein POPTR_0007s15120g             120   4e-27   
ref|XP_006585686.1|  PREDICTED: organic cation/carnitine transpor...    119   4e-27   Glycine max [soybeans]
gb|KHN38113.1|  Organic cation/carnitine transporter 7                  118   5e-27   Glycine soja [wild soybean]
gb|KJB68011.1|  hypothetical protein B456_010G222000                    117   5e-27   Gossypium raimondii
ref|XP_008670376.1|  PREDICTED: organic cation/carnitine transpor...    118   5e-27   
emb|CAH67747.1|  H0702G05.6                                             118   6e-27   Oryza sativa [red rice]
ref|XP_010552380.1|  PREDICTED: organic cation/carnitine transpor...    118   6e-27   Tarenaya hassleriana [spider flower]
gb|KJB68008.1|  hypothetical protein B456_010G222000                    118   6e-27   Gossypium raimondii
ref|XP_002460658.1|  hypothetical protein SORBIDRAFT_02g032700          118   6e-27   Sorghum bicolor [broomcorn]
ref|XP_011467508.1|  PREDICTED: organic cation/carnitine transpor...    118   7e-27   Fragaria vesca subsp. vesca
dbj|BAJ96217.1|  predicted protein                                      118   8e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009124704.1|  PREDICTED: organic cation/carnitine transpor...    118   8e-27   Brassica rapa
emb|CDY24225.1|  BnaC01g38050D                                          118   8e-27   Brassica napus [oilseed rape]
ref|XP_010421982.1|  PREDICTED: organic cation/carnitine transpor...    118   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006453149.1|  hypothetical protein CICLE_v10008141mg             117   8e-27   Citrus clementina [clementine]
emb|CDY43379.1|  BnaA01g30100D                                          118   8e-27   Brassica napus [oilseed rape]
ref|XP_010421978.1|  PREDICTED: organic cation/carnitine transpor...    118   9e-27   
gb|EMS56043.1|  Synaptic vesicle 2-related protein                      120   9e-27   Triticum urartu
gb|AFW68691.1|  hypothetical protein ZEAMMB73_097319                    117   9e-27   
ref|XP_010499859.1|  PREDICTED: organic cation/carnitine transpor...    117   9e-27   
ref|XP_002467179.1|  hypothetical protein SORBIDRAFT_01g020990          117   1e-26   
ref|XP_004140724.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-26   Cucumis sativus [cucumbers]
gb|KDO73387.1|  hypothetical protein CISIN_1g015136mg                   117   1e-26   Citrus sinensis [apfelsine]
ref|XP_010465101.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008456184.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-26   Cucumis melo [Oriental melon]
ref|XP_008681209.1|  PREDICTED: uncharacterized protein LOC100193...    117   1e-26   
ref|XP_006660971.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-26   Oryza brachyantha
ref|XP_008348401.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-26   Malus domestica [apple tree]
ref|XP_006660972.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-26   Oryza brachyantha
ref|XP_004983024.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-26   Setaria italica
ref|XP_007135877.1|  hypothetical protein PHAVU_010G165500g             117   2e-26   Phaseolus vulgaris [French bean]
gb|EMT01283.1|  Synaptic vesicle 2-related protein                      119   2e-26   
ref|XP_006582967.1|  PREDICTED: organic cation/carnitine transpor...    117   2e-26   
ref|XP_010928751.1|  PREDICTED: organic cation/carnitine transpor...    116   2e-26   Elaeis guineensis
gb|KDO36515.1|  hypothetical protein CISIN_1g030356mg                   112   2e-26   Citrus sinensis [apfelsine]
gb|KDO73398.1|  hypothetical protein CISIN_1g011416mg                   116   2e-26   Citrus sinensis [apfelsine]
ref|XP_002528039.1|  sugar transporter, putative                        117   2e-26   Ricinus communis
gb|EMT04717.1|  Synaptic vesicle 2-related protein                      117   2e-26   
ref|XP_010696144.1|  PREDICTED: organic cation/carnitine transpor...    116   3e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU21187.1|  hypothetical protein MIMGU_mgv1a005199mg                116   3e-26   Erythranthe guttata [common monkey flower]
ref|XP_002513292.1|  sugar transporter, putative                        116   3e-26   
ref|XP_009135279.1|  PREDICTED: organic cation/carnitine transpor...    116   3e-26   Brassica rapa
ref|NP_001063920.1|  Os09g0559800                                       116   4e-26   
ref|XP_003562867.1|  PREDICTED: organic cation/carnitine transpor...    115   5e-26   Brachypodium distachyon [annual false brome]
emb|CDY51903.1|  BnaC03g73660D                                          115   5e-26   Brassica napus [oilseed rape]
ref|XP_010236648.1|  PREDICTED: organic cation/carnitine transpor...    115   5e-26   Brachypodium distachyon [annual false brome]
emb|CDX82560.1|  BnaA03g32610D                                          117   5e-26   
ref|XP_010542536.1|  PREDICTED: organic cation/carnitine transpor...    115   5e-26   Tarenaya hassleriana [spider flower]
gb|EEC77965.1|  hypothetical protein OsI_17329                          115   7e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_009344025.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    115   7e-26   
gb|KDP45839.1|  hypothetical protein JCGZ_17446                         115   8e-26   Jatropha curcas
ref|XP_004157349.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    115   8e-26   
emb|CAE03655.2|  OSJNBa0060N03.20                                       116   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006453143.1|  hypothetical protein CICLE_v10008092mg             114   9e-26   Citrus clementina [clementine]
gb|EMS63401.1|  Synaptic vesicle 2-related protein                      116   1e-25   Triticum urartu
ref|XP_004507561.1|  PREDICTED: organic cation/carnitine transpor...    115   1e-25   
ref|XP_006374730.1|  hypothetical protein POPTR_0014s00290g             114   1e-25   
ref|XP_010927137.1|  PREDICTED: organic cation/carnitine transpor...    114   2e-25   Elaeis guineensis
ref|XP_008228025.1|  PREDICTED: organic cation/carnitine transpor...    113   3e-25   Prunus mume [ume]
ref|XP_006453144.1|  hypothetical protein CICLE_v10008092mg             113   3e-25   Citrus clementina [clementine]
dbj|BAJ92143.1|  predicted protein                                      113   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009800311.1|  PREDICTED: organic cation/carnitine transpor...    113   3e-25   Nicotiana sylvestris
ref|XP_003604112.1|  Synaptic vesicle 2-related protein                 113   4e-25   Medicago truncatula
gb|KDP25026.1|  hypothetical protein JCGZ_22561                         114   4e-25   Jatropha curcas
ref|XP_008796960.1|  PREDICTED: organic cation/carnitine transpor...    113   4e-25   
gb|KJB23423.1|  hypothetical protein B456_004G097300                    112   4e-25   Gossypium raimondii
tpg|DAA40755.1|  TPA: hypothetical protein ZEAMMB73_392255              113   5e-25   
gb|AFH57281.1|  MFS                                                     112   6e-25   Gossypium hirsutum [American cotton]
ref|XP_010675319.1|  PREDICTED: organic cation/carnitine transpor...    112   8e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB23424.1|  hypothetical protein B456_004G097300                    112   8e-25   Gossypium raimondii
gb|KJB23421.1|  hypothetical protein B456_004G097300                    113   9e-25   Gossypium raimondii
gb|EEC82301.1|  hypothetical protein OsI_26552                          112   9e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001060053.1|  Os07g0571700                                       112   9e-25   
ref|XP_004957629.1|  PREDICTED: organic cation/carnitine transpor...    111   1e-24   Setaria italica
ref|XP_004957627.1|  PREDICTED: organic cation/carnitine transpor...    111   2e-24   
ref|XP_010087072.1|  Organic cation/carnitine transporter 7             110   3e-24   
gb|KJB56470.1|  hypothetical protein B456_009G120800                    110   3e-24   Gossypium raimondii
ref|NP_001168223.1|  hypothetical protein                               110   4e-24   Zea mays [maize]
ref|XP_008668303.1|  PREDICTED: hypothetical protein isoform X1         110   4e-24   Zea mays [maize]
ref|NP_001147918.1|  synaptic vesicle 2-related protein                 108   5e-24   Zea mays [maize]
ref|XP_004983097.1|  PREDICTED: organic cation/carnitine transpor...    110   5e-24   Setaria italica
ref|XP_003578642.1|  PREDICTED: organic cation/carnitine transpor...    110   6e-24   
tpg|DAA46930.1|  TPA: synaptic vesicle 2 protein                        109   6e-24   
ref|XP_008674891.1|  PREDICTED: synaptic vesicle 2-related protei...    109   6e-24   Zea mays [maize]
gb|AAR01731.1|  putative sugar transporter (alternative splicing ...    108   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958090.1|  PREDICTED: organic cation/carnitine transpor...    108   1e-23   
gb|EAY91140.1|  hypothetical protein OsI_12746                          108   1e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001050729.1|  Os03g0638200                                       108   1e-23   
ref|XP_004958088.1|  PREDICTED: organic cation/carnitine transpor...    108   1e-23   Setaria italica
ref|XP_004958089.1|  PREDICTED: organic cation/carnitine transpor...    108   1e-23   
ref|XP_004958087.1|  PREDICTED: organic cation/carnitine transpor...    108   2e-23   
ref|XP_002964441.1|  hypothetical protein SELMODRAFT_81650              108   2e-23   
ref|XP_002975354.1|  hypothetical protein SELMODRAFT_103160             107   3e-23   
ref|XP_003562078.1|  PREDICTED: organic cation/carnitine transpor...    108   3e-23   Brachypodium distachyon [annual false brome]
dbj|BAJ98028.1|  predicted protein                                      105   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006380839.1|  hypothetical protein POPTR_0007s15120g             107   4e-23   
ref|XP_004958086.1|  PREDICTED: organic cation/carnitine transpor...    107   4e-23   Setaria italica
ref|XP_004981616.1|  PREDICTED: organic cation/carnitine transpor...    107   5e-23   Setaria italica
ref|XP_001770703.1|  predicted protein                                  106   9e-23   
ref|XP_004957628.1|  PREDICTED: organic cation/carnitine transpor...    106   1e-22   
ref|XP_006650328.1|  PREDICTED: organic cation/carnitine transpor...    106   1e-22   Oryza brachyantha
dbj|BAK07186.1|  predicted protein                                      106   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006353753.1|  PREDICTED: organic cation/carnitine transpor...    105   2e-22   Solanum tuberosum [potatoes]
ref|XP_004982357.1|  PREDICTED: organic cation/carnitine transpor...    105   2e-22   
ref|XP_004982358.1|  PREDICTED: organic cation/carnitine transpor...    105   3e-22   Setaria italica
emb|CDP14262.1|  unnamed protein product                                105   3e-22   Coffea canephora [robusta coffee]
emb|CDP14260.1|  unnamed protein product                                104   4e-22   Coffea canephora [robusta coffee]
tpg|DAA50363.1|  TPA: hypothetical protein ZEAMMB73_018003              104   5e-22   
gb|EYU25779.1|  hypothetical protein MIMGU_mgv1a0062851mg               103   6e-22   Erythranthe guttata [common monkey flower]
ref|XP_002466771.1|  hypothetical protein SORBIDRAFT_01g013920          103   7e-22   Sorghum bicolor [broomcorn]
ref|XP_003562063.1|  PREDICTED: organic cation/carnitine transpor...    103   7e-22   
ref|XP_004982355.1|  PREDICTED: organic cation/carnitine transpor...    103   8e-22   Setaria italica
ref|XP_006353755.1|  PREDICTED: organic cation/carnitine transpor...    103   1e-21   Solanum tuberosum [potatoes]
ref|XP_005644961.1|  MFS general substrate transporter                  103   1e-21   Coccomyxa subellipsoidea C-169
ref|XP_008680040.1|  PREDICTED: synaptic vesicle 2-related protei...    103   1e-21   
ref|XP_008680034.1|  PREDICTED: synaptic vesicle 2-related protei...    103   1e-21   Zea mays [maize]
ref|NP_001151801.1|  synaptic vesicle 2-related protein                 103   1e-21   
tpg|DAA50366.1|  TPA: hypothetical protein ZEAMMB73_510449            96.3    2e-21   
emb|CDP14261.1|  unnamed protein product                                102   2e-21   Coffea canephora [robusta coffee]
gb|ABF97804.1|  major facilitator superfamily protein, expressed        102   2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006353754.1|  PREDICTED: organic cation/carnitine transpor...    102   2e-21   Solanum tuberosum [potatoes]
ref|XP_004243672.1|  PREDICTED: organic cation/carnitine transpor...    101   4e-21   Solanum lycopersicum
gb|EPS64332.1|  hypothetical protein M569_10450                         101   4e-21   Genlisea aurea
dbj|BAJ87550.1|  predicted protein                                      100   5e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB23415.1|  hypothetical protein B456_004G097400                    101   6e-21   Gossypium raimondii
gb|EMS51638.1|  Synaptic vesicle 2-related protein                      101   6e-21   Triticum urartu
dbj|BAJ90022.1|  predicted protein                                      101   7e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011093922.1|  PREDICTED: organic cation/carnitine transpor...    101   8e-21   Sesamum indicum [beniseed]
ref|XP_011093915.1|  PREDICTED: organic cation/carnitine transpor...    100   2e-20   Sesamum indicum [beniseed]
gb|EMT10389.1|  Synaptic vesicle 2-related protein                      100   2e-20   
ref|XP_011093923.1|  PREDICTED: organic cation/carnitine transpor...  99.8    2e-20   Sesamum indicum [beniseed]
ref|XP_002466770.1|  hypothetical protein SORBIDRAFT_01g013910        99.8    3e-20   Sorghum bicolor [broomcorn]
ref|NP_001106048.1|  major facilitator superfamily protein            99.4    3e-20   Zea mays [maize]
gb|AGX85880.1|  copper transporter                                    99.0    4e-20   Triticum aestivum [Canadian hard winter wheat]
gb|EMT10390.1|  Putative transporter                                  98.2    7e-20   
ref|XP_011093924.1|  PREDICTED: organic cation/carnitine transpor...  98.2    9e-20   Sesamum indicum [beniseed]
gb|AGX85879.1|  copper transporter                                    97.4    1e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011094025.1|  PREDICTED: organic cation/carnitine transpor...  97.4    2e-19   Sesamum indicum [beniseed]
ref|XP_001753056.1|  predicted protein                                96.7    3e-19   
ref|XP_003081589.1|  Synaptic vesicle transporter SVOP and relate...  96.3    1e-18   
emb|CEF99356.1|  Major facilitator superfamily domain, general su...  95.5    1e-18   Ostreococcus tauri
ref|XP_006372273.1|  hypothetical protein POPTR_0018s14860g           94.4    2e-18   
ref|XP_002499721.1|  major facilitator superfamily                    93.6    4e-18   Micromonas commoda
ref|XP_006450736.1|  hypothetical protein CICLE_v10010744mg           85.1    2e-17   
ref|NP_498960.2|  Protein SVOP-1                                      91.7    2e-17   Caenorhabditis elegans [roundworm]
ref|XP_001420126.1|  MFS family transporter: sugar                    91.7    2e-17   Ostreococcus lucimarinus CCE9901
gb|EGT56656.1|  hypothetical protein CAEBREN_14991                    90.9    4e-17   Caenorhabditis brenneri
ref|XP_003093994.1|  hypothetical protein CRE_16352                   90.5    4e-17   Caenorhabditis remanei
ref|XP_005849521.1|  hypothetical protein CHLNCDRAFT_142865           90.5    5e-17   Chlorella variabilis
gb|KDO73388.1|  hypothetical protein CISIN_1g0117562mg                89.7    6e-17   Citrus sinensis [apfelsine]
ref|XP_005089214.1|  PREDICTED: putative transporter ZK637.1-like     88.6    7e-17   
emb|CDJ95219.1|  Major facilitator superfamily MFS-1 domain conta...  85.5    8e-17   Haemonchus contortus [red stomach worm]
ref|XP_002630184.1|  Hypothetical protein CBG00590                    89.0    2e-16   Caenorhabditis briggsae
emb|CAP22038.2|  Protein CBG00590                                     89.0    2e-16   Caenorhabditis briggsae
ref|XP_011093928.1|  PREDICTED: organic cation/carnitine transpor...  88.2    2e-16   Sesamum indicum [beniseed]
gb|KHN77735.1|  Putative transporter                                  84.3    2e-16   Toxocara canis
dbj|GAA47694.1|  putative transporter SVOPL                           89.0    3e-16   Clonorchis sinensis [oriental liver fluke]
ref|XP_011399231.1|  Synaptic vesicle 2-related protein               87.4    4e-16   Auxenochlorella protothecoides
ref|XP_002160694.2|  PREDICTED: synaptic vesicle 2-related protei...  85.9    5e-16   
ref|XP_009857552.1|  PREDICTED: synaptic vesicle 2-related protein    86.3    1e-15   
ref|XP_002679296.1|  predicted protein                                85.9    1e-15   Naegleria gruberi strain NEG-M
emb|CAR63523.1|  putative synaptic vesicle 2-related protein          84.3    5e-15   Angiostrongylus cantonensis
ref|XP_008303324.1|  PREDICTED: synaptic vesicle 2-related protei...  84.3    5e-15   Stegastes partitus
gb|KHN39387.1|  Organic cation/carnitine transporter 7                84.0    5e-15   Glycine soja [wild soybean]
ref|WP_013970067.1|  MFS transporter                                  83.2    9e-15   Treponema caldarium
emb|CEF66864.1|  Synaptic vesicle 2-related protein                   83.6    9e-15   Strongyloides ratti
emb|CBY08424.1|  unnamed protein product                              82.8    1e-14   Oikopleura dioica
ref|XP_011018199.1|  PREDICTED: organic cation/carnitine transpor...  82.0    1e-14   Populus euphratica
emb|CDI99902.1|  synaptic vesicle 2 protein                           82.8    2e-14   
emb|CDS19134.1|  synaptic vesicle 2 protein                           82.4    2e-14   Echinococcus granulosus
gb|AAX26472.2|  SJCHGC03275 protein                                   79.3    2e-14   Schistosoma japonicum
ref|XP_002611883.1|  hypothetical protein BRAFLDRAFT_83090            82.4    3e-14   Branchiostoma floridae
ref|XP_002463060.1|  hypothetical protein SORBIDRAFT_02g036920        81.6    3e-14   
gb|ELU03924.1|  hypothetical protein CAPTEDRAFT_110202                81.3    3e-14   Capitella teleta
ref|XP_010748702.1|  PREDICTED: synaptic vesicle 2-related protei...  82.0    4e-14   
ref|XP_005710322.1|  unnamed protein product                          81.6    4e-14   Chondrus crispus [carageen]
ref|XP_006817913.1|  PREDICTED: synaptic vesicle 2-related protei...  81.3    5e-14   Saccoglossus kowalevskii
ref|XP_010785049.1|  PREDICTED: synaptic vesicle 2-related protei...  81.3    5e-14   Notothenia coriiceps [yellowbelly rockcod]
emb|CCD81671.1|  putative sugar transporter                           81.3    6e-14   Schistosoma mansoni
gb|EFX74666.1|  hypothetical protein DAPPUDRAFT_199755                80.9    7e-14   Daphnia pulex
gb|ELU14236.1|  hypothetical protein CAPTEDRAFT_220893                80.9    7e-14   Capitella teleta
gb|KGB38224.1|  Synaptic vesicle 2-related protein                    80.5    1e-13   Schistosoma haematobium
ref|XP_007510245.1|  predicted protein                                80.1    1e-13   Bathycoccus prasinos
ref|XP_011350681.1|  PREDICTED: synaptic vesicle 2-related protei...  80.1    1e-13   
gb|EEE70213.1|  hypothetical protein OsJ_30325                        79.7    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003453944.1|  PREDICTED: synaptic vesicle 2-related protei...  79.7    2e-13   Oreochromis niloticus
ref|XP_001774058.1|  predicted protein                                79.3    2e-13   
ref|XP_009908006.1|  PREDICTED: synaptic vesicle 2-related protein    79.0    3e-13   Picoides pubescens
ref|XP_008617499.1|  hypothetical protein SDRG_13196                  79.0    3e-13   Saprolegnia diclina VS20
gb|KDO33549.1|  hypothetical protein SPRG_19183                       78.6    3e-13   Saprolegnia parasitica CBS 223.65
gb|EMT32918.1|  hypothetical protein F775_22612                       72.4    4e-13   
ref|XP_006108857.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    4e-13   
ref|XP_008864229.1|  hypothetical protein H310_02476                  78.6    4e-13   Aphanomyces invadans
gb|KFM60807.1|  Synaptic vesicle 2-related protein                    75.1    4e-13   Stegodyphus mimosarum
gb|EFN61924.1|  Synaptic vesicle 2-related protein                    79.0    4e-13   Camponotus floridanus
ref|XP_007058393.1|  PREDICTED: synaptic vesicle 2-related protein    78.6    4e-13   Chelonia mydas [green seaturtle]
ref|XP_011049841.1|  PREDICTED: synaptic vesicle 2-related protei...  78.6    4e-13   Acromyrmex echinatior
ref|XP_010179449.1|  PREDICTED: synaptic vesicle 2-related protein    76.3    4e-13   Mesitornis unicolor
ref|XP_004416251.1|  PREDICTED: synaptic vesicle 2-related protein    78.6    5e-13   Odobenus rosmarus divergens
ref|XP_011265694.1|  PREDICTED: synaptic vesicle 2-related protei...  78.6    5e-13   Camponotus floridanus
ref|XP_011444448.1|  PREDICTED: synaptic vesicle 2-related protei...  78.6    5e-13   Crassostrea gigas
ref|XP_011175088.1|  PREDICTED: synaptic vesicle 2-related protei...  78.2    5e-13   Solenopsis invicta [imported red fire ant]
ref|XP_008123509.1|  PREDICTED: synaptic vesicle 2-related protein    78.6    5e-13   Anolis carolinensis [Carolina anole]
gb|EKC38221.1|  Synaptic vesicle 2-related protein                    78.2    5e-13   Crassostrea gigas
ref|XP_001943712.1|  PREDICTED: synaptic vesicle glycoprotein 2B-...  78.2    6e-13   Acyrthosiphon pisum
ref|XP_011049843.1|  PREDICTED: synaptic vesicle 2-related protei...  77.8    6e-13   Acromyrmex echinatior
ref|XP_011175090.1|  PREDICTED: synaptic vesicle 2-related protei...  77.8    6e-13   Solenopsis invicta [imported red fire ant]
ref|XP_009911644.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    6e-13   Haliaeetus albicilla
ref|XP_011265695.1|  PREDICTED: synaptic vesicle 2-related protei...  77.8    6e-13   Camponotus floridanus
gb|ERE75203.1|  synaptic vesicle 2-related protein                    77.8    6e-13   Cricetulus griseus [Chinese hamsters]
ref|XP_004910674.1|  PREDICTED: synaptic vesicle 2-related protei...  77.8    7e-13   
ref|NP_001089190.1|  synaptic vesicle 2-related protein               77.8    7e-13   Xenopus laevis [clawed frog]
ref|XP_005165254.1|  PREDICTED: synaptic vesicle 2-related protein    77.8    7e-13   Danio rerio [leopard danio]
ref|XP_011193688.1|  PREDICTED: synaptic vesicle 2-related protein    73.9    7e-13   
ref|XP_005298618.1|  PREDICTED: synaptic vesicle 2-related protein    77.8    7e-13   
ref|XP_006126810.1|  PREDICTED: synaptic vesicle 2-related protein    77.8    8e-13   
ref|XP_002932106.1|  PREDICTED: synaptic vesicle 2-related protei...  77.8    8e-13   Xenopus tropicalis [western clawed frog]
ref|XP_006015213.1|  PREDICTED: synaptic vesicle 2-related protein    77.8    8e-13   
ref|XP_005735409.1|  PREDICTED: synaptic vesicle 2-related protei...  77.0    9e-13   
ref|XP_009681290.1|  PREDICTED: synaptic vesicle 2-related protein    77.8    9e-13   
ref|XP_010017386.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    9e-13   
ref|XP_009634448.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    9e-13   
ref|XP_415186.4|  PREDICTED: synaptic vesicle 2-related protein       77.4    1e-12   
ref|XP_005934745.1|  PREDICTED: synaptic vesicle 2-related protei...  77.4    1e-12   
gb|KFM10630.1|  Synaptic vesicle 2-related protein                    77.4    1e-12   
ref|XP_009511848.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_004538167.1|  PREDICTED: synaptic vesicle 2-related protei...  77.4    1e-12   
ref|XP_010283868.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_010160359.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_004470240.1|  PREDICTED: synaptic vesicle 2-related protei...  77.4    1e-12   
ref|XP_009878616.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_009470696.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_005236584.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_007900059.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_009989228.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_009282123.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_007129553.1|  PREDICTED: synaptic vesicle 2-related protei...  76.3    1e-12   
ref|XP_009577486.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_009947822.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_009480447.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_004470242.1|  PREDICTED: synaptic vesicle 2-related protei...  77.4    1e-12   
ref|XP_010580381.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_010148122.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_004470243.1|  PREDICTED: synaptic vesicle 2-related protei...  77.4    1e-12   
ref|XP_008847180.1|  PREDICTED: synaptic vesicle 2-related protei...  77.0    1e-12   
ref|XP_010718511.1|  PREDICTED: synaptic vesicle 2-related protei...  77.4    1e-12   
ref|XP_007238331.1|  PREDICTED: synaptic vesicle 2-related protei...  77.0    1e-12   
ref|XP_004065248.1|  PREDICTED: synaptic vesicle 2-related protei...  71.6    1e-12   
ref|XP_007665726.1|  PREDICTED: synaptic vesicle 2-related protein    77.4    1e-12   
ref|XP_006788935.1|  PREDICTED: synaptic vesicle 2-related protei...  77.0    1e-12   
gb|EMS60580.1|  Synaptic vesicle 2-related protein                    76.6    1e-12   
ref|XP_009869278.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    1e-12   
ref|XP_003779832.1|  PREDICTED: synaptic vesicle 2-related protei...  73.2    1e-12   
ref|XP_005145227.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    1e-12   
ref|XP_003690624.1|  PREDICTED: synaptic vesicle 2-related protei...  73.2    1e-12   
ref|XP_006044909.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    1e-12   
ref|XP_008946847.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    1e-12   
ref|XP_010079614.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    1e-12   
gb|EGW10625.1|  Synaptic vesicle 2-related protein                    77.0    2e-12   
ref|XP_010118777.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    2e-12   
ref|XP_005344309.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    2e-12   
ref|XP_010214474.1|  PREDICTED: synaptic vesicle 2-related protein    77.0    2e-12   
ref|XP_001375819.2|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
dbj|BAC33150.1|  unnamed protein product                              77.0    2e-12   
ref|XP_008847179.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
ref|XP_008492065.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_010198099.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_005795055.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
ref|XP_008767538.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
ref|XP_010303917.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_009964445.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|NP_599231.2|  synaptic vesicle 2-related protein                  76.6    2e-12   
ref|XP_003761187.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_009706331.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_006994018.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_005498371.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_007607222.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
ref|XP_008767537.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
ref|XP_006530518.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
ref|XP_003503576.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
gb|AAH59878.1|  SV2 related protein                                   76.6    2e-12   
ref|NP_081081.1|  synaptic vesicle 2-related protein                  76.6    2e-12   
ref|XP_002425260.1|  sugar transporter, putative                      76.6    2e-12   
ref|XP_009935570.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_008252123.1|  PREDICTED: synaptic vesicle 2-related protei...  71.2    2e-12   
ref|XP_010144171.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_005078990.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_005424161.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_002193955.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_008924941.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|WP_011564841.1|  MFS transporter                                  76.3    2e-12   
ref|XP_009558785.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_005495138.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_308210.3|  AGAP007660-PA                                       76.3    2e-12   
ref|XP_009839190.1|  hypothetical protein H257_13390                  76.3    2e-12   
ref|XP_009995142.1|  PREDICTED: synaptic vesicle 2-related protein    76.6    2e-12   
ref|XP_005108026.1|  PREDICTED: synaptic vesicle 2-related protei...  76.6    2e-12   
gb|KFB36629.1|  AGAP007660-PA-like protein                            76.3    2e-12   
emb|CAG08509.1|  unnamed protein product                              76.6    2e-12   
emb|CDQ62775.1|  unnamed protein product                              73.2    2e-12   
ref|XP_004664061.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    2e-12   
ref|XP_008067596.1|  PREDICTED: synaptic vesicle 2-related protei...  76.3    2e-12   
ref|XP_005909609.1|  PREDICTED: synaptic vesicle 2-related protei...  76.3    2e-12   
ref|XP_006894890.1|  PREDICTED: synaptic vesicle 2-related protei...  76.3    2e-12   
ref|XP_004538168.1|  PREDICTED: synaptic vesicle 2-related protei...  76.3    2e-12   
ref|XP_005026430.1|  PREDICTED: synaptic vesicle 2-related protein    76.3    2e-12   
ref|XP_001633415.1|  predicted protein                                75.9    3e-12   
ref|XP_002114163.1|  hypothetical protein TRIADDRAFT_28017            75.9    3e-12   
ref|XP_008705855.1|  PREDICTED: synaptic vesicle 2-related protein    76.3    3e-12   
ref|XP_004544629.1|  PREDICTED: synaptic vesicle 2-related protei...  76.3    3e-12   
ref|XP_004379050.1|  PREDICTED: synaptic vesicle 2-related protein    76.3    3e-12   
ref|XP_008067595.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_004709698.1|  PREDICTED: synaptic vesicle 2-related protein    76.3    3e-12   
ref|XP_006044907.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_003451772.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_002921288.2|  PREDICTED: synaptic vesicle 2-related protein    76.3    3e-12   
ref|XP_011286165.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_007559205.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_008067594.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_006870494.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_004843688.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_004882437.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_004636330.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_543442.3|  PREDICTED: synaptic vesicle 2-related protein       75.9    3e-12   
ref|XP_005722239.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_010597216.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_003477992.2|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_006640277.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_004072648.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_005722238.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_005916416.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_006151557.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_004779154.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_007180144.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_008002798.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_008067593.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_004281425.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_011477471.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_010396800.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_008247564.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_010961860.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_008568013.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_005524364.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_001497016.2|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_006204815.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_009090654.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_010358826.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_008519157.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|NP_001126685.1|  synaptic vesicle 2-related protein               75.9    3e-12   
ref|XP_004591974.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|NP_001253147.1|  synaptic vesicle 2-related protein               75.9    3e-12   
ref|XP_004429927.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_004017488.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_003932327.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|NP_001068909.1|  synaptic vesicle 2-related protein               75.9    3e-12   
ref|XP_005055090.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    3e-12   
ref|XP_008632413.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    3e-12   
ref|XP_006176214.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|NP_061181.1|  synaptic vesicle 2-related protein                  75.9    4e-12   
ref|XP_003789934.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_011376135.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_003832564.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_008002799.1|  PREDICTED: synaptic vesicle 2-related protei...  75.5    4e-12   
ref|XP_010751758.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_004691015.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_008416896.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_007092391.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_005670798.1|  PREDICTED: synaptic vesicle 2-related protei...  75.9    4e-12   
ref|XP_004615651.1|  PREDICTED: synaptic vesicle 2-related protein    75.9    4e-12   
ref|XP_002753021.2|  PREDICTED: synaptic vesicle 2-related protein    75.5    4e-12   
ref|XP_010602311.1|  PREDICTED: synaptic vesicle 2-related protein    75.5    4e-12   
gb|ETN63555.1|  SVOP protein                                          75.5    4e-12   
gb|EHJ69047.1|  putative sugar transporter                            75.5    4e-12   
ref|XP_008274801.1|  PREDICTED: synaptic vesicle 2-related protein    75.5    4e-12   
ref|XP_010826979.1|  PREDICTED: LOW QUALITY PROTEIN: synaptic ves...  75.5    4e-12   
ref|XP_010894684.1|  PREDICTED: synaptic vesicle 2-related protein    75.5    4e-12   
ref|XP_005691648.1|  PREDICTED: synaptic vesicle 2-related protein    75.5    4e-12   
ref|XP_006922241.1|  PREDICTED: synaptic vesicle 2-related protein    75.5    4e-12   
ref|XP_005670799.1|  PREDICTED: synaptic vesicle 2-related protei...  75.5    4e-12   
ref|XP_003269777.2|  PREDICTED: synaptic vesicle 2-related protein    75.5    4e-12   
ref|XP_003967643.1|  PREDICTED: synaptic vesicle glycoprotein 2C-...  75.5    4e-12   
ref|XP_002676781.1|  predicted protein                                75.5    4e-12   
ref|XP_005869857.1|  PREDICTED: synaptic vesicle 2-related protein    75.5    5e-12   
ref|XP_006762091.1|  PREDICTED: synaptic vesicle 2-related protein    75.5    5e-12   
ref|XP_011136116.1|  PREDICTED: synaptic vesicle 2-related protei...  75.1    5e-12   
ref|XP_008140731.1|  PREDICTED: synaptic vesicle 2-related protein    75.1    5e-12   
ref|XP_006562025.1|  PREDICTED: synaptic vesicle 2-related protei...  73.6    5e-12   
gb|ACT64461.1|  SV2 related protein homolog (rat) protein             75.1    5e-12   
ref|XP_009064614.1|  hypothetical protein LOTGIDRAFT_131851           75.1    5e-12   
emb|CDQ66364.1|  unnamed protein product                              75.1    6e-12   
ref|XP_003975025.1|  PREDICTED: synaptic vesicle 2-related protei...  75.1    6e-12   
ref|XP_009072196.1|  PREDICTED: synaptic vesicle 2-related protein    75.1    6e-12   
ref|XP_008324070.1|  PREDICTED: synaptic vesicle 2-related protei...  75.1    7e-12   
ref|XP_011136117.1|  PREDICTED: synaptic vesicle 2-related protei...  74.7    7e-12   
gb|ENN74628.1|  hypothetical protein YQE_08748                        74.3    7e-12   
ref|XP_007525360.1|  PREDICTED: synaptic vesicle 2-related protein    75.1    7e-12   
ref|XP_004522740.1|  PREDICTED: synaptic vesicle 2-related protei...  74.3    8e-12   
gb|EFX80350.1|  hypothetical protein DAPPUDRAFT_304078                74.7    9e-12   
ref|XP_007437498.1|  PREDICTED: synaptic vesicle 2-related protein    74.7    9e-12   
ref|XP_001861512.1|  SVOP protein                                     74.3    9e-12   
ref|XP_011480118.1|  PREDICTED: synaptic vesicle 2-related protei...  74.3    9e-12   
ref|XP_004074970.1|  PREDICTED: synaptic vesicle 2-related protei...  74.3    9e-12   
ref|XP_008333775.1|  PREDICTED: synaptic vesicle 2-related protein    74.3    1e-11   
ref|XP_001663679.1|  AAEL013489-PA                                    74.3    1e-11   
ref|XP_004522739.1|  PREDICTED: synaptic vesicle 2-related protei...  73.9    1e-11   
ref|XP_010788755.1|  PREDICTED: synaptic vesicle 2-related protein    73.9    1e-11   
gb|EDL19926.1|  SV2 related protein, isoform CRA_a                    73.9    1e-11   
ref|XP_001605270.1|  PREDICTED: synaptic vesicle 2-related protei...  73.9    1e-11   
ref|XP_011477470.1|  PREDICTED: synaptic vesicle 2-related protei...  73.9    1e-11   
gb|KFQ53756.1|  Synaptic vesicle 2-related protein                    73.6    2e-11   
ref|XP_003485871.1|  PREDICTED: synaptic vesicle 2-related protei...  73.6    2e-11   
ref|XP_003397461.1|  PREDICTED: synaptic vesicle 2-related protei...  73.6    2e-11   
gb|ABF45622.1|  major facilitator superfamily MFS_1                   73.6    2e-11   
ref|WP_041221172.1|  sugar transporter                                73.2    2e-11   
gb|EFA03313.1|  hypothetical protein TcasGA2_TC013255                 73.6    2e-11   
gb|ADE77746.1|  unknown                                               70.9    2e-11   
ref|XP_008193981.1|  PREDICTED: synaptic vesicle 2-related protein    73.6    2e-11   
ref|XP_001945003.1|  PREDICTED: synaptic vesicle 2-related protein    73.2    2e-11   
ref|XP_003699409.1|  PREDICTED: synaptic vesicle 2-related protei...  73.2    2e-11   
gb|EFX80573.1|  hypothetical protein DAPPUDRAFT_304079                73.2    2e-11   
emb|CDQ60937.1|  unnamed protein product                              73.2    3e-11   
ref|XP_005340182.1|  PREDICTED: synaptic vesicle 2-related protein    73.2    3e-11   
ref|XP_011506445.1|  PREDICTED: synaptic vesicle 2-related protein    73.2    3e-11   
ref|WP_025132831.1|  hypothetical protein                             71.2    3e-11   
ref|XP_009179916.1|  PREDICTED: synaptic vesicle 2-related protein    73.2    3e-11   
ref|XP_009438782.1|  PREDICTED: synaptic vesicle 2-related protein    72.8    3e-11   
gb|EAW97841.1|  SV2 related protein homolog (rat), isoform CRA_c      72.8    3e-11   
ref|XP_004927223.1|  PREDICTED: synaptic vesicle 2-related protei...  72.8    3e-11   
ref|XP_008483746.1|  PREDICTED: synaptic vesicle 2-related protei...  72.4    3e-11   
gb|KDR17464.1|  Synaptic vesicle 2-related protein                    72.8    4e-11   
gb|ETE73004.1|  putative transporter SVOPL                            68.6    4e-11   
ref|WP_043801844.1|  sugar transporter                                72.4    4e-11   
ref|XP_007180145.1|  PREDICTED: synaptic vesicle 2-related protei...  72.4    4e-11   
gb|EAW97840.1|  SV2 related protein homolog (rat), isoform CRA_b      72.4    5e-11   
ref|XP_006609504.1|  PREDICTED: synaptic vesicle 2-related protei...  72.4    5e-11   
ref|XP_003723431.1|  PREDICTED: synaptic vesicle glycoprotein 2C-...  72.4    5e-11   
ref|XP_787750.2|  PREDICTED: synaptic vesicle glycoprotein 2C-lik...  72.0    5e-11   
ref|XP_002118085.1|  hypothetical protein TRIADDRAFT_33661            71.6    7e-11   



>emb|CDP14264.1| unnamed protein product [Coffea canephora]
Length=109

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEALS   FGRFQ  VL YAGLG + +AMEVM+LSF+GP+VK  W LS+A+E LITT
Sbjct  17   YTLDEALSVVGFGRFQVLVLCYAGLGSIAEAMEVMILSFVGPAVKSQWELSSAQESLITT  76

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGML+GAYSWG++SDN+GRR
Sbjct  77   VVFAGMLVGAYSWGIISDNYGRR  99



>ref|XP_011093914.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Sesamum indicum]
Length=495

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D  + Y+IDEAL+   FGRFQ  VLAYAGLG + +AMEVM+LSFIGPSVK  WGLS+ +
Sbjct  13   NDEELVYTIDEALTVLGFGRFQALVLAYAGLGAMAEAMEVMILSFIGPSVKAEWGLSSGQ  72

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
            E LITTVVFAGMLIGAY+WG++SDN+GRR+
Sbjct  73   ESLITTVVFAGMLIGAYAWGIISDNYGRRM  102



>ref|XP_011093913.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
Length=496

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D  + Y+IDEAL+   FGRFQ  VLAYAGLG + +AMEVM+LSFIGPSVK  WGLS+ +
Sbjct  14   NDEELVYTIDEALTVLGFGRFQALVLAYAGLGAMAEAMEVMILSFIGPSVKAEWGLSSGQ  73

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
            E LITTVVFAGMLIGAY+WG++SDN+GRR+
Sbjct  74   ESLITTVVFAGMLIGAYAWGIISDNYGRRM  103



>gb|EYU25780.1| hypothetical protein MIMGU_mgv1a005148mg [Erythranthe guttata]
Length=495

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  348  GGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSA  527
            G DD  + Y++DEA++   FG+FQ  VL YAGLG + +AMEVM+LSFIGPSVK  WGLS+
Sbjct  16   GSDDVELVYTLDEAITVVGFGKFQALVLTYAGLGAMAEAMEVMILSFIGPSVKSEWGLSS  75

Query  528  AEEGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
             +E L+TTVVFAGML+GAYSWGLL+DN+GRR+
Sbjct  76   GQESLLTTVVFAGMLVGAYSWGLLADNYGRRM  107



>ref|XP_006372262.1| hypothetical protein POPTR_0018s14760g [Populus trichocarpa]
 gb|ERP50059.1| hypothetical protein POPTR_0018s14760g [Populus trichocarpa]
Length=507

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  348  GGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSA  527
            G DD    Y++DEAL+   FG+FQ  VLAYAGLG+  +AME+MLLSF+GP+VK  WGLS+
Sbjct  14   GMDDEAPAYTLDEALACLGFGKFQGLVLAYAGLGWFAEAMELMLLSFVGPTVKSQWGLSS  73

Query  528  AEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             +E L++TVVFAGML+GAYSWGL+SDN GRR A  FS
Sbjct  74   GQESLLSTVVFAGMLVGAYSWGLVSDNCGRRQAIHFS  110



>ref|XP_006425191.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
 gb|ESR38431.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
Length=314

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            G+  DD    Y++DEA+    FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+ LW L
Sbjct  2    GIKSDDEKQTYTVDEAIVTMGFGKFQLCVLAYAGMGWISEAMEMMLLSFVGPAVQSLWHL  61

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            S  +E LIT+VVFAGML+GAYSWG++SDNFGRR  F
Sbjct  62   SPNQESLITSVVFAGMLVGAYSWGIVSDNFGRRKGF  97



>ref|XP_006353741.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=481

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  330  PQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKV  509
            PQ   +  D+    Y++DEAL+A  FG+FQY VL YAGLG +VDA+EVM+LSFIGP+VK 
Sbjct  3    PQQQQVEEDEH--VYTLDEALTALGFGKFQYLVLGYAGLGSMVDAVEVMILSFIGPAVKS  60

Query  510  LWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
             WGLS+ +E LITTVVFAGMLIGAY WG+L+DN+GRR
Sbjct  61   QWGLSSTQETLITTVVFAGMLIGAYFWGILADNYGRR  97



>ref|XP_006488615.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus 
sinensis]
Length=514

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            G+  DD    Y++DEA+    FG+FQ+ VLAYAG+G++ +AME+MLLSF+GP+V+ LW L
Sbjct  2    GIKSDDEKQTYTVDEAIVTMGFGKFQFCVLAYAGMGWISEAMEMMLLSFVGPAVQSLWHL  61

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            S  +E LIT+VVFAGML+GAYSWG++SDNFGRR  F
Sbjct  62   SPNQESLITSVVFAGMLVGAYSWGIVSDNFGRRKGF  97



>ref|XP_010034101.1| PREDICTED: organic cation/carnitine transporter 7 [Eucalyptus 
grandis]
 gb|KCW54001.1| hypothetical protein EUGRSUZ_J03196 [Eucalyptus grandis]
 gb|KCW54002.1| hypothetical protein EUGRSUZ_J03196 [Eucalyptus grandis]
Length=497

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  345  LGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLS  524
            +G  D    Y++DEAL A  FG+FQ  VLAYAG+G++ +AMEVMLLSFIGP+V+ LWGLS
Sbjct  1    MGDGDPPATYTVDEALVALGFGKFQLLVLAYAGMGWVSEAMEVMLLSFIGPAVQSLWGLS  60

Query  525  AAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            A EE LIT+VVFAGML+GAYSWG++SD  GRR  F
Sbjct  61   AREESLITSVVFAGMLVGAYSWGIVSDKHGRRKGF  95



>ref|XP_010323959.1| PREDICTED: organic cation/carnitine transporter 7 [Solanum lycopersicum]
Length=482

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+A  FG+FQY VL YAGLG +VDA+EVM+LSFIGP+VK  WGLS+ +E LITT
Sbjct  16   YTLDEALTALGFGKFQYLVLCYAGLGSMVDAVEVMILSFIGPAVKSQWGLSSTQETLITT  75

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGMLIGAY WG+L+DN+GRR
Sbjct  76   VVFAGMLIGAYFWGILADNYGRR  98



>ref|XP_006453135.1| hypothetical protein CICLE_v10008131mg [Citrus clementina]
 ref|XP_006474364.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus 
sinensis]
 gb|ESR66375.1| hypothetical protein CICLE_v10008131mg [Citrus clementina]
Length=485

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            GD+  VY ++DEALSA  FG++Q  VLAYAGLG++ +AME+M+LSF+GP+VK  W L+++
Sbjct  2    GDERPVY-TLDEALSALRFGKYQALVLAYAGLGWVSEAMEIMILSFVGPAVKSKWKLTSS  60

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            EE L+TTVVFAGML+GAYSWG++SDN+GRR +F
Sbjct  61   EESLLTTVVFAGMLLGAYSWGIISDNYGRRKSF  93



>ref|XP_006425190.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
 gb|ESR38430.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
Length=377

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            G+  DD    Y++DEA+    FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+ LW L
Sbjct  2    GIKSDDEKQTYTVDEAIVTMGFGKFQLCVLAYAGMGWISEAMEMMLLSFVGPAVQSLWHL  61

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            S  +E LIT+VVFAGML+GAYSWG++SDNFGRR  F
Sbjct  62   SPNQESLITSVVFAGMLVGAYSWGIVSDNFGRRKGF  97



>gb|KDO67078.1| hypothetical protein CISIN_1g010268mg [Citrus sinensis]
Length=439

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            G+  DD    Y++DEA+    FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+ LW L
Sbjct  2    GIKSDDEKQTYTVDEAIVTMGFGKFQLCVLAYAGMGWISEAMEMMLLSFVGPAVQSLWHL  61

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            S  +E LIT+VVFAGML+GAYSWG++SDNFGRR  F
Sbjct  62   SPNQESLITSVVFAGMLVGAYSWGIVSDNFGRRKGF  97



>gb|KDO67076.1| hypothetical protein CISIN_1g010268mg [Citrus sinensis]
Length=514

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            G+  DD    Y++DEA+    FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+ LW L
Sbjct  2    GIKSDDEKQTYTVDEAIVTMGFGKFQLCVLAYAGMGWISEAMEMMLLSFVGPAVQSLWHL  61

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            S  +E LIT+VVFAGML+GAYSWG++SDNFGRR  F
Sbjct  62   SPNQESLITSVVFAGMLVGAYSWGIVSDNFGRRKGF  97



>ref|XP_006425192.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
 gb|ESR38432.1| hypothetical protein CICLE_v10028224mg [Citrus clementina]
Length=514

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            G+  DD    Y++DEA+    FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+ LW L
Sbjct  2    GIKSDDEKQTYTVDEAIVTMGFGKFQLCVLAYAGMGWISEAMEMMLLSFVGPAVQSLWHL  61

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            S  +E LIT+VVFAGML+GAYSWG++SDNFGRR  F
Sbjct  62   SPNQESLITSVVFAGMLVGAYSWGIVSDNFGRRKGF  97



>ref|XP_011017563.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017564.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017565.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017566.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017567.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
 ref|XP_011017568.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=507

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  348  GGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSA  527
            G DD    Y++DEAL+   FG+FQ  VLAYAGLG+  +AME+MLLSF+GP+VK  WGLS+
Sbjct  14   GMDDEAPAYTLDEALACLGFGKFQGLVLAYAGLGWFAEAMELMLLSFVGPTVKSQWGLSS  73

Query  528  AEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             +E L++TVVFAGML+GAYSWGL+SDN GRR  F
Sbjct  74   GQESLLSTVVFAGMLVGAYSWGLVSDNCGRRKGF  107



>ref|XP_011017555.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=510

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  291  NVFSMIDVEDVVPPQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAME  470
            N   ++D E  +P  +     D+  + Y++D+AL++A FG+FQ+ VLAYAGLG+  +AME
Sbjct  4    NYQPVVDDETSIPTSSSSRMDDEDQLVYTLDDALASAGFGKFQFLVLAYAGLGWFAEAME  63

Query  471  VMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +M+LSF+GP+VK  W LS+ +E L++TVVFAGML+GAYSWGL SD  GRR  F
Sbjct  64   IMILSFVGPAVKSQWNLSSTQESLLSTVVFAGMLVGAYSWGLFSDYCGRRKGF  116



>ref|XP_009800312.1| PREDICTED: organic cation/carnitine transporter 7 [Nicotiana 
sylvestris]
Length=481

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D  + Y++DEAL++  FG+FQY VL YAGLG +VDA+EVM+LSFIGP++K  WGLS+ +
Sbjct  10   EDHELVYTLDEALTSLGFGKFQYLVLVYAGLGSMVDAVEVMILSFIGPALKSQWGLSSTQ  69

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E LITTVVF+GMLIGAY WGL++DN+GRR
Sbjct  70   ESLITTVVFSGMLIGAYFWGLVADNYGRR  98



>ref|XP_006453137.1| hypothetical protein CICLE_v10008136mg [Citrus clementina]
 ref|XP_006474365.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Citrus sinensis]
 ref|XP_006474366.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Citrus sinensis]
 gb|ESR66377.1| hypothetical protein CICLE_v10008136mg [Citrus clementina]
Length=485

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            GD+  VY  +DEALSA  FG++Q  VLAYAGLG++ +AME+M+LSF+GP+VK  W L+++
Sbjct  2    GDERPVYM-LDEALSALRFGKYQALVLAYAGLGWVSEAMEIMILSFVGPAVKSKWKLTSS  60

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            EE L+TTVVFAGML+GAYSWG++SDN+GRR +F
Sbjct  61   EESLLTTVVFAGMLLGAYSWGIISDNYGRRKSF  93



>ref|XP_008361990.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
Length=179

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  WGLS+ +E
Sbjct  3    DGGQEYTVDEALVAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFVGPAVQSAWGLSSKQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
              IT+VVFAGML+GAYSWG++SD  GRR  F  + T
Sbjct  63   SFITSVVFAGMLVGAYSWGIVSDKHGRRKGFLITAT  98



>gb|AFW68692.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
Length=119

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++D+AL ++ FGRFQ  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +E +IT+
Sbjct  14   YTVDDALLSSGFGRFQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWKLTSHQESMITS  73

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSY  641
            VVF GMLIGAYSWG++SDN+GRR    F+Y
Sbjct  74   VVFVGMLIGAYSWGVVSDNYGRRQVQSFTY  103



>ref|XP_009620262.1| PREDICTED: organic cation/carnitine transporter 7 [Nicotiana 
tomentosiformis]
Length=480

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL++  FG+FQY VL YAGLG +VDA+EVM+LSFIGP++K  WGLS+ +E LITT
Sbjct  15   YTLDEALTSLGFGKFQYMVLVYAGLGSMVDAVEVMILSFIGPALKSQWGLSSTQESLITT  74

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVF+GMLIGAY WGL++DN+GRR
Sbjct  75   VVFSGMLIGAYLWGLVADNYGRR  97



>ref|XP_011093921.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Sesamum indicum]
Length=493

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  336  NYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLW  515
            N G+   D  + Y++DEAL+   FG+FQ  VLAYAGLG + DAME+M+LSFIGPSV+  W
Sbjct  7    NSGVMDYDRELVYTMDEALTMVGFGKFQALVLAYAGLGSMADAMELMILSFIGPSVRSEW  66

Query  516  GLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
            GLS+ +E LITTVVFAGMLIG+Y+ GL+SDN+GRR+
Sbjct  67   GLSSRQESLITTVVFAGMLIGSYASGLISDNYGRRM  102



>ref|XP_006474361.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Citrus sinensis]
Length=493

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            DD  + Y++DEAL+   FG+FQ   LAY+GLG+  +AMEVM+LSF+GP+VK  WGLS++E
Sbjct  2    DDHRLVYTLDEALTFMGFGKFQGLALAYSGLGWFSEAMEVMILSFVGPAVKSEWGLSSSE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLA  626
            E LITTVVFAGML+GAYSWGL+SD +GRR++
Sbjct  62   ESLITTVVFAGMLVGAYSWGLISDIYGRRMS  92



>ref|XP_006299899.1| hypothetical protein CARUB_v10016107mg [Capsella rubella]
 gb|EOA32797.1| hypothetical protein CARUB_v10016107mg [Capsella rubella]
Length=500

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LSA EE
Sbjct  3    DGNPSFTVDEALVAMGFGKFQLYVLAYAGMGWVAEAMEMMLLSFVGPAVQSLWSLSAREE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SLITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>ref|XP_007023588.1| Major facilitator superfamily protein isoform 6 [Theobroma cacao]
 gb|EOY26210.1| Major facilitator superfamily protein isoform 6 [Theobroma cacao]
Length=360

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            G+D    +++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSFIGP+V+ +WGLS+ 
Sbjct  2    GEDGTPTFTVDEALLAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFIGPAVQSIWGLSSH  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            EE LIT+VVF GMLIGAYSWG++SD  GRR  F
Sbjct  62   EESLITSVVFVGMLIGAYSWGVVSDKHGRRKGF  94



>ref|NP_187911.1| nicotinate transporter [Arabidopsis thaliana]
 sp|Q940M4.1|OCT7_ARATH RecName: Full=Organic cation/carnitine transporter 7; Short=AtOCT7 
[Arabidopsis thaliana]
 gb|AAL06921.1| AT3g13050/MGH6_16 [Arabidopsis thaliana]
 gb|AAO42768.1| At3g13050/MGH6_16 [Arabidopsis thaliana]
 gb|AEE75283.1| nicotinate transporter [Arabidopsis thaliana]
Length=500

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LSA +E
Sbjct  3    DGNTRFTVDEALVAMGFGKFQIYVLAYAGMGWVAEAMEMMLLSFVGPAVQSLWNLSARQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SLITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>ref|XP_007023583.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007023585.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007023586.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY26205.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY26207.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY26208.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=496

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            G+D    +++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSFIGP+V+ +WGLS+ 
Sbjct  2    GEDGTPTFTVDEALLAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFIGPAVQSIWGLSSH  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            EE LIT+VVF GMLIGAYSWG++SD  GRR  F
Sbjct  62   EESLITSVVFVGMLIGAYSWGVVSDKHGRRKGF  94



>ref|XP_006652797.1| PREDICTED: organic cation/carnitine transporter 7-like [Oryza 
brachyantha]
Length=489

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    YS+D+AL ++ FGRFQ  +L+YAG+G + +AME+MLLSF+GPSV++ W LSA +
Sbjct  3    EDQSATYSVDDALLSSGFGRFQILILSYAGVGLIAEAMEMMLLSFVGPSVQLEWKLSAHQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E +IT++VF GMLIGAYSWG++SDN+GRR  F F+
Sbjct  63   ESMITSIVFVGMLIGAYSWGVVSDNYGRRRGFLFT  97



>ref|XP_010675318.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
Length=496

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D  V YS+D+A+    FG+ QY VL YAG+G++ +AME+M+LSF+GP+VK  W LSAA+E
Sbjct  3    DHSVTYSVDDAILKMGFGKLQYLVLGYAGMGWIAEAMEMMILSFVGPAVKSSWKLSAAQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             LITTVVFAGML+GAYSWG +SD +GRR  + FS
Sbjct  63   SLITTVVFAGMLLGAYSWGFVSDKYGRRKGYMFS  96



>ref|XP_007023587.1| Major facilitator superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY26209.1| Major facilitator superfamily protein isoform 5 [Theobroma cacao]
Length=389

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            G+D    +++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSFIGP+V+ +WGLS+ 
Sbjct  2    GEDGTPTFTVDEALLAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFIGPAVQSIWGLSSH  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            EE LIT+VVF GMLIGAYSWG++SD  GRR  F
Sbjct  62   EESLITSVVFVGMLIGAYSWGVVSDKHGRRKGF  94



>ref|XP_007023584.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY26206.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=488

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            G+D    +++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSFIGP+V+ +WGLS+ 
Sbjct  2    GEDGTPTFTVDEALLAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFIGPAVQSIWGLSSH  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            EE LIT+VVF GMLIGAYSWG++SD  GRR  F
Sbjct  62   EESLITSVVFVGMLIGAYSWGVVSDKHGRRKGF  94



>dbj|BAB02515.1| transporter-like protein [Arabidopsis thaliana]
Length=470

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LSA +E
Sbjct  3    DGNTRFTVDEALVAMGFGKFQIYVLAYAGMGWVAEAMEMMLLSFVGPAVQSLWNLSARQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SLITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>ref|NP_001174085.1| Os04g0609200 [Oryza sativa Japonica Group]
 dbj|BAH92813.1| Os04g0609200 [Oryza sativa Japonica Group]
Length=102

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    YS+D+AL ++ FGR+Q  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +
Sbjct  3    EDQSATYSVDDALLSSGFGRYQILILSYAGVGLIAEAMEMMLLSFVGPSVQLEWKLTSHQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E +IT++VF GMLIGAY+WG++SDN+GRR
Sbjct  63   ESMITSIVFVGMLIGAYTWGVVSDNYGRR  91



>ref|XP_010675316.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010675317.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
Length=509

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
             D  G+ YS+D+A+S   FG+ QY VLAYAG+G++ +AME+M+LSF+GP+V   W L++ 
Sbjct  2    ADTGGLIYSVDDAISKMGFGKLQYMVLAYAGMGWISEAMEMMILSFVGPAVTFEWNLTSK  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            +E LITTVVFAGML+GAYSWGL+SD +GRR  + FS
Sbjct  62   QESLITTVVFAGMLVGAYSWGLVSDIYGRRKGYVFS  97



>ref|XP_006407270.1| hypothetical protein EUTSA_v10020555mg [Eutrema salsugineum]
 gb|ESQ48723.1| hypothetical protein EUTSA_v10020555mg [Eutrema salsugineum]
Length=505

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LSA E
Sbjct  5    EDGNPSFTVDEALVAMGFGKFQLYVLAYAGMGWVAEAMEMMLLSFVGPAVQSLWNLSARE  64

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E LIT+VVFAGMLIGAY+WG+++D  GRR  F
Sbjct  65   ESLITSVVFAGMLIGAYAWGIVADKHGRRKGF  96



>ref|XP_011031259.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=503

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++DEAL    FG+FQ+ VL YAG+G++ +AMEVM+LSF+GP+V   WGL++ EE
Sbjct  3    DGGPRYTVDEALVTVGFGKFQFLVLLYAGMGWVSEAMEVMILSFVGPAVHSKWGLTSREE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LITTVVFAGML+GAY+WG++SD +GRR  F
Sbjct  63   SLITTVVFAGMLVGAYTWGVISDKYGRRKGF  93



>gb|KDO73399.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
Length=486

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            + G  Y++DEAL+   FG++Q +VLAYAGLG++ +AME+M+LSF+GP+VK  W LS+ EE
Sbjct  3    EQGHVYTVDEALTHVGFGKYQCFVLAYAGLGWVAEAMEIMILSFVGPTVKSEWNLSSTEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LITT VFAG+++GAY+WGL++DN+GRR+ F
Sbjct  63   SLITTSVFAGLVVGAYAWGLVADNYGRRMGF  93



>ref|XP_006453139.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
 ref|XP_006453140.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
 ref|XP_006474363.1| PREDICTED: organic cation/carnitine transporter 7-like [Citrus 
sinensis]
 gb|ESR66379.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
 gb|ESR66380.1| hypothetical protein CICLE_v10008130mg [Citrus clementina]
Length=486

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            + G  Y++DEAL+   FG++Q +VLAYAGLG++ +AME+M+LSF+GP+VK  W LS+ EE
Sbjct  3    EQGHVYTVDEALTHVGFGKYQCFVLAYAGLGWVAEAMEIMILSFVGPTVKSEWNLSSTEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LITT VFAG+++GAY+WGL++DN+GRR+ F
Sbjct  63   SLITTSVFAGLVVGAYAWGLVADNYGRRMGF  93



>ref|XP_002310345.2| transporter-related family protein [Populus trichocarpa]
 gb|EEE90795.2| transporter-related family protein [Populus trichocarpa]
Length=487

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++DEAL    FG+FQ+ VL YAG+G++ +AMEVM+LSF+GP+V   WGL++ EE
Sbjct  3    DGGPRYTVDEALVTVGFGKFQFLVLLYAGMGWVSEAMEVMILSFVGPAVHSKWGLTSHEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LITTVVFAGML+GAY+WG++SD +GRR  F
Sbjct  63   SLITTVVFAGMLVGAYTWGVISDKYGRRKGF  93



>ref|XP_011093916.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093917.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093918.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093919.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093920.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D  + Y++DEAL+   FG+FQ  VLAYAGLG + DAME+M+LSFIGPSV+  WGLS+ +E
Sbjct  15   DRELVYTMDEALTMVGFGKFQALVLAYAGLGSMADAMELMILSFIGPSVRSEWGLSSRQE  74

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
             LITTVVFAGMLIG+Y+ GL+SDN+GRR+
Sbjct  75   SLITTVVFAGMLIGSYASGLISDNYGRRM  103



>ref|XP_009346014.1| PREDICTED: organic cation/carnitine transporter 7-like [Pyrus 
x bretschneideri]
Length=496

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  WGLS+ +E
Sbjct  3    DGGQEYTVDEALVAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFVGPAVQSAWGLSSKQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
              IT+VVFAGML+GAYSWG++SD  GRR  F  + T
Sbjct  63   SFITSVVFAGMLVGAYSWGIVSDKHGRRKGFLITAT  98



>ref|XP_007014586.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY32205.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=493

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  339  YGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWG  518
            Y +  ++ G Y ++DEAL+   FG+FQ  VLAYAGLG+  +AME+M+LSFIG +VK  WG
Sbjct  6    YKMDDEELGAY-TLDEALAMVGFGKFQGLVLAYAGLGWFAEAMEIMILSFIGAAVKSEWG  64

Query  519  LSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            LS ++E L+TTVVFAGMLIGAYSWGL+SDN+GRR  F
Sbjct  65   LSPSQESLLTTVVFAGMLIGAYSWGLISDNYGRRKGF  101



>ref|XP_002882803.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59062.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++D+AL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LSA EE
Sbjct  3    DGKSRFTVDKALVAMGFGKFQLYVLAYAGMGWVAEAMEMMLLSFVGPAVQSLWNLSAREE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SLITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>gb|KDO73403.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
Length=418

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            + G  Y++DEAL+   FG++Q +VLAYAGLG++ +AME+M+LSF+GP+VK  W LS+ EE
Sbjct  3    EQGHVYTVDEALTHVGFGKYQCFVLAYAGLGWVAEAMEIMILSFVGPTVKSEWNLSSTEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LITT VFAG+++GAY+WGL++DN+GRR+ F
Sbjct  63   SLITTSVFAGLVVGAYAWGLVADNYGRRMGF  93



>ref|XP_010240388.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Brachypodium distachyon]
Length=488

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D+    Y++D+AL ++ FGRFQ  +L+YAG+G + +AME+MLLSF+GPSV++ W L+A +
Sbjct  3    DEQSATYTVDDALLSSGFGRFQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWKLTAHQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E +IT+VVF GMLIGAYSWG++SDN+GRR  F F+
Sbjct  63   ESMITSVVFVGMLIGAYSWGVVSDNYGRRKGFFFT  97



>ref|XP_007014587.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY32206.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=486

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+   FG+FQ  VLAYAGLG+  +AME+M+LSFIG +VK  WGLS ++E L+TT
Sbjct  9    YTLDEALAMVGFGKFQGLVLAYAGLGWFAEAMEIMILSFIGAAVKSEWGLSPSQESLLTT  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVFAGMLIGAYSWGL+SDN+GRR  F
Sbjct  69   VVFAGMLIGAYSWGLISDNYGRRKGF  94



>ref|XP_002273636.1| PREDICTED: organic cation/carnitine transporter 7 [Vitis vinifera]
 emb|CBI18371.3| unnamed protein product [Vitis vinifera]
Length=495

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++D+AL A  FG FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  WGLS+ EE
Sbjct  3    DESPNYTVDDALVAMGFGNFQILVLAYAGMGWISEAMEMMLLSFVGPAVQSAWGLSSHEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SDN GRR  F
Sbjct  63   SLITSVVFAGMLVGAYSWGIVSDNHGRRKGF  93



>ref|XP_010278453.1| PREDICTED: organic cation/carnitine transporter 7 [Nelumbo nucifera]
 ref|XP_010278454.1| PREDICTED: organic cation/carnitine transporter 7 [Nelumbo nucifera]
 ref|XP_010278455.1| PREDICTED: organic cation/carnitine transporter 7 [Nelumbo nucifera]
Length=496

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D  VY ++DEAL +  FG+FQ +VLAYAG G++ +AME+MLLSF+GP+V+  WGLS+ E
Sbjct  3    NDCPVY-TVDEALVSLGFGKFQIFVLAYAGAGWIAEAMEMMLLSFVGPAVQAEWGLSSHE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E LI +VVFAGML+GAYSWG++SDN+GRR  F
Sbjct  62   ESLIASVVFAGMLVGAYSWGIVSDNYGRRTGF  93



>emb|CAN64534.1| hypothetical protein VITISV_042940 [Vitis vinifera]
Length=461

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++D+AL A  FG FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  WGLS+ EE
Sbjct  3    DESPNYTVDDALVAMGFGNFQILVLAYAGMGWISEAMEMMLLSFVGPAVQSAWGLSSHEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SDN GRR  F
Sbjct  63   SLITSVVFAGMLVGAYSWGIVSDNHGRRKGF  93



>gb|AFW68693.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
Length=113

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++D+AL ++ FGRFQ  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +E +IT+
Sbjct  14   YTVDDALLSSGFGRFQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWKLTSHQESMITS  73

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVF GMLIGAYSWG++SDN+GRR
Sbjct  74   VVFVGMLIGAYSWGVVSDNYGRR  96



>dbj|BAJ87199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D+    Y++D+AL ++ FG++Q  +LAYAG+G + +AME+MLLSF+GPSV++ W L+A +
Sbjct  3    DEQSATYTVDDALISSGFGKYQILILAYAGIGLIAEAMEMMLLSFVGPSVQLEWNLTAHQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E +IT+VVF GMLIGAYSWG++SDN+GRR  F F+
Sbjct  63   ESMITSVVFVGMLIGAYSWGVVSDNYGRRKGFLFT  97



>ref|XP_009397373.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=486

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D  + +++DEAL + EFG+FQ +VL YAG+G++ +AME+MLLSF+GP+V++ W LS+ +
Sbjct  3    EDGVLSFTVDEALLSIEFGKFQTFVLCYAGMGWISEAMEMMLLSFVGPAVQLEWELSSQQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAYSWG++SD +GRR+ F F+
Sbjct  63   ESLITSVVFVGMLLGAYSWGIVSDIYGRRMGFLFT  97



>ref|XP_006380837.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|ERP58634.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=456

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+A+ A  FG+FQY+VL YAG+G++ +AME+M+LSFIGP+VK  W L++ +E
Sbjct  98   DGGPRYTVDDAILAMGFGKFQYFVLLYAGMGWVSEAMEMMILSFIGPAVKSDWNLTSQQE  157

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SD +GRR  F
Sbjct  158  SLITSVVFAGMLVGAYSWGVVSDRYGRRKGF  188



>ref|XP_011031262.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=529

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+A+ A  FG+FQY+VL YAG+G++ +AME+M+LSFIGP+VK  W L++ +E
Sbjct  26   DGGPRYTVDDAILATGFGKFQYFVLLYAGMGWVSEAMEMMILSFIGPAVKSDWNLTSQQE  85

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SD +GRR  F
Sbjct  86   SLITSVVFAGMLVGAYSWGVVSDRYGRRKGF  116



>ref|XP_010928750.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Elaeis guineensis]
Length=497

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++DEAL +  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  W LS+ +E
Sbjct  3    DGTSTYTVDEALLSLGFGKFQVLVLAYAGMGWISEAMEMMLLSFVGPAVQSEWKLSSHQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             LIT+VVF GML+GAYSWG++SDN+GRR+ F F+
Sbjct  63   SLITSVVFGGMLLGAYSWGVVSDNYGRRMGFLFT  96



>ref|XP_007215272.1| hypothetical protein PRUPE_ppa004702mg [Prunus persica]
 gb|EMJ16471.1| hypothetical protein PRUPE_ppa004702mg [Prunus persica]
Length=495

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  WGLS+ +E
Sbjct  3    DGSPEYTVDEALVAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFVGPAVQSAWGLSSQQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
              IT+VVFAGML+GAYSWG++SD  GRR  F  + T
Sbjct  63   SFITSVVFAGMLVGAYSWGIVSDKHGRRKGFLITAT  98



>ref|XP_006380836.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|ERP58633.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=518

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+A+ A  FG+FQY+VL YAG+G++ +AME+M+LSFIGP+VK  W L++ +E
Sbjct  98   DGGPRYTVDDAILAMGFGKFQYFVLLYAGMGWVSEAMEMMILSFIGPAVKSDWNLTSQQE  157

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SD +GRR  F
Sbjct  158  SLITSVVFAGMLVGAYSWGVVSDRYGRRKGF  188



>ref|XP_009620247.1| PREDICTED: organic cation/carnitine transporter 7-like [Nicotiana 
tomentosiformis]
 ref|XP_009620252.1| PREDICTED: organic cation/carnitine transporter 7-like [Nicotiana 
tomentosiformis]
Length=475

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
             D G+ Y++DEAL++  FG+FQY VL YAGLG + +A E+M+LSFIGP +++ W LS  +
Sbjct  4    QDIGLVYTLDEALTSLGFGKFQYLVLCYAGLGSMAEAFEIMILSFIGPVLRLEWELSPTQ  63

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E LITTVVFAGMLIG Y WG ++DN+GRR
Sbjct  64   ESLITTVVFAGMLIGCYYWGFITDNYGRR  92



>ref|XP_006380838.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|ERP58635.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=529

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+A+ A  FG+FQY+VL YAG+G++ +AME+M+LSFIGP+VK  W L++ +E
Sbjct  26   DGGPRYTVDDAILAMGFGKFQYFVLLYAGMGWVSEAMEMMILSFIGPAVKSDWNLTSQQE  85

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SD +GRR  F
Sbjct  86   SLITSVVFAGMLVGAYSWGVVSDRYGRRKGF  116



>ref|XP_002527821.1| sugar transporter, putative [Ricinus communis]
 gb|EEF34573.1| sugar transporter, putative [Ricinus communis]
Length=498

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+A  FG+FQ  VL YAGLG   +AME+M+LSF+GP+VK  WGLS+++E L+T+
Sbjct  14   YTLDEALAAVGFGKFQGLVLVYAGLGSFAEAMEMMILSFVGPAVKSEWGLSSSQESLLTS  73

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGML GAYSWGL+SDN+GRR
Sbjct  74   VVFAGMLFGAYSWGLISDNYGRR  96



>ref|XP_006380840.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP58637.1| transporter-related family protein [Populus trichocarpa]
Length=506

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+A+ A  FG+FQY+VL YAG+G++ +AME+M+LSFIGP+VK  W L++ +E
Sbjct  3    DGGPRYTVDDAILAMGFGKFQYFVLLYAGMGWVSEAMEMMILSFIGPAVKSDWNLTSQQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SD +GRR  F
Sbjct  63   SLITSVVFAGMLVGAYSWGVVSDRYGRRKGF  93



>ref|XP_002310344.2| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|EEE90794.2| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=601

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+A+ A  FG+FQY+VL YAG+G++ +AME+M+LSFIGP+VK  W L++ +E
Sbjct  98   DGGPRYTVDDAILAMGFGKFQYFVLLYAGMGWVSEAMEMMILSFIGPAVKSDWNLTSQQE  157

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SD +GRR  F
Sbjct  158  SLITSVVFAGMLVGAYSWGVVSDRYGRRKGF  188



>ref|XP_006585686.1| PREDICTED: organic cation/carnitine transporter 7-like [Glycine 
max]
Length=487

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  363  GVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGL  542
            G  Y++D+AL A  FG FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  W LSA EE L
Sbjct  6    GPTYTVDDALVALGFGNFQILVLAYAGVGWVSEAMEMMLLSFVGPAVQTAWNLSAHEESL  65

Query  543  ITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            IT+VVFAGMLIGAYSWG++SD  GRR  F  + T
Sbjct  66   ITSVVFAGMLIGAYSWGIVSDKHGRRKGFLITAT  99



>gb|KHN38113.1| Organic cation/carnitine transporter 7 [Glycine soja]
Length=487

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  363  GVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGL  542
            G  Y++D+AL A  FG FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  W LSA EE L
Sbjct  6    GPTYTVDDALVALGFGNFQILVLAYAGVGWVSEAMEMMLLSFVGPAVQTAWNLSAHEESL  65

Query  543  ITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            IT+VVFAGMLIGAYSWG++SD  GRR  F  + T
Sbjct  66   ITSVVFAGMLIGAYSWGIVSDKHGRRKGFLITAT  99



>gb|KJB68011.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
Length=362

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            G+D    +++D+AL    FG+FQ  VLAYAG+G++ +AME+MLLSFIGP+V+ LWGL++ 
Sbjct  2    GEDGTPTFTVDDALLHMGFGKFQILVLAYAGMGWVSEAMEMMLLSFIGPAVQSLWGLTSH  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +E LIT+VVF GML+GAYSWG++SD +GRR  F
Sbjct  62   QESLITSVVFVGMLVGAYSWGVVSDKYGRRKGF  94



>ref|XP_008670376.1| PREDICTED: organic cation/carnitine transporter 7-like [Zea mays]
 ref|XP_008670377.1| PREDICTED: organic cation/carnitine transporter 7-like [Zea mays]
 tpg|DAA40751.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
 tpg|DAA40752.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
 tpg|DAA40753.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
 tpg|DAA40754.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
Length=492

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+F  +VLAY+G+  + +AME+MLLSF+G SV+  WGLSA E
Sbjct  2    EDGVSTYTVDEALVSMGFGKFHAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWGLSAHE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAY+WG++SDN+GRR+ F F+
Sbjct  62   ESLITSVVFVGMLVGAYAWGIVSDNYGRRVGFNFT  96



>emb|CAH67747.1| H0702G05.6 [Oryza sativa Indica Group]
Length=489

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    YS+D+AL ++ FGR+Q  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +
Sbjct  3    EDQSATYSVDDALLSSGFGRYQILILSYAGVGLIAEAMEMMLLSFVGPSVQLEWKLTSHQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E +IT++VF GMLIGAY+WG++SDN+GRR  F F+
Sbjct  63   ESMITSIVFVGMLIGAYTWGVVSDNYGRRRGFLFT  97



>ref|XP_010552380.1| PREDICTED: organic cation/carnitine transporter 7 [Tarenaya hassleriana]
Length=503

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++DEAL A  FGRFQ+ VLAYAG+G++ +AME+MLLSF+GP+V+ LW LS+ EE  IT+
Sbjct  8    FTVDEALVAMGFGRFQFLVLAYAGMGWVSEAMEMMLLSFVGPAVQSLWNLSSHEESFITS  67

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVF GMLIGAYSWG++SD  GRR  F
Sbjct  68   VVFFGMLIGAYSWGIVSDKHGRRKGF  93



>gb|KJB68008.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68009.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68010.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68012.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
 gb|KJB68013.1| hypothetical protein B456_010G222000 [Gossypium raimondii]
Length=496

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            G+D    +++D+AL    FG+FQ  VLAYAG+G++ +AME+MLLSFIGP+V+ LWGL++ 
Sbjct  2    GEDGTPTFTVDDALLHMGFGKFQILVLAYAGMGWVSEAMEMMLLSFIGPAVQSLWGLTSH  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +E LIT+VVF GML+GAYSWG++SD +GRR  F
Sbjct  62   QESLITSVVFVGMLVGAYSWGVVSDKYGRRKGF  94



>ref|XP_002460658.1| hypothetical protein SORBIDRAFT_02g032700 [Sorghum bicolor]
 gb|EER97179.1| hypothetical protein SORBIDRAFT_02g032700 [Sorghum bicolor]
Length=492

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+F  +VLAY+G+  + +AME+MLLSF+G SV+  WGLSA E
Sbjct  2    EDGISTYTVDEALVSMGFGKFHAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWGLSAQE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAY+WG++SDN+GRR+ F F+
Sbjct  62   ESLITSVVFVGMLVGAYAWGIVSDNYGRRVGFNFT  96



>ref|XP_011467508.1| PREDICTED: organic cation/carnitine transporter 7 [Fragaria vesca 
subsp. vesca]
Length=495

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++D+AL +  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  WGLS+ +E
Sbjct  3    DGSQEYTVDDALVSMGFGKFQLLVLAYAGMGWISEAMEMMLLSFVGPAVQSAWGLSSKQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
              IT+VVF GML+GAY+WG++SDN+GRR  F  + T
Sbjct  63   SFITSVVFTGMLVGAYTWGIVSDNYGRRKGFLITAT  98



>dbj|BAJ96217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+FQ +VLAY+G+  + +AME+MLLSF+G SV   WGLSA E
Sbjct  2    EDGVSTYTVDEALVSMGFGKFQAFVLAYSGMAKISEAMEMMLLSFVGQSVHAEWGLSAQE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E  IT+VVF GML+GAY WGL+SDN+GRR+ F F+
Sbjct  62   ESFITSVVFLGMLVGAYCWGLVSDNYGRRVGFNFT  96



>ref|XP_009124704.1| PREDICTED: organic cation/carnitine transporter 7 [Brassica rapa]
Length=494

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            ++    +++DEAL    FG+FQ +VLAYAG+ ++ +AME+MLLSF+GP+V+ LW LSA E
Sbjct  2    EEGNPSFTVDEALVGIGFGKFQLYVLAYAGMAWVAEAMEMMLLSFVGPAVQSLWNLSARE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E LIT+VVFAGMLIGAYSWG+++D  GRR  F
Sbjct  62   ESLITSVVFAGMLIGAYSWGIVADKHGRRKGF  93



>emb|CDY24225.1| BnaC01g38050D [Brassica napus]
Length=492

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            ++    +++DEAL    FG+FQ +VLAYAG+ ++ +AME+MLLSF+GP+V+ LW LSA E
Sbjct  2    EEGNPSFTVDEALVGIGFGKFQLYVLAYAGMAWVAEAMEMMLLSFVGPAVQSLWNLSARE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E LIT+VVFAGMLIGAYSWG+++D  GRR  F
Sbjct  62   ESLITSVVFAGMLIGAYSWGIVADKHGRRKGF  93



>ref|XP_010421982.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
 ref|XP_010421983.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
 ref|XP_010421984.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
Length=500

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LS+ +E
Sbjct  3    DGKPSFTVDEALVAMGFGKFQLYVLAYAGMGWIGEAMEMMLLSFVGPAVQSLWNLSSRQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
              IT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SFITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>ref|XP_006453149.1| hypothetical protein CICLE_v10008141mg [Citrus clementina]
 gb|ESR66389.1| hypothetical protein CICLE_v10008141mg [Citrus clementina]
Length=482

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++DEAL++A FG+FQY V AYAGL    +AME+M+LSFIGP+VK  WG+S + E
Sbjct  3    DEGHRYTVDEALTSAGFGKFQYLVFAYAGLAVFAEAMEIMILSFIGPAVKSEWGVSPSAE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             L++TVVFAG L+G Y WGLLSDN+GR+  F
Sbjct  63   SLLSTVVFAGNLVGVYLWGLLSDNYGRKKGF  93



>emb|CDY43379.1| BnaA01g30100D [Brassica napus]
Length=494

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            ++    +++DEAL    FG+FQ +VLAYAG+ ++ +AME+MLLSF+GP+V+ LW LSA E
Sbjct  2    EEGNPSFTVDEALVGIGFGKFQLYVLAYAGMAWVAEAMEMMLLSFVGPAVQSLWNLSARE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E LIT+VVFAGMLIGAYSWG+++D  GRR  F
Sbjct  62   ESLITSVVFAGMLIGAYSWGIVADKHGRRKGF  93



>ref|XP_010421978.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010421979.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010421980.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Camelina sativa]
Length=500

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LS+ +E
Sbjct  3    DGKPSFTVDEALVAMGFGKFQLYVLAYAGMGWIGEAMEMMLLSFVGPAVQSLWNLSSRQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
              IT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SFITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>gb|EMS56043.1| Synaptic vesicle 2-related protein [Triticum urartu]
Length=771

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  336  NYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLW  515
            + G   +D    Y++DEAL +  FG+FQ +VLAY+G+  + +AME+MLLSF+G SV   W
Sbjct  264  DVGASMEDGVSTYTVDEALVSMGFGKFQAFVLAYSGMAKISEAMEMMLLSFVGQSVHAEW  323

Query  516  GLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            GLSA EE  IT+VVF GML+GAY WGL+SDN+GRR+ F F+
Sbjct  324  GLSAQEESFITSVVFLGMLVGAYCWGLVSDNYGRRVGFNFT  364



>gb|AFW68691.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
Length=500

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++D+AL ++ FGRFQ  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +E +IT+
Sbjct  18   YTVDDALLSSGFGRFQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWKLTSHQESMITS  77

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGAYSWG++SDN+GRR  F F+
Sbjct  78   VVFVGMLIGAYSWGVVSDNYGRRRGFLFT  106



>ref|XP_010499859.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
 ref|XP_010499865.1| PREDICTED: organic cation/carnitine transporter 7-like [Camelina 
sativa]
Length=500

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LS+ +E
Sbjct  3    DGKPSFTVDEALVAMGFGKFQLYVLAYAGMGWIGEAMEMMLLSFVGPAVQSLWNLSSRQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
              IT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SFITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>ref|XP_002467179.1| hypothetical protein SORBIDRAFT_01g020990 [Sorghum bicolor]
 gb|EER94177.1| hypothetical protein SORBIDRAFT_01g020990 [Sorghum bicolor]
Length=491

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++D+AL ++ FGRFQ  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +E +IT+
Sbjct  9    YTVDDALLSSGFGRFQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWKLTSHQESMITS  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGAYSWG++SDN+GRR  F F+
Sbjct  69   VVFVGMLIGAYSWGVVSDNYGRRRGFLFT  97



>ref|XP_004140724.1| PREDICTED: organic cation/carnitine transporter 7-like [Cucumis 
sativus]
 gb|KGN57483.1| hypothetical protein Csa_3G198470 [Cucumis sativus]
Length=502

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  321  VVPPQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPS  500
            VV    + +G       Y+IDEAL +  FG FQ  VLAYAG+G++ +AME+MLLSF+GP+
Sbjct  9    VVSSNRHQVGDGGESPRYTIDEALVSMGFGNFQILVLAYAGMGWVSEAMEMMLLSFVGPA  68

Query  501  VKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            V+  W LS  EE LIT+VVFAGML+GAY+WG++SD +GRR  F  + T
Sbjct  69   VQSSWNLSPHEESLITSVVFAGMLVGAYAWGIVSDKYGRRKGFFITAT  116



>gb|KDO73387.1| hypothetical protein CISIN_1g015136mg [Citrus sinensis]
Length=412

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++DEAL++A FG+FQY V AYAGL    +AME+M+LSFIGP+VK  WG+S + E
Sbjct  3    DEGHRYTVDEALTSAGFGKFQYLVFAYAGLAVFAEAMEIMILSFIGPAVKSEWGVSPSAE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             L++TVVFAG L+G Y WGLLSDN+GR+  F
Sbjct  63   SLLSTVVFAGNLVGVYLWGLLSDNYGRKKGF  93



>ref|XP_010465101.1| PREDICTED: organic cation/carnitine transporter 7 [Camelina sativa]
Length=500

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEAL A  FG+FQ +VLAYAG+G++ +AME+MLLSF+GP+V+ LW LS+ +E
Sbjct  3    DGKPSFTVDEALVAMGFGKFQLYVLAYAGMGWIGEAMEMMLLSFVGPAVQSLWNLSSRQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
              IT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  63   SFITSVVFAGMLIGAYSWGIVSDKHGRRKGF  93



>ref|XP_008456184.1| PREDICTED: organic cation/carnitine transporter 7 [Cucumis melo]
Length=502

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +3

Query  330  PQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKV  509
            P     GG+     Y+IDEAL +  FG FQ  VLAYAG+G++ +AME+MLLSF+GP+V+ 
Sbjct  14   PHQVEDGGESP--RYTIDEALVSMGFGNFQILVLAYAGMGWISEAMEMMLLSFVGPAVQS  71

Query  510  LWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
             W LS  EE LIT+VVFAGML+GAY+WG++SD +GRR  F  + T
Sbjct  72   AWNLSPHEESLITSVVFAGMLVGAYTWGIVSDKYGRRKGFFITAT  116



>ref|XP_008681209.1| PREDICTED: uncharacterized protein LOC100193898 isoform X1 [Zea 
mays]
 gb|ACN35011.1| unknown [Zea mays]
 gb|ACN35622.2| unknown [Zea mays]
 gb|AFW68694.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
 gb|AFW68695.1| hypothetical protein ZEAMMB73_097319 [Zea mays]
Length=496

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++D+AL ++ FGRFQ  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +E +IT+
Sbjct  14   YTVDDALLSSGFGRFQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWKLTSHQESMITS  73

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGAYSWG++SDN+GRR  F F+
Sbjct  74   VVFVGMLIGAYSWGVVSDNYGRRRGFLFT  102



>ref|XP_006660971.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Oryza brachyantha]
Length=500

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+FQ +VLAYAG+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  12   EDGVSTYTVDEALVSMGFGKFQAFVLAYAGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  71

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAYSWG++SDN+GRR+ F F+
Sbjct  72   ESLITSVVFVGMLVGAYSWGIVSDNYGRRVGFNFT  106



>ref|XP_008348401.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
 ref|XP_008348402.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
 ref|XP_008348403.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus 
domestica]
Length=493

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  WGLS+ +E
Sbjct  3    DGSPKYTVDEALVAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFVGPAVQSAWGLSSEQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVF G L+GAYSWG++SD +GRR  F
Sbjct  63   SLITSVVFVGTLVGAYSWGIVSDKYGRRKGF  93



>ref|XP_006660972.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Oryza brachyantha]
Length=490

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+FQ +VLAYAG+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  2    EDGVSTYTVDEALVSMGFGKFQAFVLAYAGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAYSWG++SDN+GRR+ F F+
Sbjct  62   ESLITSVVFVGMLVGAYSWGIVSDNYGRRVGFNFT  96



>ref|XP_004983024.1| PREDICTED: organic cation/carnitine transporter 7-like [Setaria 
italica]
Length=491

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            ++    Y++D+AL ++ FG+FQ  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +
Sbjct  3    EEQSASYTVDDALLSSGFGKFQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWKLTSHQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E +IT+VVF GMLIGAYSWG++SDN+GRR  F F+
Sbjct  63   ESMITSVVFVGMLIGAYSWGVVSDNYGRRRGFLFT  97



>ref|XP_007135877.1| hypothetical protein PHAVU_010G165500g [Phaseolus vulgaris]
 gb|ESW07871.1| hypothetical protein PHAVU_010G165500g [Phaseolus vulgaris]
Length=487

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  363  GVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGL  542
            G  Y++D+AL A  FG FQ  VL YAG+G++ +AME+MLLSF+GP+V+  W LSA EE L
Sbjct  6    GPSYTVDDALVALGFGNFQILVLVYAGVGWISEAMEMMLLSFVGPAVQAQWNLSAHEESL  65

Query  543  ITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            IT+VVFAGMLIGAYSWG++SD  GRR  F  + T
Sbjct  66   ITSVVFAGMLIGAYSWGIVSDKHGRRKGFLITAT  99



>gb|EMT01283.1| Synaptic vesicle 2-related protein [Aegilops tauschii]
Length=713

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+FQ +VLAY+G+  + +AME+MLLSF+G SV   WGLSA E
Sbjct  212  EDGVSTYTVDEALVSMGFGKFQAFVLAYSGMAKISEAMEMMLLSFVGQSVHAEWGLSAQE  271

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E  IT+VVF GML+GAY WGL+SDN+GRR+ F F+
Sbjct  272  ESFITSVVFLGMLVGAYCWGLVSDNYGRRVGFNFT  306



>ref|XP_006582967.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Glycine max]
Length=487

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  363  GVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGL  542
            G  Y++D+AL A  FG FQ  VLAYAG+G++ +AME+M+LSF+GP+V+  W LSA EE L
Sbjct  6    GPSYTVDDALVALGFGNFQILVLAYAGVGWVSEAMEMMILSFVGPAVQTAWNLSAHEESL  65

Query  543  ITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            IT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  66   ITSVVFAGMLIGAYSWGIVSDKHGRRKGF  94



>ref|XP_010928751.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Elaeis guineensis]
Length=419

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++DEAL +  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  W LS+ +E
Sbjct  3    DGTSTYTVDEALLSLGFGKFQVLVLAYAGMGWISEAMEMMLLSFVGPAVQSEWKLSSHQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLA  626
             LIT+VVF GML+GAYSWG++SDN+GRR A
Sbjct  63   SLITSVVFGGMLLGAYSWGVVSDNYGRRQA  92



>gb|KDO36515.1| hypothetical protein CISIN_1g030356mg [Citrus sinensis]
Length=179

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+   FG+FQ  VL YAGLG + +AME+M+LSFIGP++K  W LS A+E L+T+
Sbjct  9    YTLDEALNHVGFGKFQILVLIYAGLGLVAEAMEIMILSFIGPAIKSEWNLSPAQETLLTS  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAG+L+G+YSWG +SDN+GRR
Sbjct  69   VVFAGLLVGSYSWGFISDNYGRR  91



>gb|KDO73398.1| hypothetical protein CISIN_1g011416mg [Citrus sinensis]
Length=447

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            + G  Y++DEAL+   FG++Q +VLAYAGLG++ +AME+M+LSF+GP+VK  W LS+ EE
Sbjct  3    EQGHVYTVDEALTHVGFGKYQCFVLAYAGLGWVAEAMEIMILSFVGPTVKSEWNLSSTEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGR  617
             LITT VFAG+++GAY+WGL++DN+GR
Sbjct  63   SLITTSVFAGLVVGAYAWGLVADNYGR  89



>ref|XP_002528039.1| sugar transporter, putative [Ricinus communis]
 gb|EEF34357.1| sugar transporter, putative [Ricinus communis]
Length=497

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +   + Y++DEAL+A  FG+FQ +VL YAGLG+  +AMEVM+LSF+GP+VK+ W LS+ +
Sbjct  6    ESQNLVYNLDEALAAVGFGKFQGFVLVYAGLGWFSEAMEVMILSFVGPAVKLKWELSSTQ  65

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E L++TVVF GMLIGA +WGL+SDN+GRR
Sbjct  66   ESLLSTVVFGGMLIGACTWGLISDNYGRR  94



>gb|EMT04717.1| Synaptic vesicle 2-related protein [Aegilops tauschii]
Length=502

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D+    Y++D+AL ++ FG++Q  +L+YAG+G + +AME+MLLSF+GPSV++ W L+A +
Sbjct  89   DEQSATYTVDDALISSGFGKYQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWNLTAHQ  148

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E +IT+VVF GMLIGAYSWG++SDN+GRR
Sbjct  149  ESMITSVVFVGMLIGAYSWGVVSDNYGRR  177



>ref|XP_010696144.1| PREDICTED: organic cation/carnitine transporter 7 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            GDD   + ++D+AL A  FG+FQ ++L YAG+G++ +AME+MLLSF+GP+V+  WGLS+ 
Sbjct  8    GDDTETF-TVDDALIAMGFGKFQVYLLVYAGMGWISEAMEMMLLSFVGPAVQAEWGLSSN  66

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +E +IT+VVFAGMLIG+YSWG++SD FGRR  F
Sbjct  67   KESMITSVVFAGMLIGSYSWGVVSDKFGRRNGF  99



>gb|EYU21187.1| hypothetical protein MIMGU_mgv1a005199mg [Erythranthe guttata]
Length=493

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D+    Y++DEAL A  FG+FQ +VL YAG+G++ +AME+MLLSF+G +V+  WGLS+ E
Sbjct  3    DERKSSYTVDEALIALGFGKFQVFVLIYAGIGWVSEAMEMMLLSFVGSAVQSAWGLSSHE  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            E LIT++VFAGML+GAYSWG++SD +GRR  F  + T
Sbjct  63   ESLITSIVFAGMLVGAYSWGIVSDIYGRRKGFLITAT  99



>ref|XP_002513292.1| sugar transporter, putative [Ricinus communis]
 gb|EEF48695.1| sugar transporter, putative [Ricinus communis]
Length=504

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D  + Y++DEAL A  FG+FQ  VL YAGLG+  +AME+MLLS IGP+V+  WGLS+A++
Sbjct  3    DGRLVYTVDEALFAVGFGKFQVLVLLYAGLGWASEAMEMMLLSTIGPAVQQQWGLSSAKQ  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT++VF GM+IGAYSWGL+SD FGRR  F
Sbjct  63   SLITSMVFVGMMIGAYSWGLVSDKFGRRRGF  93



>ref|XP_009135279.1| PREDICTED: organic cation/carnitine transporter 7-like [Brassica 
rapa]
Length=500

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    +++DEAL    FG+FQ +VLAYAG+G + +AME+MLLSF+GP+V+ LW LS+ E
Sbjct  2    EDGNRSFTVDEALVEMGFGKFQLYVLAYAGMGMVAEAMEMMLLSFVGPAVQSLWNLSSRE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E  IT+VVFAGMLIGAYSWG+++D  GRR  F
Sbjct  62   ESSITSVVFAGMLIGAYSWGIVADKHGRRKGF  93



>ref|NP_001063920.1| Os09g0559800 [Oryza sativa Japonica Group]
 dbj|BAD45955.1| putative SV2 related protein [Oryza sativa Japonica Group]
 dbj|BAF25834.1| Os09g0559800 [Oryza sativa Japonica Group]
Length=490

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+FQ +VLAY+G+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  2    EDGVSTYTVDEALISMGFGKFQAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAYSWG++SDN+GRR+ F F+
Sbjct  62   ESLITSVVFVGMLVGAYSWGIVSDNYGRRVGFNFT  96



>ref|XP_003562867.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
Length=491

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  348  GGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSA  527
            GG     YY+ D+ALS   FGRFQ  VLAYAG+G+  +AME+MLLSF+GP+VK  WG+S 
Sbjct  10   GGGAECCYYTTDDALSHVGFGRFQALVLAYAGVGWTAEAMEIMLLSFVGPAVKDEWGISG  69

Query  528  AEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             ++GLIT+VVFAGMLIGA   G LSD +GRR  F F+
Sbjct  70   QQQGLITSVVFAGMLIGALFGGALSDTYGRRTGFLFT  106



>emb|CDY51903.1| BnaC03g73660D [Brassica napus]
Length=500

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    +++DEAL    FG+FQ +VLAYAG+G + +AME+MLLSF+GP+V+ LW LS+ E
Sbjct  2    EDGNRSFTVDEALVDMGFGKFQLYVLAYAGMGMVAEAMEMMLLSFVGPAVQSLWNLSSRE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E  IT+VVFAGMLIGAYSWG+++D  GRR  F
Sbjct  62   ESSITSVVFAGMLIGAYSWGIVADKHGRRKGF  93



>ref|XP_010236648.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Brachypodium distachyon]
Length=426

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  348  GGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSA  527
            GG     YY+ D+ALS   FGRFQ  VLAYAG+G+  +AME+MLLSF+GP+VK  WG+S 
Sbjct  10   GGGAECCYYTTDDALSHVGFGRFQALVLAYAGVGWTAEAMEIMLLSFVGPAVKDEWGISG  69

Query  528  AEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             ++GLIT+VVFAGMLIGA   G LSD +GRR  F F+
Sbjct  70   QQQGLITSVVFAGMLIGALFGGALSDTYGRRTGFLFT  106



>emb|CDX82560.1| BnaA03g32610D [Brassica napus]
Length=663

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    +++DEAL    FG+FQ +VLAYAG+G + +AME+MLLSF+GP+V+ LW LS+ E
Sbjct  2    EDGNRSFTVDEALVEMGFGKFQLYVLAYAGMGMVAEAMEMMLLSFVGPAVQSLWNLSSRE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E  IT+VVFAGMLIGAYSWG+++D  GRR  F
Sbjct  62   ESSITSVVFAGMLIGAYSWGIVADKHGRRKGF  93



>ref|XP_010542536.1| PREDICTED: organic cation/carnitine transporter 7-like [Tarenaya 
hassleriana]
 ref|XP_010542537.1| PREDICTED: organic cation/carnitine transporter 7-like [Tarenaya 
hassleriana]
Length=495

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++DEAL A  FG+FQ  VLAYAG+G+L +AME+MLLSF+GP+V+ LW LS  E+  +T+
Sbjct  8    FTVDEALVAMGFGKFQLLVLAYAGMGWLSEAMEMMLLSFVGPAVQSLWNLSPHEDSFLTS  67

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  68   VVFAGMLIGAYSWGIVSDKCGRRKGF  93



>gb|EEC77965.1| hypothetical protein OsI_17329 [Oryza sativa Indica Group]
Length=529

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    YS+D+AL ++ FGR+Q  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +
Sbjct  7    EDQSATYSVDDALLSSGFGRYQILILSYAGVGLIAEAMEMMLLSFVGPSVQLEWKLTSHQ  66

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E +IT++VF GMLIGAY+WG++SDN+GRR
Sbjct  67   ESMITSIVFVGMLIGAYTWGVVSDNYGRR  95



>ref|XP_009344025.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
7-like [Pyrus x bretschneideri]
Length=501

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    Y++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+V+  W LS+ +E
Sbjct  3    DGSPQYTVDEALVAMGFGKFQILVLAYAGMGWVSEAMEMMLLSFVGPAVQSAWDLSSEQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAG L+G+YSWG++SD +GRR  F
Sbjct  63   SLITSVVFAGTLVGSYSWGIVSDKYGRRKGF  93



>gb|KDP45839.1| hypothetical protein JCGZ_17446 [Jatropha curcas]
Length=493

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D+ G+ Y++DEAL A  FG+FQ  VL YAGLG   +AME+M+LSF+G +++  WGLS+++
Sbjct  2    DEYGLEYTLDEALVAVGFGKFQGLVLLYAGLGLFAEAMEIMILSFVGLAIETEWGLSSSQ  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            + L+T+VVFAGMLIGAYSWGL+SDN GR+
Sbjct  62   KSLLTSVVFAGMLIGAYSWGLISDNMGRK  90



>ref|XP_004157349.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
7-like [Cucumis sativus]
Length=502

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +3

Query  321  VVPPQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPS  500
            VV    + +G       Y+IDEAL +  FG FQ  VLAYAG+G++ +AME+MLLSF+GP+
Sbjct  9    VVSSNRHQVGDGGESPRYTIDEALVSMGFGNFQILVLAYAGMGWVSEAMEMMLLSFVGPA  68

Query  501  VKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            V+  W LS   E LIT+VVFAGML+GAY+WG++SD +GRR  F  + T
Sbjct  69   VQSSWNLSPHAESLITSVVFAGMLVGAYAWGIVSDKYGRRKGFFITAT  116



>emb|CAE03655.2| OSJNBa0060N03.20 [Oryza sativa Japonica Group]
Length=588

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    YS+D+AL ++ FGR+Q  +L+YAG+G + +AME+MLLSF+GPSV++ W L++ +
Sbjct  66   EDQSATYSVDDALLSSGFGRYQILILSYAGVGLIAEAMEMMLLSFVGPSVQLEWKLTSHQ  125

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E +IT++VF GMLIGAY+WG++SDN+GRR
Sbjct  126  ESMITSIVFVGMLIGAYTWGVVSDNYGRR  154



>ref|XP_006453143.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
 gb|ESR66383.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
Length=473

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+   FG+FQ  VL YAGLG + +AME+M+LSFIGP++K  W LS A+E L+T+
Sbjct  9    YTLDEALNHVGFGKFQILVLIYAGLGLVAEAMEIMILSFIGPAIKSEWNLSPAQETLLTS  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAG+L+G+YSWG +SDN+GRR
Sbjct  69   VVFAGLLVGSYSWGFISDNYGRR  91



>gb|EMS63401.1| Synaptic vesicle 2-related protein [Triticum urartu]
Length=695

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D+    Y++D+AL ++ FG++Q  +L+YAG+G + +AME+MLLSF+GPSV++ W L+A +
Sbjct  3    DEQSATYTVDDALISSGFGKYQILILSYAGIGLIAEAMEMMLLSFVGPSVQLEWNLTAHQ  62

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E +IT+VVF GMLIGAYSWG++SDN+GRR
Sbjct  63   ESMITSVVFVGMLIGAYSWGVVSDNYGRR  91



>ref|XP_004507561.1| PREDICTED: organic cation/carnitine transporter 7-like [Cicer 
arietinum]
Length=515

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+AL A  FG+FQ  VL YAG+G++ +AME+MLLSF+GP+V+  W LS+ EE
Sbjct  25   DEGGGYTVDDALVALGFGKFQILVLVYAGIGWISEAMEMMLLSFVGPAVESAWNLSSHEE  84

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
              IT+VVFAGMLIGAYSWG+++D  GRR  F  + T
Sbjct  85   SFITSVVFAGMLIGAYSWGIVADQHGRRKGFLITAT  120



>ref|XP_006374730.1| hypothetical protein POPTR_0014s00290g [Populus trichocarpa]
 gb|ERP52527.1| hypothetical protein POPTR_0014s00290g [Populus trichocarpa]
Length=480

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G  Y++D+A+ A  FG+FQY VL YAG+G++ ++ME+M+LSF+GP+VK  W L++ +E
Sbjct  66   DGGPRYTVDDAILAMGFGKFQYLVLLYAGMGWVSESMEMMILSFVGPAVKSDWDLTSQQE  125

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+GAYSWG++SD  GRR  F
Sbjct  126  SLITSVVFAGMLVGAYSWGVVSDRCGRRKGF  156



>ref|XP_010927137.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Elaeis guineensis]
 ref|XP_010927138.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 
[Elaeis guineensis]
Length=487

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++D+A  +  FG+FQ  VLAYAG+G++ +AME+MLLSF+GPSV++ W LS+ E+ +IT+
Sbjct  8    FTVDDAFLSMRFGKFQALVLAYAGMGWVSEAMEMMLLSFVGPSVRMEWKLSSYEDSMITS  67

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             VF GML+GAYSWG++SDN+GRR+ F F+
Sbjct  68   AVFVGMLLGAYSWGIVSDNYGRRMGFLFT  96



>ref|XP_008228025.1| PREDICTED: organic cation/carnitine transporter 7 [Prunus mume]
Length=495

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D  + Y++DEAL A  FG+FQ  VLAYAG+G++ +AME+MLLSF+GP+ +   G+S+ +E
Sbjct  3    DGSLEYTVDEALVAMGFGKFQILVLAYAGMGWISEAMEMMLLSFVGPAAQSACGVSSQQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
              IT+VVFAGML+GAYSWG++SD  GRR  F  + T
Sbjct  63   SFITSVVFAGMLVGAYSWGIVSDKHGRRKGFLITAT  98



>ref|XP_006453144.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
 gb|ESR66384.1| hypothetical protein CICLE_v10008092mg [Citrus clementina]
Length=496

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+   FG+FQ  VL YAGLG + +AME+M+LSFIGP++K  W LS A+E L+T+
Sbjct  9    YTLDEALNHVGFGKFQILVLIYAGLGLVAEAMEIMILSFIGPAIKSEWNLSPAQETLLTS  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRRL  623
            VVFAG+L+G+YSWG +SDN+GR L
Sbjct  69   VVFAGLLVGSYSWGFISDNYGRSL  92



>dbj|BAJ92143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 4/101 (4%)
 Frame = +3

Query  348  GGDDA----GVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLW  515
            GG +A      YY+ D+ALS   FGRFQ  VLAYAG+G+  +AME+M+LSF+GPSVK  W
Sbjct  3    GGSEARGGECCYYTTDDALSQVGFGRFQALVLAYAGVGWTAEAMEIMMLSFVGPSVKDEW  62

Query  516  GLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            G+S  +EGLIT+VVFAGM+IG    G++SD++GRR  F F+
Sbjct  63   GISGQQEGLITSVVFAGMIIGGCLGGVISDSYGRRAGFLFT  103



>ref|XP_009800311.1| PREDICTED: organic cation/carnitine transporter 7-like [Nicotiana 
sylvestris]
Length=475

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL++  FG+FQY VL YAGLG + +A E+M+LSFIGP ++  W LS  +E LITT
Sbjct  10   YTVDEALTSLGFGKFQYLVLCYAGLGSMAEAFEIMILSFIGPVLRSEWELSPTQESLITT  69

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            V+FAGMLIG Y WG ++DN+GRR
Sbjct  70   VIFAGMLIGCYYWGFITDNYGRR  92



>ref|XP_003604112.1| Synaptic vesicle 2-related protein [Medicago truncatula]
 gb|AES86309.1| organic cation/carnitine transporter-like protein [Medicago truncatula]
Length=499

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL    FG+FQ  VL YAG+G++ +AME+MLLSF+GP+V+  W LS+ +E  IT+
Sbjct  14   YTVDEALITLGFGKFQILVLIYAGIGWISEAMEMMLLSFVGPAVQSAWNLSSHQESFITS  73

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            VVFAGMLIGAYSWG++SD  GRR  F  + T
Sbjct  74   VVFAGMLIGAYSWGIVSDQHGRRKGFLITAT  104



>gb|KDP25026.1| hypothetical protein JCGZ_22561 [Jatropha curcas]
Length=572

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D G+ ++IDEAL    FG+FQ  VL YAG+G++ +AME+MLLSF+G +V+  WGL++ +E
Sbjct  71   DEGLGFTIDEALVEMGFGKFQILVLLYAGMGWISEAMEMMLLSFVGSAVQHEWGLTSQQE  130

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVF GML+GAYSWGL+SD +GRR  F
Sbjct  131  SLITSVVFVGMLVGAYSWGLVSDKYGRRKGF  161



>ref|XP_008796960.1| PREDICTED: organic cation/carnitine transporter 7 [Phoenix dactylifera]
Length=512

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++D+AL +  FG+FQ  VLAYAG+G + +AME+MLLSF+GPSV++ W LS+ E+
Sbjct  28   DESATFTVDDALLSMRFGKFQALVLAYAGMGSVSEAMEMMLLSFVGPSVRMEWKLSSYED  87

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             +IT+ VF GML+GAYSWG++SD +GRR+ F F+
Sbjct  88   SMITSAVFVGMLLGAYSWGVVSDKYGRRMGFLFT  121



>gb|KJB23423.1| hypothetical protein B456_004G097300, partial [Gossypium raimondii]
Length=433

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  QNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVL  512
            Q +G     A   Y++DEAL    FG+FQ +VL YAGLG+  +AME+M+LSFIG +VK  
Sbjct  70   QFHGQMDYKAAGLYTLDEALETVGFGKFQGFVLGYAGLGWFAEAMEIMILSFIGQAVKSE  129

Query  513  WGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            W LS+ +E L++T+VFAGML+GA +WGLLSDN+GRR  F
Sbjct  130  WQLSSGQESLLSTIVFAGMLLGANTWGLLSDNYGRRKGF  168



>tpg|DAA40755.1| TPA: hypothetical protein ZEAMMB73_392255 [Zea mays]
Length=527

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+F  +VLAY+G+  + +AME+MLLSF+G SV+  WGLSA E
Sbjct  2    EDGVSTYTVDEALVSMGFGKFHAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWGLSAHE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E LIT+VVF GML+GAY+WG++SDN+GRR
Sbjct  62   ESLITSVVFVGMLVGAYAWGIVSDNYGRR  90



>gb|AFH57281.1| MFS [Gossypium hirsutum]
Length=482

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL    FG+FQ +VL YAGLG+  +AME+M+LSFIG +VK  W LS+ +E L++T
Sbjct  9    YTLDEALETVGFGKFQGFVLGYAGLGWFAEAMEIMILSFIGQAVKSEWQLSSGQESLLST  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVFAGML+GA +WGLLSDN+GRR  F
Sbjct  69   VVFAGMLLGANTWGLLSDNYGRRKGF  94



>ref|XP_010675319.1| PREDICTED: organic cation/carnitine transporter 7-like [Beta 
vulgaris subsp. vulgaris]
Length=497

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    YS+D+AL +  FG++Q  +L YAGLG++ +AMEVM+LSF+GP+V+  W L++ +E
Sbjct  3    DRTAIYSMDDALLSLGFGKYQTLILIYAGLGWISEAMEVMILSFVGPAVQTEWNLTSEQE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LITTVVFAGML GAY+WGL+SD +GRR  F
Sbjct  63   SLITTVVFAGMLFGAYTWGLVSDRYGRRKGF  93



>gb|KJB23424.1| hypothetical protein B456_004G097300 [Gossypium raimondii]
Length=482

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL    FG+FQ +VL YAGLG+  +AME+M+LSFIG +VK  W LS+ +E L++T
Sbjct  9    YTLDEALETVGFGKFQGFVLGYAGLGWFAEAMEIMILSFIGQAVKSEWQLSSGQESLLST  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +VFAGML+GA +WGLLSDN+GRR  F
Sbjct  69   IVFAGMLLGANTWGLLSDNYGRRKGF  94



>gb|KJB23421.1| hypothetical protein B456_004G097300, partial [Gossypium raimondii]
Length=556

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  QNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVL  512
            Q +G     A   Y++DEAL    FG+FQ +VL YAGLG+  +AME+M+LSFIG +VK  
Sbjct  70   QFHGQMDYKAAGLYTLDEALETVGFGKFQGFVLGYAGLGWFAEAMEIMILSFIGQAVKSE  129

Query  513  WGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            W LS+ +E L++T+VFAGML+GA +WGLLSDN+GRR  F
Sbjct  130  WQLSSGQESLLSTIVFAGMLLGANTWGLLSDNYGRRKGF  168



>gb|EEC82301.1| hypothetical protein OsI_26552 [Oryza sativa Indica Group]
Length=490

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+ A FGRFQ  VLAYA +G++ +AMEVMLLSF+GPSVK  WG+S A EGL+++
Sbjct  16   YTTDDALTRAGFGRFQALVLAYACVGWVAEAMEVMLLSFVGPSVKAEWGVSGAAEGLVSS  75

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVFAGMLIGA   GL+SD +GRR+ F
Sbjct  76   VVFAGMLIGACLGGLISDRYGRRIGF  101



>ref|NP_001060053.1| Os07g0571700 [Oryza sativa Japonica Group]
 dbj|BAC84668.1| putative organic cation transporter [Oryza sativa Japonica Group]
 dbj|BAF21967.1| Os07g0571700 [Oryza sativa Japonica Group]
Length=491

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+ A FGRFQ  VLAYA +G++ +AMEVMLLSF+GPSVK  WG+S A EGL+++
Sbjct  17   YTTDDALTRAGFGRFQALVLAYACVGWVAEAMEVMLLSFVGPSVKAEWGVSGAAEGLVSS  76

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVFAGMLIGA   GL+SD +GRR+ F
Sbjct  77   VVFAGMLIGACLGGLISDRYGRRIGF  102



>ref|XP_004957629.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X3 [Setaria italica]
Length=491

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL    FG+F  +VLAY+G+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  2    EDGVSTYTVDEALVFMGFGKFHAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAY+WG++SDN+GRR+ F F+
Sbjct  62   ESLITSVVFVGMLVGAYAWGIVSDNYGRRVGFNFT  96



>ref|XP_004957627.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=503

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL    FG+F  +VLAY+G+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  14   EDGVSTYTVDEALVFMGFGKFHAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  73

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            E LIT+VVF GML+GAY+WG++SDN+GRR+ F F+
Sbjct  74   ESLITSVVFVGMLVGAYAWGIVSDNYGRRVGFNFT  108



>ref|XP_010087072.1| Organic cation/carnitine transporter 7 [Morus notabilis]
 gb|EXB26127.1| Organic cation/carnitine transporter 7 [Morus notabilis]
Length=474

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL    FG F   VL+YAG+ ++ +AME+MLLSF+GP+++  WG+S+ +
Sbjct  4    EDGSKTYTVDEALVVLGFGHFHVLVLSYAGMAWISEAMEMMLLSFVGPALQSAWGISSHQ  63

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            + LIT+VVFAGMLIGAYSWG++SD  GRR
Sbjct  64   QSLITSVVFAGMLIGAYSWGIVSDKHGRR  92



>gb|KJB56470.1| hypothetical protein B456_009G120800 [Gossypium raimondii]
Length=478

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++D+AL    FG++QY+VLAYA L ++ +AME+MLLSFIGP +K +W LSA E+ LIT+
Sbjct  11   FTVDDALLTLGFGKYQYFVLAYAALAWVSEAMEMMLLSFIGPVLKRIWRLSAKEQSLITS  70

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVF GML+GAYSWG+++D +GRR  F
Sbjct  71   VVFIGMLVGAYSWGVIADKYGRRKGF  96



>ref|NP_001168223.1| hypothetical protein [Zea mays]
 gb|ACN27493.1| unknown [Zea mays]
 tpg|DAA41164.1| TPA: hypothetical protein ZEAMMB73_754098 [Zea mays]
Length=484

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            +  ++Y+ D+ALS   FGRFQ  VLAY+GLG++ +A E+MLLSF+GP+V+  WG+S AE+
Sbjct  6    EVSMHYTTDDALSLVGFGRFQTLVLAYSGLGWIAEAFEIMLLSFVGPAVEADWGISGAEQ  65

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            GLI++ VFAGMLIG+ + GL++D +GRR  F F+
Sbjct  66   GLISSAVFAGMLIGSIAGGLIADRYGRRTGFLFT  99



>ref|XP_008668303.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=491

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            +  ++Y+ D+ALS   FGRFQ  VLAY+GLG++ +A E+MLLSF+GP+V+  WG+S AE+
Sbjct  6    EVSMHYTTDDALSLVGFGRFQTLVLAYSGLGWIAEAFEIMLLSFVGPAVEADWGISGAEQ  65

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            GLI++ VFAGMLIG+ + GL++D +GRR  F F+
Sbjct  66   GLISSAVFAGMLIGSIAGGLIADRYGRRTGFLFT  99



>ref|NP_001147918.1| synaptic vesicle 2-related protein [Zea mays]
 gb|ACG29123.1| synaptic vesicle 2-related protein [Zea mays]
Length=336

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+FQ  VL YAG G+L D+ME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDDALTAMGFGKFQALVLVYAGTGWLADSMELMLLSFVGPLVRQQWNVSAQHESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            VVF GML+GA SWG +SD +GRR A  FS T
Sbjct  64   VVFTGMLLGACSWGYISDKYGRRTALLFSVT  94



>ref|XP_004983097.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
 ref|XP_004983098.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=479

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+FQ +VL YAG G+L D+ME+MLLSF+GP ++  W +SA  E L+++
Sbjct  4    YTTDDALTAMGFGKFQAFVLVYAGTGWLADSMELMLLSFVGPLIRQQWNVSAQHESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGA SWG +SD +GRR A  FS
Sbjct  64   VVFTGMLIGACSWGYISDKYGRRTALLFS  92



>ref|XP_003578642.1| PREDICTED: organic cation/carnitine transporter 7-like [Brachypodium 
distachyon]
Length=490

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+FQ +VLAY+G+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  2    EDGVPTYTVDEALVSMGFGKFQAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E LIT+VVF GML+GAY WGL+SDN+GRR
Sbjct  62   ESLITSVVFLGMLVGAYCWGLVSDNYGRR  90



>tpg|DAA46930.1| TPA: synaptic vesicle 2 protein [Zea mays]
Length=408

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+FQ  VL YAG G+L D+ME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDDALTAMGFGKFQALVLVYAGTGWLADSMELMLLSFVGPLVRQQWNVSAQHESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            VVF GML+GA SWG +SD +GRR A  FS T
Sbjct  64   VVFTGMLLGACSWGYISDKYGRRTALLFSVT  94



>ref|XP_008674891.1| PREDICTED: synaptic vesicle 2-related protein isoform X1 [Zea 
mays]
 gb|ACF84617.1| unknown [Zea mays]
 gb|ACF88099.1| unknown [Zea mays]
 tpg|DAA46929.1| TPA: synaptic vesicle 2 protein [Zea mays]
Length=467

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+FQ  VL YAG G+L D+ME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDDALTAMGFGKFQALVLVYAGTGWLADSMELMLLSFVGPLVRQQWNVSAQHESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            VVF GML+GA SWG +SD +GRR A  FS T
Sbjct  64   VVFTGMLLGACSWGYISDKYGRRTALLFSVT  94



>gb|AAR01731.1| putative sugar transporter (alternative splicing product) [Oryza 
sativa Japonica Group]
 gb|ABF97802.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=417

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ DEAL    FG+FQ  VLAYAG+G++V++ME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDEALEFMGFGKFQLLVLAYAGMGWVVESMEIMLLSFVGPLVREEWNISAENESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGMLIGA  WG +SD +GRR+   FS
Sbjct  64   VVFAGMLIGASGWGFVSDKYGRRICLLFS  92



>ref|XP_004958090.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X3 [Setaria italica]
Length=383

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            +A  +Y+ D+AL+   FGRFQ  +LAY+G+G++ +A E+MLLSF+GP+V+  WG+S AE+
Sbjct  6    EAATHYTTDDALTRVGFGRFQALLLAYSGVGWVAEAFEIMLLSFVGPAVEAEWGVSGAEQ  65

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            GLI++VVFAGMLIG+ + GL++D  GRR  F F+
Sbjct  66   GLISSVVFAGMLIGSIAGGLIADRCGRRTGFLFT  99



>gb|EAY91140.1| hypothetical protein OsI_12746 [Oryza sativa Indica Group]
Length=480

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ DEAL    FG+FQ  VLAYAG+G++V++ME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDEALEFMGFGKFQLLVLAYAGMGWVVESMEIMLLSFVGPLVREEWNISAENESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGMLIGA  WG +SD +GRR+   FS
Sbjct  64   VVFAGMLIGASGWGFVSDKYGRRICLLFS  92



>ref|NP_001050729.1| Os03g0638200 [Oryza sativa Japonica Group]
 gb|AAR01732.1| putative sugar transporter (alternative splicing product) [Oryza 
sativa Japonica Group]
 gb|ABF97800.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF97801.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF97803.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12643.1| Os03g0638200 [Oryza sativa Japonica Group]
 gb|EEE59558.1| hypothetical protein OsJ_11843 [Oryza sativa Japonica Group]
Length=480

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ DEAL    FG+FQ  VLAYAG+G++V++ME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDEALEFMGFGKFQLLVLAYAGMGWVVESMEIMLLSFVGPLVREEWNISAENESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGMLIGA  WG +SD +GRR+   FS
Sbjct  64   VVFAGMLIGASGWGFVSDKYGRRICLLFS  92



>ref|XP_004958088.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=484

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            +A  +Y+ D+AL+   FGRFQ  +LAY+G+G++ +A E+MLLSF+GP+V+  WG+S AE+
Sbjct  6    EAATHYTTDDALTRVGFGRFQALLLAYSGVGWVAEAFEIMLLSFVGPAVEAEWGVSGAEQ  65

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            GLI++VVFAGMLIG+ + GL++D  GRR  F F+
Sbjct  66   GLISSVVFAGMLIGSIAGGLIADRCGRRTGFLFT  99



>ref|XP_004958089.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=386

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            +A  +Y+ D+AL+   FGRFQ  +LAY+G+G++ +A E+MLLSF+GP+V+  WG+S AE+
Sbjct  6    EAATHYTTDDALTRVGFGRFQALLLAYSGVGWVAEAFEIMLLSFVGPAVEAEWGVSGAEQ  65

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            GLI++VVFAGMLIG+ + GL++D  GRR  F F+
Sbjct  66   GLISSVVFAGMLIGSIAGGLIADRCGRRTGFLFT  99



>ref|XP_004958087.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=440

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  345  LGGDDAGV-YYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            + GD +G   Y+ DEALS   FGRFQ  +L + G G++ +AMEVMLLSF+GPS+K  WG+
Sbjct  1    MAGDASGAETYTTDEALSRLGFGRFQALLLGFLGTGWVAEAMEVMLLSFVGPSMKEEWGV  60

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            S A EGLIT+VVFAGML+GA   GL SD +GRR  F F+
Sbjct  61   SGAAEGLITSVVFAGMLLGACVGGLGSDRYGRRAGFLFT  99



>ref|XP_002964441.1| hypothetical protein SELMODRAFT_81650 [Selaginella moellendorffii]
 gb|EFJ34774.1| hypothetical protein SELMODRAFT_81650 [Selaginella moellendorffii]
Length=460

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++D+A+ +  FGRFQ  +L YAG+ ++ +AME+MLLSF+GP+V+ LW LS  +E  I++
Sbjct  7    FTLDDAIESLGFGRFQCLILVYAGMSWMAEAMEMMLLSFVGPAVEQLWDLSPRQESTISS  66

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVFAGM+IGAYSWG+LSD+ GRR+ F
Sbjct  67   VVFAGMMIGAYSWGVLSDSKGRRIGF  92



>ref|XP_002975354.1| hypothetical protein SELMODRAFT_103160 [Selaginella moellendorffii]
 gb|EFJ23555.1| hypothetical protein SELMODRAFT_103160 [Selaginella moellendorffii]
Length=460

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++D+A+ +  FGRFQ  +L YAG+ ++ +AME+MLLSF+GP+V+ LW LS  +E  I++
Sbjct  7    FTLDDAIESLGFGRFQCLILVYAGMSWMAEAMEMMLLSFVGPAVEQLWDLSPRQESAISS  66

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVFAGM+IGAYSWG+LSD+ GRR+ F
Sbjct  67   VVFAGMMIGAYSWGVLSDSKGRRIGF  92



>ref|XP_003562078.1| PREDICTED: organic cation/carnitine transporter 7-like [Brachypodium 
distachyon]
Length=507

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +3

Query  327  PPQNYGL----GGDDAGVY--YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSF  488
            PP   GL      D+A     Y+ D+ALSA  FG+FQ  VL YAG+G++ +AMEVMLLSF
Sbjct  9    PPPTTGLCIATSMDNAASMETYTTDDALSAMGFGKFQALVLVYAGMGWVAEAMEVMLLSF  68

Query  489  IGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            +GP V+  W +SA +E L+++VVF GMLIGA  WG +SD +GRR    FS
Sbjct  69   VGPLVREEWKISAQDESLLSSVVFFGMLIGACGWGFVSDKYGRRTGLLFS  118



>dbj|BAJ98028.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+ALSA  FG+FQ  VLAYAG+G++V+AME+ LLSF+GP V+  W +SA +E L+++
Sbjct  4    YTTDDALSAMGFGKFQGLVLAYAGMGWVVEAMELNLLSFVGPLVREEWKVSAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGMLIG+ +WG +SD +GRR    FS
Sbjct  64   VVFAGMLIGSLAWGFVSDRYGRRTVLLFS  92



>ref|XP_006380839.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
 gb|ERP58636.1| hypothetical protein POPTR_0007s15120g [Populus trichocarpa]
Length=490

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  405  FGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAY  584
            FG+FQY+VL YAG+G++ +AME+M+LSFIGP+VK  W L++ +E LIT+VVFAGML+GAY
Sbjct  3    FGKFQYFVLLYAGMGWVSEAMEMMILSFIGPAVKSDWNLTSQQESLITSVVFAGMLVGAY  62

Query  585  SWGLLSDNFGRRLAF  629
            SWG++SD +GRR  F
Sbjct  63   SWGVVSDRYGRRKGF  77



>ref|XP_004958086.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=472

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  345  LGGDDAGV-YYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            + GD +G   Y+ DEALS   FGRFQ  +L + G G++ +AMEVMLLSF+GPS+K  WG+
Sbjct  1    MAGDASGAETYTTDEALSRLGFGRFQALLLGFLGTGWVAEAMEVMLLSFVGPSMKEEWGV  60

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            S A EGLIT+VVFAGML+GA   GL SD +GRR  F F+
Sbjct  61   SGAAEGLITSVVFAGMLLGACVGGLGSDRYGRRAGFLFT  99



>ref|XP_004981616.1| PREDICTED: organic cation/carnitine transporter 7-like [Setaria 
italica]
Length=472

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  345  LGGDDAGV-YYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            + GD +G   Y+ DEALS   FGRFQ  +L + G G++ +AMEVMLLSF+GPS+K  WG+
Sbjct  1    MAGDASGAETYTTDEALSRLGFGRFQALLLGFLGTGWVAEAMEVMLLSFVGPSMKEEWGV  60

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            S A EGLIT+VVFAGML+GA   GL SD +GRR  F F+
Sbjct  61   SGAAEGLITSVVFAGMLLGACVGGLGSDRYGRRAGFLFT  99



>ref|XP_001770703.1| predicted protein [Physcomitrella patens]
 gb|EDQ64527.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            + +D+A+    FG++Q W+LAYAG+ +  +AME+MLLSF+GP+V+V W L+  EE LI +
Sbjct  12   FMLDDAIEQVGFGKYQRWLLAYAGMSWTAEAMEMMLLSFVGPAVQVEWQLTGREESLIAS  71

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVF GM+IGAYSWG LSD  GRR+ F
Sbjct  72   VVFGGMMIGAYSWGALSDAKGRRVGF  97



>ref|XP_004957628.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=500

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL    FG+F  +VLAY+G+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  2    EDGVSTYTVDEALVFMGFGKFHAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E LIT+VVF GML+GAY+WG++SDN+GRR
Sbjct  62   ESLITSVVFVGMLVGAYAWGIVSDNYGRR  90



>ref|XP_006650328.1| PREDICTED: organic cation/carnitine transporter 7-like [Oryza 
brachyantha]
Length=480

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ DEAL    FG+FQ  VL YAG+G+ V+AME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDEALEHMGFGKFQVLVLVYAGMGWAVEAMEIMLLSFVGPLVREEWNVSAENESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGMLIGA  WG +SD +GRR    FS
Sbjct  64   VVFAGMLIGASGWGFVSDKYGRRTGLLFS  92



>dbj|BAK07186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=481

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+ALSA  FG+FQ  VLAYAG+G++V+AME+ LLSF+GP V+  W +SA +E L+++
Sbjct  4    YTTDDALSAMGFGKFQGLVLAYAGMGWVVEAMELNLLSFVGPLVREEWKVSAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGMLIG+ +WG +SD +GRR    FS
Sbjct  64   VVFAGMLIGSLAWGFVSDRYGRRTVLLFS  92



>ref|XP_006353753.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=473

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            ++ G  Y+++EAL+A   G+FQY  + YAGLG++ +A E M+LSFIGP+++  W LS+ +
Sbjct  6    EEDGPVYTLEEALTAVGIGKFQYMAMCYAGLGFIAEAAETMILSFIGPALRSQWTLSSTQ  65

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E L+TTVVFAGM IGA  WG ++D +GRR
Sbjct  66   ESLMTTVVFAGMFIGAIFWGFITDCYGRR  94



>ref|XP_004982357.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Setaria italica]
Length=509

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
            G  G      Y+ D AL+A  FG+FQ  VLAYAG G++ +AMEVMLLSF+GP ++  W +
Sbjct  23   GSAGSSNMETYTTDNALTAMGFGKFQALVLAYAGTGWVAEAMEVMLLSFLGPVMREEWNV  82

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            S  +E L+++VVFAGMLIGA++WG +SD +GRR
Sbjct  83   SPQDESLLSSVVFAGMLIGAFTWGFISDRYGRR  115



>ref|XP_004982358.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Setaria italica]
Length=480

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D AL+A  FG+FQ  VLAYAG G++ +AMEVMLLSF+GP ++  W +S  +E L+++
Sbjct  4    YTTDNALTAMGFGKFQALVLAYAGTGWVAEAMEVMLLSFLGPVMREEWNVSPQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGMLIGA++WG +SD +GRR
Sbjct  64   VVFAGMLIGAFTWGFISDRYGRR  86



>emb|CDP14262.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D  + Y+ ++A+S   FG+FQ  +L YAGLG++ +AME+M+LSF+G +V+  WGLS AEE
Sbjct  3    DQSISYTPEDAISGMGFGKFQGLLLVYAGLGWISEAMEMMILSFVGVAVQSEWGLSPAEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML G Y WG++SD +GRR  F
Sbjct  63   SLITSVVFAGMLAGCYFWGIISDAYGRRKGF  93



>emb|CDP14260.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            GD + V+ ++DEALS   FG FQ  +L Y  LG++ +AME+M+LSFIGP ++  W LS++
Sbjct  2    GDPSSVH-TVDEALSTIGFGNFQTVLLLYGALGWVAEAMELMILSFIGPVLQSEWRLSSS  60

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +E LI+TVVFAGMLIGAY WG +SDN+GR+  F
Sbjct  61   KESLISTVVFAGMLIGAYLWGHISDNWGRKKGF  93



>tpg|DAA50363.1| TPA: hypothetical protein ZEAMMB73_018003 [Zea mays]
Length=494

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VLAYAG+G++ +AMEVMLLSF+GP V+  W +S  +E L+++
Sbjct  88   YTTDDALTLMGFGKFQALVLAYAGMGWVAEAMEVMLLSFLGPVVREEWNVSPQDESLLSS  147

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGMLIGA +WG +SD +GR+
Sbjct  148  VVFAGMLIGACAWGFISDRYGRK  170



>gb|EYU25779.1| hypothetical protein MIMGU_mgv1a0062851mg, partial [Erythranthe 
guttata]
Length=377

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            GD  G+Y ++DEALS   FG++Q  +LAY GLG++ +AME+M+LS IG S++  W LS +
Sbjct  2    GDSEGMY-TVDEALSTVGFGKYQALLLAYGGLGWIAEAMELMILSLIGSSLQSEWLLSPS  60

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            ++ LI+TVVFAGML+GAY WG +SD +GR+
Sbjct  61   QKSLISTVVFAGMLVGAYLWGFVSDTYGRK  90



>ref|XP_002466771.1| hypothetical protein SORBIDRAFT_01g013920 [Sorghum bicolor]
 gb|EER93769.1| hypothetical protein SORBIDRAFT_01g013920 [Sorghum bicolor]
Length=479

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VLAYAG+G+L +AMEVMLLSF+GP V+  W +S  +E L+++
Sbjct  4    YTTDDALTLIGFGKFQALVLAYAGMGWLTEAMEVMLLSFLGPVVREEWNVSPEDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGMLIGA +WG +SD +GR+
Sbjct  64   VVFAGMLIGACAWGFISDRYGRK  86



>ref|XP_003562063.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010232278.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010232282.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010232286.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Brachypodium distachyon]
Length=481

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+FQ  VLAYAG+G++ +AME+ LLSF+GP V+  W +SA +E L+++
Sbjct  4    YTTDDALAAMGFGKFQALVLAYAGMGWVAEAMELNLLSFVGPLVRDEWEISAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGML G+ +WG +SD +GRR A  FS
Sbjct  64   VVFAGMLTGSCTWGFVSDKYGRRTALLFS  92



>ref|XP_004982355.1| PREDICTED: organic cation/carnitine transporter 7-like [Setaria 
italica]
Length=480

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FGRFQ  VL YAG+G++ ++ME+MLLSF+GP ++  W LS   E +I++
Sbjct  4    YTTDDALTMMGFGRFQALVLVYAGIGWVAESMELMLLSFLGPFIREEWNLSPENESMISS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGML+GA SWG +SD +GRR    FS
Sbjct  64   VVFAGMLLGACSWGFVSDKYGRRTGLLFS  92



>ref|XP_006353755.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=478

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D G  Y+++EAL++   G+FQY VL YAGLG + +A+E M+LSFIGP+++  W LS  +
Sbjct  8    EDDGSVYTMEEALTSVGIGKFQYMVLCYAGLGSISEAVETMILSFIGPALRSQWSLSPTQ  67

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E L+++VVF GMLIGA  WG ++D +GRR
Sbjct  68   ESLMSSVVFVGMLIGALFWGFITDCYGRR  96



>ref|XP_005644961.1| MFS general substrate transporter [Coccomyxa subellipsoidea C-169]
 gb|EIE20417.1| MFS general substrate transporter [Coccomyxa subellipsoidea C-169]
Length=531

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +3

Query  330  PQNYGLGGD-DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVK  506
            PQ+   GGD D G  Y++ EAL    FGRFQ  VL Y G  +  DA+E+MLLSF+GP+V+
Sbjct  12   PQDVEQGGDADEGPTYTVGEALDCIGFGRFQGMVLFYCGCAWAADAVEMMLLSFLGPAVR  71

Query  507  VLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
              WG+S + E LIT++VF G ++GAY WG+L D  GRR+
Sbjct  72   CEWGISPSAESLITSIVFCGTMLGAYGWGVLGDAKGRRV  110



>ref|XP_008680040.1| PREDICTED: synaptic vesicle 2-related protein isoform X2 [Zea 
mays]
Length=471

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VLAYAG+G++ +AMEVMLLSF+GP V+  W +S  +E L+++
Sbjct  4    YTTDDALTLMGFGKFQALVLAYAGMGWVAEAMEVMLLSFLGPVVREEWNVSPQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGMLIGA +WG +SD +GR+
Sbjct  64   VVFAGMLIGACAWGFISDRYGRK  86



>ref|XP_008680034.1| PREDICTED: synaptic vesicle 2-related protein isoform X1 [Zea 
mays]
Length=479

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VLAYAG+G++ +AMEVMLLSF+GP V+  W +S  +E L+++
Sbjct  4    YTTDDALTLMGFGKFQALVLAYAGMGWVAEAMEVMLLSFLGPVVREEWNVSPQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGMLIGA +WG +SD +GR+
Sbjct  64   VVFAGMLIGACAWGFISDRYGRK  86



>ref|NP_001151801.1| synaptic vesicle 2-related protein [Zea mays]
 gb|ACG44352.1| synaptic vesicle 2-related protein [Zea mays]
Length=479

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VLAYAG+G++ +AMEVMLLSF+GP V+  W +S  +E L+++
Sbjct  4    YTTDDALTLMGFGKFQALVLAYAGMGWVAEAMEVMLLSFLGPVVREEWNVSPQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGMLIGA +WG +SD +GR+
Sbjct  64   VVFAGMLIGACAWGFISDRYGRK  86



>tpg|DAA50366.1| TPA: hypothetical protein ZEAMMB73_510449 [Zea mays]
Length=86

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VL YAG+G++ +AME+MLLSF+GP ++  W +S   E L+++
Sbjct  4    YTTDDALTIMGFGKFQALVLFYAGMGWVAEAMELMLLSFLGPFIREEWNVSPENESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRR  620
            VVFAGML+GA +WG +SD +GRR
Sbjct  64   VVFAGMLLGACAWGFVSDKYGRR  86



>emb|CDP14261.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D  +  + +EA+S   FG+FQ  +L +AGLG++ +AME+M+LSF+G +V+  WGLS AEE
Sbjct  3    DQSIGCTPEEAISVIGFGKFQGLILVFAGLGWISEAMEMMILSFVGVAVQSEWGLSPAEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
             LIT+VVFAGML+G   WG++SD +GRR AF
Sbjct  63   SLITSVVFAGMLVGCSFWGIISDAYGRRKAF  93



>gb|ABF97804.1| major facilitator superfamily protein, expressed [Oryza sativa 
Japonica Group]
Length=469

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ DEAL    FG+FQ  VLAYAG+G++V++ME+MLLSF+GP V+  W +SA  E L+++
Sbjct  4    YTTDEALEFMGFGKFQLLVLAYAGMGWVVESMEIMLLSFVGPLVREEWNISAENESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGR  617
            VVFAGMLIGA  WG +SD +GR
Sbjct  64   VVFAGMLIGASGWGFVSDKYGR  85



>ref|XP_006353754.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
tuberosum]
Length=477

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D GVY +++EAL++   G+FQY VL YAGLG + +A+E M+LSFIGP+++  W LS  +
Sbjct  8    EDGGVY-TMEEALTSVGIGKFQYMVLCYAGLGSISEAVETMILSFIGPALRSQWSLSPTQ  66

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E L+++VVF GMLIGA  WG ++D +GRR
Sbjct  67   ESLMSSVVFVGMLIGALFWGFITDCYGRR  95



>ref|XP_004243672.1| PREDICTED: organic cation/carnitine transporter 7-like [Solanum 
lycopersicum]
Length=476

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            DD+   Y+++EAL++   G+FQY VL YAGLG + +A+E M+LSFIGP+++  W LS  +
Sbjct  8    DDS--VYTMEEALTSVGIGKFQYMVLCYAGLGSVSEAVETMILSFIGPALRSQWALSPTQ  65

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E L++TVVF GMLIGA  WG ++D++GRR
Sbjct  66   ESLMSTVVFVGMLIGALFWGFITDSYGRR  94



>gb|EPS64332.1| hypothetical protein M569_10450, partial [Genlisea aurea]
Length=478

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            ++    Y++DEALS   FG FQ + L ++G+GY  DAME+ LLSFIGP++K  W L+  +
Sbjct  2    EEGSSEYTLDEALSRLGFGTFQVYALLFSGIGYFSDAMEMSLLSFIGPALKSEWSLTPIQ  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E LITTVVF GML GA  WGL++D+FGR+
Sbjct  62   ESLITTVVFVGMLCGAVFWGLIADSFGRK  90



>dbj|BAJ87550.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+ Q  VL YAG+G++ +AMEVMLLSF+GP ++  W +SA +E L+++
Sbjct  4    YTTDDALTAMGFGKLQGLVLVYAGMGWVAEAMEVMLLSFVGPLIREEWKISAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGA  WG +SD +GRR    FS
Sbjct  64   VVFLGMLIGACGWGYVSDKYGRRTGLLFS  92



>gb|KJB23415.1| hypothetical protein B456_004G097400 [Gossypium raimondii]
Length=483

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL +  FG+FQ +VLAYAGLG+  +AME+M+LSFIG +VK  WGLS+++E L++T
Sbjct  9    YTLDEALESLGFGKFQAFVLAYAGLGWFAEAMEIMILSFIGQAVKSEWGLSSSQESLLST  68

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +VFAGM+IGAY WG +SD +GRR  F
Sbjct  69   IVFAGMVIGAYGWGTISDTYGRRTGF  94



>gb|EMS51638.1| Synaptic vesicle 2-related protein [Triticum urartu]
Length=462

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+ Q  VL YAG+G++ +AMEVMLLSF+GP ++  W +SA +E L+++
Sbjct  4    YTTDDALTAMGFGKLQGLVLVYAGMGWVAEAMEVMLLSFVGPLIREEWKISAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSYTR  647
            VVF GMLIGA  WG +SD +GRR  F F + +
Sbjct  64   VVFLGMLIGACGWGYVSDKYGRRRIFIFIFDK  95



>dbj|BAJ90022.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85415.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+ Q  VL YAG+G++ +AMEVMLLSF+GP ++  W +SA +E L+++
Sbjct  4    YTTDDALTAMGFGKLQGLVLVYAGMGWVAEAMEVMLLSFVGPLIREEWKISAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGA  WG +SD +GRR    FS
Sbjct  64   VVFLGMLIGACGWGYVSDKYGRRTGLLFS  92



>ref|XP_011093922.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X1 [Sesamum indicum]
Length=497

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 4/110 (4%)
 Frame = +3

Query  303  MIDVEDVVPPQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLL  482
            MI   +VV P       +D G  Y++DEALS+  FG FQ   L +AG+G+  DAMEV LL
Sbjct  1    MIKNGEVVSPFEM----EDQGNGYTVDEALSSVGFGTFQVLSLVFAGIGWCSDAMEVTLL  56

Query  483  SFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFR  632
            SFIGP+++  W LS  EE L++T VF GML+G+Y  G ++D +GRR   R
Sbjct  57   SFIGPALESEWSLSPTEESLLSTAVFGGMLVGSYFLGFIADAYGRRTGIR  106



>ref|XP_011093915.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=486

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            GDD    Y++DEALS+  FG FQ   L +AG+G   DAME+ LLSFIGP+++  W LS  
Sbjct  2    GDDESGGYTVDEALSSVGFGAFQGLALVFAGIGCFSDAMEITLLSFIGPALESEWSLSPT  61

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFR  632
            EE L++T VF GML+GAY  G ++D +GRR+  R
Sbjct  62   EESLLSTAVFGGMLVGAYFMGFIADAYGRRVGIR  95



>gb|EMT10389.1| Synaptic vesicle 2-related protein [Aegilops tauschii]
Length=534

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+ Q  VL YAG+G++ +AMEVMLLSF+GP ++  W +SA +E L+++
Sbjct  97   YTTDDALTTMGFGKLQGLVLVYAGMGWVAEAMEVMLLSFVGPLIREEWKISAQDESLLSS  156

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGA  WG +SD +GRR    FS
Sbjct  157  VVFLGMLIGACGWGYVSDKYGRRTGLLFS  185



>ref|XP_011093923.1| PREDICTED: organic cation/carnitine transporter 7-like isoform 
X2 [Sesamum indicum]
Length=485

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D G  Y++DEALS+  FG FQ   L +AG+G+  DAMEV LLSFIGP+++  W LS  E
Sbjct  2    EDQGNGYTVDEALSSVGFGTFQVLSLVFAGIGWCSDAMEVTLLSFIGPALESEWSLSPTE  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFR  632
            E L++T VF GML+G+Y  G ++D +GRR   R
Sbjct  62   ESLLSTAVFGGMLVGSYFLGFIADAYGRRTGIR  94



>ref|XP_002466770.1| hypothetical protein SORBIDRAFT_01g013910 [Sorghum bicolor]
 gb|EER93768.1| hypothetical protein SORBIDRAFT_01g013910 [Sorghum bicolor]
Length=483

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VL YAG+G++ +AME+MLLSF+GP ++  W +S   E L+++
Sbjct  8    YTTDDALTMMGFGKFQALVLFYAGMGWVAEAMELMLLSFLGPFIREEWNVSPENESLLSS  67

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGML+GA +WG +SD +GRR    FS
Sbjct  68   VVFAGMLLGACAWGFVSDKYGRRTGLIFS  96



>ref|NP_001106048.1| major facilitator superfamily protein [Zea mays]
 gb|ABQ63093.1| major facilitator superfamily protein [Zea mays]
 gb|ABR12535.1| major facilitator superfamily protein [Zea mays]
 gb|ACG30552.1| synaptic vesicle 2-related protein [Zea mays]
 gb|ACN36562.1| unknown [Zea mays]
 tpg|DAA50364.1| TPA: proteinSynaptic vesicle 2 protein , Major facilitator superfamily 
isoform 1 [Zea mays]
 tpg|DAA50365.1| TPA: proteinSynaptic vesicle 2 protein , Major facilitator superfamily 
isoform 2 [Zea mays]
Length=479

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+FQ  VL YAG+G++ +AME+MLLSF+GP ++  W +S   E L+++
Sbjct  4    YTTDDALTIMGFGKFQALVLFYAGMGWVAEAMELMLLSFLGPFIREEWNVSPENESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGML+GA +WG +SD +GRR    FS
Sbjct  64   VVFAGMLLGACAWGFVSDKYGRRTGLIFS  92



>gb|AGX85880.1| copper transporter [Triticum aestivum]
 gb|AGX85881.1| copper transporter [Triticum aestivum]
 gb|AGX85883.1| copper transporter [Triticum aestivum]
 gb|AGX85884.1| copper transporter [Triticum aestivum]
Length=479

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+A  FG+ Q  VL YAG+G++ +AMEVMLLSF+GP ++  W +SA +E L+++
Sbjct  4    YTTDDALTAMGFGKLQGLVLVYAGMGWVAEAMEVMLLSFVGPLIREEWKISAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGA  WG +SD +GRR     S
Sbjct  64   VVFLGMLIGACGWGYVSDKYGRRTGLLLS  92



>gb|EMT10390.1| Putative transporter [Aegilops tauschii]
Length=469

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +3

Query  405  FGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAY  584
            FGRFQ  VLAYAG+G++V+AME+ LLSF+GP V+  W +SA +E L+++VVFAGMLIG+ 
Sbjct  3    FGRFQALVLAYAGMGWVVEAMELNLLSFVGPLVREEWKVSAQDESLLSSVVFAGMLIGSC  62

Query  585  SWGLLSDNFGRRLAFRFS  638
            +WG +SD +GRR    FS
Sbjct  63   AWGFVSDRYGRRTVLLFS  80



>ref|XP_011093924.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
 ref|XP_011093926.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
 ref|XP_011093927.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=482

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D  + Y++DEALS   FG FQ   L +AG+ +  +AME+ LLSFIGP+VK  W LS  EE
Sbjct  3    DPSLGYTLDEALSTVGFGTFQALALVFAGISWFSEAMEMNLLSFIGPAVKSEWSLSPTEE  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFR  632
             L++T VF GML+GA  WG +SD +GRR+  +
Sbjct  63   SLLSTAVFGGMLVGALFWGFVSDAYGRRIGMQ  94



>gb|AGX85879.1| copper transporter [Triticum aestivum]
 gb|AGX85882.1| copper transporter [Triticum aestivum]
Length=479

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ D+AL+   FG+ Q  VL YAG+G++ +AMEVMLLSF+GP ++  W +SA +E L+++
Sbjct  4    YTTDDALTTMGFGKLQGLVLVYAGMGWVAEAMEVMLLSFVGPLIREEWKISAQDESLLSS  63

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF GMLIGA  WG +SD +GRR     S
Sbjct  64   VVFLGMLIGACGWGYVSDKYGRRTGLLLS  92



>ref|XP_011094025.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=492

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            GD     Y++DEALS+  FG FQ   L +AG+G+  DAME+ LLSFIGP+++  W LS  
Sbjct  3    GDRESDGYTVDEALSSVGFGTFQGLALVFAGIGWFADAMEITLLSFIGPALESEWSLSPT  62

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFR  632
            EE L++T VF GM++G+Y  G ++D +GRR+  R
Sbjct  63   EESLLSTAVFGGMIVGSYFLGFIADAYGRRMGIR  96



>ref|XP_001753056.1| predicted protein [Physcomitrella patens]
 gb|EDQ82097.1| predicted protein, partial [Physcomitrella patens]
Length=465

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +3

Query  405  FGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAY  584
            FG+FQ  +L Y GL +L DA E++LLSFIGPS K  WGLS+ EEG IT+ VFAG+ +GAY
Sbjct  2    FGKFQLGILTYTGLAWLADAAEMILLSFIGPSAKCEWGLSSFEEGAITSAVFAGIFVGAY  61

Query  585  SWGLLSDNFGRRLAF  629
             WGL+SD  GRRL F
Sbjct  62   VWGLVSDMKGRRLGF  76



>ref|XP_003081589.1| Synaptic vesicle transporter SVOP and related transporters (major 
facilitator superfamily) (ISS) [Ostreococcus tauri]
Length=825

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +3

Query  366  VYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLI  545
            + Y   +AL A  FG FQ  +LA+ GL +  DAME+MLLSF+GP+++  +G+    EGL+
Sbjct  1    MRYRAADALDAMGFGSFQVMILAFVGLAWTADAMEMMLLSFLGPAMRCEFGVGKTAEGLL  60

Query  546  TTVVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            T+VVFAGM+IGA SWG +SD  GRR A   S T
Sbjct  61   TSVVFAGMMIGAPSWGAMSDQRGRRPALLGSAT  93



>emb|CEF99356.1| Major facilitator superfamily domain, general substrate transporter 
[Ostreococcus tauri]
Length=545

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y   +AL A  FG FQ  +LA+ GL +  DAME+MLLSF+GP+++  +G+    EGL+T+
Sbjct  62   YRAADALDAMGFGSFQVMILAFVGLAWTADAMEMMLLSFLGPAMRCEFGVGKTAEGLLTS  121

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            VVFAGM+IGA SWG +SD  GRR A   S T
Sbjct  122  VVFAGMMIGAPSWGAMSDQRGRRPALLGSAT  152



>ref|XP_006372273.1| hypothetical protein POPTR_0018s14860g [Populus trichocarpa]
 gb|ERP50070.1| hypothetical protein POPTR_0018s14860g [Populus trichocarpa]
Length=515

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  PQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKV  509
            P    +  D   + Y++DEAL++  FG+FQ  VL YAGL +   AMEVM+LSF+GP+VK 
Sbjct  4    PAETSVRTDGENLVYTVDEALASVGFGKFQGLVLVYAGLAWFAYAMEVMILSFVGPAVKS  63

Query  510  LWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
             W LS+++E L++T VF GMLIG++ WGL+SD+ GRR
Sbjct  64   QWDLSSSQESLLSTAVFGGMLIGSFFWGLVSDHHGRR  100



>ref|XP_002499721.1| major facilitator superfamily [Micromonas sp. RCC299]
 gb|ACO60979.1| major facilitator superfamily [Micromonas sp. RCC299]
Length=537

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++DEA+    FG FQ  +L   GL ++ DAME+MLLSF+GP+ +  WG+S  +EG++T+
Sbjct  39   WTVDEAIDEIGFGPFQLVMLCVTGLAWMGDAMEMMLLSFLGPAARCEWGISPRQEGMLTS  98

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVF GML GA +WG ++D  GR+LAF
Sbjct  99   VVFVGMLFGAPTWGQIADWKGRKLAF  124



>ref|XP_006450736.1| hypothetical protein CICLE_v10010744mg, partial [Citrus clementina]
 gb|ESR63976.1| hypothetical protein CICLE_v10010744mg, partial [Citrus clementina]
Length=76

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 14/82 (17%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+   FGRFQ  VL YAGLG + +AME              W LS A+E L+T+
Sbjct  9    YTLDEALNHVGFGRFQILVLVYAGLGLVAEAME--------------WNLSPAQETLLTS  54

Query  552  VVFAGMLIGAYSWGLLSDNFGR  617
            VVFAG+L+G+YSWG +SDN+GR
Sbjct  55   VVFAGLLVGSYSWGFISDNYGR  76



>ref|NP_498960.2| Protein SVOP-1 [Caenorhabditis elegans]
 sp|P30638.5|YOU1_CAEEL RecName: Full=Putative transporter ZK637.1 [Caenorhabditis elegans]
 emb|CAA77460.2| SVOP-1 [Caenorhabditis elegans]
Length=520

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D+   +++DEA+ A  FGRFQ  +    G+ ++ DAME+MLLS I P++   WG+S+ ++
Sbjct  62   DSEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQ  121

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             L+TT VF+GM++ +  WG + D FGRR    FS
Sbjct  122  ALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFS  155



>ref|XP_001420126.1| MFS family transporter: sugar [Ostreococcus lucimarinus CCE9901]
 gb|ABO98419.1| MFS family transporter: sugar [Ostreococcus lucimarinus CCE9901]
Length=576

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+ +EAL    FG+FQ   L + G  +  DAME+MLLSFIGP+++  +G+S+  EG +T+
Sbjct  86   YTANEALDHVGFGKFQIHALCFVGFAWAADAMEMMLLSFIGPAMRCEFGVSSDAEGALTS  145

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFSYT  644
            VVF GM +GA +WG++SD  GR+ A  FS T
Sbjct  146  VVFVGMALGAPAWGVVSDARGRKPALLFSST  176



>gb|EGT56656.1| hypothetical protein CAEBREN_14991 [Caenorhabditis brenneri]
Length=536

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEA+ A  FGRFQ  +    G+ ++ DAME+MLLS I P++   WG+S+ ++
Sbjct  62   DQEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGVSSVQQ  121

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             L+TT VF+GM++ +  WG + D FGRR    FS
Sbjct  122  ALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFS  155



>ref|XP_003093994.1| hypothetical protein CRE_16352 [Caenorhabditis remanei]
 gb|EFO92687.1| hypothetical protein CRE_16352 [Caenorhabditis remanei]
Length=522

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++DEA+ A  FGRFQ  +    G+ ++ DAME+MLLS I P++   WG+S+ ++ L+TT
Sbjct  69   FTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTT  128

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             VF+GM++ +  WG + D FGRR    FS
Sbjct  129  CVFSGMMLSSTFWGKICDRFGRRKGLTFS  157



>ref|XP_005849521.1| hypothetical protein CHLNCDRAFT_142865 [Chlorella variabilis]
 gb|EFN57419.1| hypothetical protein CHLNCDRAFT_142865 [Chlorella variabilis]
Length=550

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
                 + S+  AL    FGR Q  +L Y GL +L D+ E MLLSF+GP+V   WG+  A 
Sbjct  2    QQGSAHTSVTAALDDVGFGRVQVLLLCYCGLAWLADSCETMLLSFLGPAVHCAWGVQPAA  61

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            E L+T+VVF GML+G YS G+ SD  GRR  F
Sbjct  62   ESLLTSVVFVGMLLGVYSLGIASDYLGRRRGF  93



>gb|KDO73388.1| hypothetical protein CISIN_1g0117562mg [Citrus sinensis]
Length=478

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++DEAL+   FG+FQ   LAY+GLG+  +AMEVM+LSF+GP+VK  WGLS++EE LITT
Sbjct  10   YTLDEALTFMGFGKFQGLALAYSGLGWFSEAMEVMILSFVGPAVKSEWGLSSSEESLITT  69

Query  552  VVFAGML  572
            VVFAGM+
Sbjct  70   VVFAGMM  76



>ref|XP_005089214.1| PREDICTED: putative transporter ZK637.1-like [Aplysia californica]
Length=390

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  351  GDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAA  530
            G DA    S+ EA+    FG+FQ  +    GL Y+ DAME+MLLS + P ++  W L+ A
Sbjct  35   GKDA-TRLSMQEAIDKLGFGKFQIHLSIMTGLCYMSDAMEIMLLSILSPELQCTWQLTGA  93

Query  531  EEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRF  635
            +E L+TT VFAGM + +  WGLL D +GRR    F
Sbjct  94   QEALLTTAVFAGMAVSSNVWGLLFDKYGRRFGLLF  128



>emb|CDJ95219.1| Major facilitator superfamily MFS-1 domain containing protein 
[Haemonchus contortus]
Length=154

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 63/101 (62%), Gaps = 2/101 (2%)
 Frame = +3

Query  330  PQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKV  509
            P +  L  ++A   +++ +A+ A  FGRFQ  +    G+ ++ DAME+MLLS + P++  
Sbjct  55   PADQQLSEENA--TFTVHDAVEALGFGRFQVKLSLLTGIAWMADAMEMMLLSLLSPAIAC  112

Query  510  LWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFR  632
             WG+S  ++ L+TT VF+GM++ +  WG   D FGRR+  R
Sbjct  113  EWGVSPVQQALVTTCVFSGMMLSSTFWGKTCDRFGRRVVGR  153



>ref|XP_002630184.1| Hypothetical protein CBG00590 [Caenorhabditis briggsae]
Length=560

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEA+ A  FGRFQ  +    G+ ++ DAME+MLLS I P++   W +S+ ++
Sbjct  62   DQEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACQWQISSVQQ  121

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             L+TT VF+GM++ +  WG + D FGRR    FS
Sbjct  122  ALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFS  155



>emb|CAP22038.2| Protein CBG00590 [Caenorhabditis briggsae]
Length=523

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D    +++DEA+ A  FGRFQ  +    G+ ++ DAME+MLLS I P++   W +S+ ++
Sbjct  62   DQEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACQWQISSVQQ  121

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             L+TT VF+GM++ +  WG + D FGRR    FS
Sbjct  122  ALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFS  155



>ref|XP_011093928.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
 ref|XP_011093929.1| PREDICTED: organic cation/carnitine transporter 7-like [Sesamum 
indicum]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            D+   Y++DEAL+   FG++Q  +LAY GLG++ +AME+M+LSF+G +V+  W LS+ ++
Sbjct  3    DSDTVYTLDEALTTVGFGKYQGLLLAYGGLGWVAEAMEMMILSFVGSAVQSEWHLSSGQK  62

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
              I+TVVF GML+GAY WG++SDN+GR+  F
Sbjct  63   SSISTVVFFGMLVGAYFWGVVSDNYGRKKGF  93



>gb|KHN77735.1| Putative transporter [Toxocara canis]
Length=168

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +3

Query  315  EDVVPPQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIG  494
            ED + P +     D     +++DEA+    FG+FQ  +    GL ++ DAME+ +L+ + 
Sbjct  39   EDALQPPS----PDKKPTSFTVDEAVELLGFGKFQIKLSILTGLAWMADAMEMTILAIVS  94

Query  495  PSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            P+++  WG++A E+ +ITTVVF+GM++ +  WG + D FGR+
Sbjct  95   PALQCDWGITAIEQAMITTVVFSGMMLSSTFWGNICDRFGRK  136



>dbj|GAA47694.1| putative transporter SVOPL [Clonorchis sinensis]
Length=1141

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D  G  Y++++A+ AA FGRFQ  +    G+    DAME++LLS +GP+++  W LS+ E
Sbjct  628  DSEGKTYTVEDAVEAAGFGRFQLLLCVICGVLMAADAMEMLLLSILGPALRCSWLLSSEE  687

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGR  617
               ITTVVFAG LIG+  WG +SD FGR
Sbjct  688  IAAITTVVFAGFLIGSPIWGFVSDRFGR  715



>ref|XP_011399231.1| Synaptic vesicle 2-related protein [Auxenochlorella protothecoides]
 gb|KFM26335.1| Synaptic vesicle 2-related protein [Auxenochlorella protothecoides]
Length=487

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  405  FGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAY  584
            FGRFQ+ +LAY GL +L DA E MLLSF+G +VK  WGL++++   +T+VVFAGM+ G Y
Sbjct  12   FGRFQWLLLAYTGLAWLADACETMLLSFLGLAVKCDWGLTSSQAAALTSVVFAGMMAGVY  71

Query  585  SWGLLSDNFGRRLAF  629
            + G L+D  GRR  F
Sbjct  72   TLGALADQLGRRRGF  86



>ref|XP_002160694.2| PREDICTED: synaptic vesicle 2-related protein-like [Hydra vulgaris]
Length=353

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +S+++A+ A  FG+FQ  VLA  G  +  D++E+ LL+ + P+++  W L+   E  +TT
Sbjct  57   FSVEDAIEAVGFGKFQTKVLAMVGFAWSADSLEMALLAILAPAIRCEWNLTHWHEAFLTT  116

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLA  626
            +VF GM +  Y WG +SDNFGRR A
Sbjct  117  IVFVGMFVATYFWGFVSDNFGRRKA  141



>ref|XP_009857552.1| PREDICTED: synaptic vesicle 2-related protein [Ciona intestinalis]
Length=507

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            ++++EA+ A  FGRFQ+ +    G  ++ DAME+M+LS I P +K  W L + EE LITT
Sbjct  42   FTVEEAVEAIGFGRFQWILSMLTGCAWMADAMELMILSIISPQLKCEWRLYSYEEALITT  101

Query  552  VVFAGMLIGAYSWGLLSDNFGRRL  623
            VVF GM++ +  WG + D +GR+L
Sbjct  102  VVFVGMMLSSSMWGNICDRYGRKL  125



>ref|XP_002679296.1| predicted protein [Naegleria gruberi]
 gb|EFC46552.1| predicted protein [Naegleria gruberi]
Length=518

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +3

Query  342  GLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGL  521
             + GD+   + S+D+A+     G+FQ  +L   G+ ++ DA E+MLLSFI P+V+ +W L
Sbjct  48   NINGDEK--FISVDDAIEWMGVGKFQIILLFVCGIAWMADACEIMLLSFIMPAVRDIWNL  105

Query  522  SAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
             +AEE  I  +VFAGMLIG+  WG + D FGR++
Sbjct  106  GSAEEATIGGIVFAGMLIGSSFWGFICDRFGRKI  139



>emb|CAR63523.1| putative synaptic vesicle 2-related protein [Angiostrongylus 
cantonensis]
Length=523

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++D+A+ A  FGRFQ  +    G+ ++ DAME+MLLS + P+V   WG+++ ++ L+TT
Sbjct  71   FTVDDAVEALGFGRFQVKLSILTGIAWMADAMEMMLLSLLSPAVACEWGVTSVQQALVTT  130

Query  552  VVFAGMLIGAYSWGLLSDNFGRRL  623
             VF+GM++ +  WG   D FGRR+
Sbjct  131  CVFSGMMLSSTFWGKTCDRFGRRV  154



>ref|XP_008303324.1| PREDICTED: synaptic vesicle 2-related protein-like [Stegastes 
partitus]
Length=543

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 0/98 (0%)
 Frame = +3

Query  345  LGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLS  524
             G D     +++DEAL A  FG+FQ+ +    GL ++ DAME+M+LS +GP +   W L 
Sbjct  59   CGSDKIEETFTVDEALEAIGFGKFQWKISLLTGLSWVADAMEMMILSILGPQLHCEWRLP  118

Query  525  AAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            + +  LIT+VVF GM I +  WG +SD +GRR+    S
Sbjct  119  SYQVALITSVVFVGMGISSPVWGNVSDKYGRRVGLTIS  156



>gb|KHN39387.1| Organic cation/carnitine transporter 7 [Glycine soja]
Length=448

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  MEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            ME+M+LSF+GP+V+  W LSA EE LIT+VVFAGMLIGAYSWG++SD  GRR  F
Sbjct  1    MEMMILSFVGPAVQTAWNLSAHEESLITSVVFAGMLIGAYSWGIVSDKHGRRKGF  55



>ref|WP_013970067.1| MFS transporter [Treponema caldaria]
 gb|AEJ20789.1| major facilitator superfamily MFS_1 [Treponema caldaria DSM 7334]
Length=441

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  369  YYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLIT  548
            + S+D  +    +GRFQ  +L   GLG+  DAMEVML+SF  P++   W LSAA++GL+ 
Sbjct  3    HLSLDPLVEQVGYGRFQRRLLWVCGLGWAADAMEVMLVSFALPAMAAEWSLSAAQKGLLA  62

Query  549  TVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            T +F GML GA  WG LSD  GR+L F
Sbjct  63   TALFVGMLAGALIWGRLSDLIGRKLGF  89



>emb|CEF66864.1| Synaptic vesicle 2-related protein [Strongyloides ratti]
Length=525

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++D+A+    FG+FQ  +    GL ++ DAME+M+LS + P++   WG+++ E+ +ITT
Sbjct  71   FTVDDAIEFLGFGKFQIKISLLTGLAWMADAMEMMILSILSPALHCEWGITSVEQAMITT  130

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVF+GM + +  WG + D FGR++    S
Sbjct  131  VVFSGMFLSSTVWGKICDRFGRKIGLMCS  159



>emb|CBY08424.1| unnamed protein product [Oikopleura dioica]
Length=474

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            D+    ++++EA+  A FGRFQ+ +    G+ ++ DAME+M+LS I P+++  W L + +
Sbjct  23   DENEARFTVEEAVEKAGFGRFQWRLSILTGMAWMADAMELMILSIIAPALRCEWKLDSWK  82

Query  534  EGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
            E L++TVVF GM+  +  WG + D  GRR
Sbjct  83   EALVSTVVFVGMMCSSAFWGKICDRHGRR  111



>ref|XP_011018199.1| PREDICTED: organic cation/carnitine transporter 7-like [Populus 
euphratica]
Length=366

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  444  LGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
            LG++ +AME+M+LS +GP VK  W LS  +E L++TVVFAGML+GA+SWGL+SD +GRR 
Sbjct  18   LGWIAEAMELMILSLVGPVVKSQWDLSPGQESLLSTVVFAGMLVGAFSWGLVSDYYGRRQ  77

Query  624  A  626
            A
Sbjct  78   A  78



>emb|CDI99902.1| synaptic vesicle 2 protein [Echinococcus multilocularis]
 emb|CDS37184.1| synaptic vesicle 2 protein [Echinococcus multilocularis]
Length=512

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = +3

Query  345  LGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLS  524
            LGG      Y+I+EA+ A   G FQ+ V+   G+    +AME++LLS +GP ++  W L+
Sbjct  10   LGGTLPAKTYTIEEAVEAYGLGWFQFRVVIICGILQAANAMEMLLLSVLGPVLRCSWQLN  69

Query  525  AAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +++  LITTVVF G   GA  WGL SD FGR+  F
Sbjct  70   SSQVALITTVVFIGFFFGAPIWGLFSDRFGRKRCF  104



>emb|CDS19134.1| synaptic vesicle 2 protein [Echinococcus granulosus]
Length=513

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = +3

Query  345  LGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLS  524
            LGG      Y+I+EA+ A   G FQ+ V+   G+    +AME++LLS +GP ++  W L+
Sbjct  11   LGGTLPTKTYTIEEAVEAYGLGWFQFRVVIICGILQAANAMEMLLLSVLGPVLRCAWQLN  70

Query  525  AAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +++  LITTVVF G   GA  WGL SD FGR+  F
Sbjct  71   SSQVALITTVVFIGFFFGAPIWGLFSDRFGRKRCF  105



>gb|AAX26472.2| SJCHGC03275 protein [Schistosoma japonicum]
Length=217

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +3

Query  336  NYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLW  515
            N  + GD++   +++++A+ +A  GRFQ  +    G     DAME++LLS +GP+++  W
Sbjct  44   NEVITGDNSSPTHTVEDAVESAGLGRFQLKLFVLCGAISAADAMEMLLLSVLGPALRCYW  103

Query  516  GLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGR  617
             LS+ +   +TTVVFAG L GA  WG ++D FGR
Sbjct  104  LLSSGQVAALTTVVFAGFLFGAPLWGFIADRFGR  137



>ref|XP_002611883.1| hypothetical protein BRAFLDRAFT_83090 [Branchiostoma floridae]
 gb|EEN67892.1| hypothetical protein BRAFLDRAFT_83090 [Branchiostoma floridae]
Length=689

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +3

Query  345  LGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLS  524
            L  D +   +++++A+ A  FGRFQ  +    GL ++ DAME+M+LS + P +   W LS
Sbjct  73   LEKDTSEDTFTVEDAVEAIGFGRFQIKLSVLTGLSWMADAMEMMILSILSPQLLCEWQLS  132

Query  525  AAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRL  623
            + +E  ITT+VF GM++ +  WG + D +GRRL
Sbjct  133  SWQEAFITTIVFIGMMVSSSMWGNICDRYGRRL  165



>ref|XP_002463060.1| hypothetical protein SORBIDRAFT_02g036920 [Sorghum bicolor]
 gb|EER99581.1| hypothetical protein SORBIDRAFT_02g036920 [Sorghum bicolor]
Length=466

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 18/94 (19%)
 Frame = +3

Query  357  DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEE  536
            +A ++Y+ D+ALS   FGRFQ  VLAY+GLG++ +A E+MLLSF+GP+V+  WG+S AE+
Sbjct  6    EASMHYTTDDALSLVGFGRFQTLVLAYSGLGWVAEAFEIMLLSFVGPAVEEDWGISGAEQ  65

Query  537  GLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            GLI                  +D +GRR  F F+
Sbjct  66   GLI------------------ADRYGRRTGFLFT  81



>gb|ELU03924.1| hypothetical protein CAPTEDRAFT_110202 [Capitella teleta]
Length=418

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            YS+++A+  + FG FQ  + A AG  ++ D+MEVM++S IGP +   W LS+ +E LI+T
Sbjct  31   YSVEDAIEHSGFGSFQVKLSAIAGFAWMADSMEVMVVSIIGPVLACEWVLSSTQEALIST  90

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            VVFAGM++G+ + G + D +GRR+A   S
Sbjct  91   VVFAGMMLGSPALGYVGDAYGRRVALILS  119



>ref|XP_010748702.1| PREDICTED: synaptic vesicle 2-related protein-like [Larimichthys 
crocea]
Length=543

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +3

Query  348  GGD-DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLS  524
            GGD +  V +++D+AL A  FG+FQ+ +    GL ++ D+ME+MLLS +GP +   W L 
Sbjct  56   GGDSEPEVTFTVDDALEAIGFGKFQWKISLLTGLSWIGDSMEMMLLSILGPQLHCEWKLP  115

Query  525  AAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAF  629
            +    +IT+VVFAGM IG+  WG ++D +GR+++ 
Sbjct  116  SFMVAIITSVVFAGMGIGSPVWGNIADKYGRKISL  150



>ref|XP_005710322.1| unnamed protein product [Chondrus crispus]
 emb|CDF40028.1| unnamed protein product [Chondrus crispus]
Length=588

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y+++EA+S    G FQY +LA  GL +  ++ME++LLSFI   ++  W ++  +  +ITT
Sbjct  35   YTVEEAISHIGVGNFQYGLLAMTGLCWTAESMEMLLLSFIKAPLQCQWHITDPQAAMITT  94

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
             V  GML+GA SWGL+ D +GRR+ F
Sbjct  95   SVGIGMLLGATSWGLIGDRYGRRVGF  120



>ref|XP_006817913.1| PREDICTED: synaptic vesicle 2-related protein-like [Saccoglossus 
kowalevskii]
Length=537

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++++A+ A  FG+FQ  +   AGL ++ DAME+M+LS + P +  +W L + +E LITT
Sbjct  66   FTVEDAVEAIGFGKFQIKLSLLAGLCWMADAMEMMILSILSPELHCIWKLKSWQEALITT  125

Query  552  VVFAGMLIGAYSWGLLSDNFGRRL  623
            VVF GM + +  WG + D +GRR+
Sbjct  126  VVFIGMFMSSTIWGSICDKYGRRV  149



>ref|XP_010785049.1| PREDICTED: synaptic vesicle 2-related protein-like [Notothenia 
coriiceps]
Length=545

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +3

Query  348  GGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSA  527
            G D     +++DEAL A  FG+FQ+ +    GL ++ DAME+M+LS + P +   W L  
Sbjct  60   GLDQHEETFTVDEALEAIGFGKFQWKMSVVTGLSWVADAMEMMILSILAPQLHCEWKLPG  119

Query  528  AEEGLITTVVFAGMLIGAYSWGLLSDNFGRR  620
             +  LIT+VVFAGM +G+  WG +SD +GR+
Sbjct  120  YQVALITSVVFAGMGVGSPLWGNMSDTYGRK  150



>emb|CCD81671.1| putative sugar transporter [Schistosoma mansoni]
Length=631

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 3/109 (3%)
 Frame = +3

Query  300  SMIDVEDVVPPQNYGLGGD---DAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAME  470
            + ID ED+    +   G D        Y++++A+ +A FGRFQ  +    G     DAME
Sbjct  170  TRIDSEDLDKSNSSRNGLDTEKKPNPTYTVEDAVESAGFGRFQLKLFVLCGAISAADAME  229

Query  471  VMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGR  617
            ++LLS +GP+++  W LS+ +   ITTVVFAG L GA  WG ++D FGR
Sbjct  230  MLLLSVLGPALRCYWLLSSGQVAAITTVVFAGFLFGAPLWGFIADRFGR  278



>gb|EFX74666.1| hypothetical protein DAPPUDRAFT_199755 [Daphnia pulex]
Length=538

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++D+A++A  FGRFQ  +    GL ++ D+ME+M+LS I P++K  W L   ++ L+TT
Sbjct  73   FTVDQAVNATGFGRFQVKLSLITGLSWMADSMEMMILSIISPALKCDWRLPDWKQALVTT  132

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             VF GM++ A  WG LSD +GR+ A   S
Sbjct  133  GVFLGMMMSAVFWGQLSDKYGRKKALALS  161



>gb|ELU14236.1| hypothetical protein CAPTEDRAFT_220893 [Capitella teleta]
Length=539

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++D+A+ A  FG+FQ  +  + G+ ++ DAME+M+LS + P++   W LS   + L+TT
Sbjct  67   YTVDQAVDAIGFGKFQLKLSLFTGIVWMADAMEMMILSILAPALHCYWDLSPIYQALLTT  126

Query  552  VVFAGMLIGAYSWGLLSDNFGRRL  623
            VVFAGM++ +  WG + D +GR++
Sbjct  127  VVFAGMMVSSGMWGKICDKYGRKI  150



>gb|KGB38224.1| Synaptic vesicle 2-related protein, partial [Schistosoma haematobium]
Length=552

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++++A+ AA FGRFQ  +    G     DAME++LLS +GP+++  W LS+ +   ITT
Sbjct  57   YTVEDAVEAAGFGRFQLKLFILCGAISAADAMEMLLLSVLGPALRCYWLLSSGQVAAITT  116

Query  552  VVFAGMLIGAYSWGLLSDNFGR  617
            VVFAG L GA  WG ++D FGR
Sbjct  117  VVFAGFLFGAPLWGFIADRFGR  138



>ref|XP_007510245.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18590.1| predicted protein [Bathycoccus prasinos]
Length=639

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            Y++++A+    FG+FQ   LA  GL +L DAME+MLLSFIGP+ +  W L+  +   +T+
Sbjct  90   YTVEQAIDYIGFGKFQMVFLAVTGLSWLCDAMEMMLLSFIGPAARCEWRLTTTQASSLTS  149

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
             VF GM  GA S+G+ +D  GR  + R S
Sbjct  150  FVFLGMGFGAPSFGMFADRKGRLFSLRCS  178



>ref|XP_011350681.1| PREDICTED: synaptic vesicle 2-related protein isoform X1 [Cerapachys 
biroi]
 gb|EZA46890.1| Synaptic vesicle 2-related protein [Cerapachys biroi]
Length=520

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +3

Query  372  YSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITT  551
            +++ +A++A  FG+FQ  +  + GL ++VD+ME+ +LS + PS+   WG+S  ++ L TT
Sbjct  58   FTVVQAINALGFGKFQVKLSLFTGLCWMVDSMEITILSILSPSLHCDWGISRYQQALTTT  117

Query  552  VVFAGMLIGAYSWGLLSDNFGRRLAF  629
            VVF GM++ +  W +LSD +GR+ A 
Sbjct  118  VVFLGMMLSSTFWNILSDRYGRKQAL  143



>gb|EEE70213.1| hypothetical protein OsJ_30325 [Oryza sativa Japonica Group]
Length=489

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (65%), Gaps = 5/97 (5%)
 Frame = +3

Query  354  DDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAE  533
            +D    Y++DEAL +  FG+FQ +VLAY+G+  + +AME+MLLSF+G SV+  W LSA  
Sbjct  26   EDGVSTYTVDEALISMGFGKFQAFVLAYSGMAKISEAMEMMLLSFVGQSVQAEWELSAQA  85

Query  534  EGLITTVVFAGMLIGAYSWGLLS---DNFGRRLAFRF  635
            E LIT+VVF  ++ G    GLLS    N+   +  RF
Sbjct  86   ESLITSVVFVALVTGGA--GLLSAFAPNYLSLIVLRF  120



>ref|XP_003453944.1| PREDICTED: synaptic vesicle 2-related protein-like [Oreochromis 
niloticus]
Length=544

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +3

Query  285  IPNVFSMIDVEDVVPPQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDA  464
            I  + S  D E  V   +   G +     +++D+AL A  FG+FQ+ +    GL ++ DA
Sbjct  40   ICTIASNFDAE--VTQSSSASGSNKPEETFTVDDALEAIGFGKFQWKISFLTGLSWVADA  97

Query  465  MEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            ME+M+LS +GP +   W L + +  LIT+VVF GM I +  WG ++D +GR++  + S
Sbjct  98   MEMMILSILGPQLHCEWRLPSYKVALITSVVFVGMGISSPIWGNVADKYGRKVGLKVS  155



>ref|XP_001774058.1| predicted protein [Physcomitrella patens]
 gb|EDQ61110.1| predicted protein [Physcomitrella patens]
Length=474

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  426  VLAYAGLGYLVDAMEVMLLSFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSD  605
            +L Y GL +L DA E++LLSFIGP+ K  WGL + +EG I++ VF G+ +GAY WGL+SD
Sbjct  3    ILTYTGLAWLADASEMILLSFIGPAAKCEWGLPSFQEGAISSSVFVGIFVGAYIWGLVSD  62

Query  606  NFGRRLAF  629
              GRR+ F
Sbjct  63   IKGRRVGF  70



>ref|XP_009908006.1| PREDICTED: synaptic vesicle 2-related protein [Picoides pubescens]
Length=539

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 67/112 (60%), Gaps = 4/112 (4%)
 Frame = +3

Query  306  IDVEDVVP-PQNYGLGGDDAGVYYSIDEALSAAEFGRFQYWVLAYAGLGYLVDAMEVMLL  482
            +++ED  P P+ +    DD    + +++A+ A  FG+FQ+ +    GL ++ DAME+M+L
Sbjct  38   VELEDGAPVPKEFANPTDDT---FMVEDAVEAIGFGKFQWKLSIITGLAWMADAMEMMIL  94

Query  483  SFIGPSVKVLWGLSAAEEGLITTVVFAGMLIGAYSWGLLSDNFGRRLAFRFS  638
            S + P +   W L + +  L+T+VVF GM+  +  WG +SD +GR+   + S
Sbjct  95   SILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKIS  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1593558888600