BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041L12

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625617.1|  PREDICTED: uncharacterized protein LOC104116463    234   1e-71   Nicotiana tomentosiformis
ref|XP_009781567.1|  PREDICTED: uncharacterized protein LOC104230446    228   3e-69   Nicotiana sylvestris
ref|XP_004228549.1|  PREDICTED: uncharacterized protein LOC101249752    221   2e-66   Solanum lycopersicum
ref|XP_006348525.1|  PREDICTED: uncharacterized protein LOC102597...    218   4e-65   Solanum tuberosum [potatoes]
ref|XP_006348523.1|  PREDICTED: uncharacterized protein LOC102597...    217   4e-65   Solanum tuberosum [potatoes]
ref|XP_011086570.1|  PREDICTED: uncharacterized protein LOC105168...    216   1e-64   Sesamum indicum [beniseed]
ref|XP_007044668.1|  Domain of Uncharacterized protein function i...    217   3e-64   
ref|XP_007044669.1|  Domain of Uncharacterized protein function i...    215   3e-64   
ref|XP_011086569.1|  PREDICTED: uncharacterized protein LOC105168...    213   2e-63   Sesamum indicum [beniseed]
gb|KDP26597.1|  hypothetical protein JCGZ_17755                         213   2e-63   Jatropha curcas
ref|XP_002525367.1|  conserved hypothetical protein                     213   3e-63   Ricinus communis
ref|XP_008221831.1|  PREDICTED: uncharacterized protein LOC103321776    210   2e-62   Prunus mume [ume]
gb|KJB15570.1|  hypothetical protein B456_002G185100                    208   1e-61   Gossypium raimondii
gb|KJB15571.1|  hypothetical protein B456_002G185100                    208   1e-61   Gossypium raimondii
ref|XP_007044670.1|  Domain of Uncharacterized protein function i...    208   2e-61   
ref|XP_006483874.1|  PREDICTED: uncharacterized protein LOC102618...    206   4e-61   Citrus sinensis [apfelsine]
ref|XP_007222563.1|  hypothetical protein PRUPE_ppa008383mg             207   4e-61   Prunus persica
ref|XP_006438370.1|  hypothetical protein CICLE_v10032036mg             206   1e-60   Citrus clementina [clementine]
ref|XP_002315692.2|  hypothetical protein POPTR_0010s05140g             206   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010251230.1|  PREDICTED: uncharacterized protein LOC104593182    206   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_006483871.1|  PREDICTED: uncharacterized protein LOC102618...    206   2e-60   
ref|XP_008389656.1|  PREDICTED: uncharacterized protein LOC103451974    201   2e-60   
gb|KJB61048.1|  hypothetical protein B456_009G337600                    205   2e-60   Gossypium raimondii
ref|XP_006390884.1|  hypothetical protein EUTSA_v10019595mg             203   7e-60   
emb|CDP00160.1|  unnamed protein product                                203   1e-59   Coffea canephora [robusta coffee]
ref|XP_008353017.1|  PREDICTED: uncharacterized protein LOC103416...    203   1e-59   
ref|XP_002887303.1|  hypothetical protein ARALYDRAFT_894859             202   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_010427823.1|  PREDICTED: uncharacterized protein LOC104712594    202   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002265077.1|  PREDICTED: uncharacterized protein LOC100244891    201   4e-59   Vitis vinifera
ref|XP_010552646.1|  PREDICTED: uncharacterized protein LOC104822970    202   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_011463200.1|  PREDICTED: uncharacterized protein LOC101307881    201   5e-59   Fragaria vesca subsp. vesca
ref|XP_010415726.1|  PREDICTED: uncharacterized protein LOC104701686    201   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006300944.1|  hypothetical protein CARUB_v10021325mg             201   9e-59   Capsella rubella
ref|XP_011011119.1|  PREDICTED: uncharacterized protein LOC105115...    201   9e-59   Populus euphratica
ref|NP_564989.1|  uncharacterized protein                               200   9e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471039.1|  PREDICTED: uncharacterized protein LOC104750885    200   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_011011117.1|  PREDICTED: uncharacterized protein LOC105115...    201   1e-58   Populus euphratica
ref|NP_001031261.1|  uncharacterized protein                            200   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003552022.1|  PREDICTED: uncharacterized protein LOC100781...    200   2e-58   Glycine max [soybeans]
gb|AAM64384.1|  unknown                                                 199   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50220.1|  hypothetical protein B456_008G159400                    200   3e-58   Gossypium raimondii
gb|KHN25530.1|  hypothetical protein glysoja_043966                     198   7e-58   Glycine soja [wild soybean]
gb|AAA79703.1|  OBP32pep                                                195   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KHG03137.1|  hypothetical protein F383_26743                         197   2e-57   Gossypium arboreum [tree cotton]
ref|XP_006438371.1|  hypothetical protein CICLE_v10032036mg             196   2e-57   
ref|XP_008353020.1|  PREDICTED: uncharacterized protein LOC103416...    197   3e-57   Malus domestica [apple tree]
ref|XP_003532005.1|  PREDICTED: uncharacterized protein LOC100808...    197   4e-57   Glycine max [soybeans]
gb|KHN26884.1|  hypothetical protein glysoja_035523                     196   4e-57   Glycine soja [wild soybean]
ref|XP_006840743.1|  hypothetical protein AMTR_s00096p00135790          195   2e-56   
ref|XP_010100449.1|  hypothetical protein L484_027761                   194   3e-56   
ref|XP_010023547.1|  PREDICTED: uncharacterized protein LOC104414205    194   3e-56   Eucalyptus grandis [rose gum]
ref|XP_010925756.1|  PREDICTED: uncharacterized protein LOC105048...    194   4e-56   Elaeis guineensis
ref|XP_004956598.1|  PREDICTED: uncharacterized protein LOC101756968    196   4e-56   Setaria italica
ref|XP_009105709.1|  PREDICTED: uncharacterized protein LOC103831...    193   5e-56   
ref|XP_004509756.1|  PREDICTED: uncharacterized protein LOC101489238    194   6e-56   Cicer arietinum [garbanzo]
gb|ACJ86261.1|  unknown                                                 189   9e-56   Medicago truncatula
emb|CDY47136.1|  BnaA08g05470D                                          192   1e-55   Brassica napus [oilseed rape]
ref|XP_008812484.1|  PREDICTED: uncharacterized protein LOC103723...    192   2e-55   Phoenix dactylifera
ref|XP_008812483.1|  PREDICTED: uncharacterized protein LOC103723...    192   2e-55   Phoenix dactylifera
gb|KHG05657.1|  Trimethylamine-N-oxide reductase                        192   3e-55   Gossypium arboreum [tree cotton]
ref|XP_004143071.1|  PREDICTED: uncharacterized protein LOC101212235    192   4e-55   Cucumis sativus [cucumbers]
emb|CDY11589.1|  BnaC06g31500D                                          191   4e-55   Brassica napus [oilseed rape]
ref|XP_004166540.1|  PREDICTED: uncharacterized protein LOC101230152    191   4e-55   
ref|XP_008444321.1|  PREDICTED: uncharacterized protein LOC103487688    191   7e-55   Cucumis melo [Oriental melon]
gb|KEH20028.1|  OBP32pep, putative                                      191   9e-55   Medicago truncatula
gb|KEH20026.1|  OBP32pep, putative                                      191   2e-54   Medicago truncatula
gb|KEH20027.1|  OBP32pep, putative                                      191   2e-54   Medicago truncatula
ref|XP_007153742.1|  hypothetical protein PHAVU_003G061200g             189   3e-54   Phaseolus vulgaris [French bean]
ref|XP_006661122.1|  PREDICTED: uncharacterized protein LOC102713573    189   3e-54   Oryza brachyantha
ref|XP_009394240.1|  PREDICTED: uncharacterized protein LOC103979763    188   9e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT22456.1|  hypothetical protein F775_02661                         186   1e-52   
ref|XP_003577995.1|  PREDICTED: uncharacterized protein LOC100824540    185   1e-52   Brachypodium distachyon [annual false brome]
gb|EYU31258.1|  hypothetical protein MIMGU_mgv1a009978mg                177   1e-49   Erythranthe guttata [common monkey flower]
dbj|BAD23602.1|  hypothetical protein                                   177   4e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462231.1|  hypothetical protein SORBIDRAFT_02g022180          184   1e-48   
ref|XP_010682540.1|  PREDICTED: uncharacterized protein LOC104897377    171   2e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS62234.1|  hypothetical protein M569_12558                         166   4e-46   Genlisea aurea
ref|XP_006416072.1|  hypothetical protein EUTSA_v10008158mg             164   2e-44   Eutrema salsugineum [saltwater cress]
ref|XP_010551585.1|  PREDICTED: uncharacterized protein LOC104822...    160   2e-43   
ref|XP_009110090.1|  PREDICTED: uncharacterized protein LOC103835...    158   2e-42   
ref|XP_009110088.1|  PREDICTED: uncharacterized protein LOC103835...    158   3e-42   
ref|XP_009109809.1|  PREDICTED: uncharacterized protein LOC103835402    157   3e-42   Brassica rapa
gb|AAM63743.1|  unknown                                                 155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564197.1|  uncharacterized protein                               155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551589.1|  PREDICTED: uncharacterized protein LOC104822...    154   2e-41   
emb|CDY57831.1|  BnaCnng32520D                                          154   3e-41   Brassica napus [oilseed rape]
emb|CDY41434.1|  BnaA08g20360D                                          155   5e-41   Brassica napus [oilseed rape]
gb|KDO82400.1|  hypothetical protein CISIN_1g040266mg                   150   2e-40   Citrus sinensis [apfelsine]
gb|KFK44441.1|  hypothetical protein AALP_AA1G256900                    152   4e-40   Arabis alpina [alpine rockcress]
ref|XP_006305312.1|  hypothetical protein CARUB_v10009689mg             150   3e-39   Capsella rubella
ref|XP_010477648.1|  PREDICTED: uncharacterized protein LOC104756719    148   1e-38   Camelina sativa [gold-of-pleasure]
gb|AAF79591.1|AC007945_11  F28C11.19                                    155   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893289.1|  hypothetical protein ARALYDRAFT_472619             146   6e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_010460141.1|  PREDICTED: uncharacterized protein LOC104741066    146   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_001766483.1|  predicted protein                                  144   2e-37   
emb|CDY69075.1|  BnaCnng61760D                                          142   4e-36   Brassica napus [oilseed rape]
ref|XP_001771562.1|  predicted protein                                  140   8e-36   
ref|XP_001766244.1|  predicted protein                                  138   2e-35   
emb|CDY25798.1|  BnaA07g09840D                                          140   2e-35   Brassica napus [oilseed rape]
ref|XP_002964647.1|  hypothetical protein SELMODRAFT_82450              136   4e-35   
ref|XP_009103781.1|  PREDICTED: uncharacterized protein LOC103829839    142   4e-35   
ref|XP_006602384.1|  PREDICTED: uncharacterized protein LOC100781...    126   6e-31   Glycine max [soybeans]
ref|XP_006585947.1|  PREDICTED: uncharacterized protein LOC100808...    122   3e-29   
ref|XP_001752924.1|  predicted protein                                  120   5e-29   
gb|KJB61050.1|  hypothetical protein B456_009G337600                    121   8e-29   Gossypium raimondii
gb|EMS64572.1|  hypothetical protein TRIUR3_17734                       112   1e-25   Triticum urartu
gb|KJB15572.1|  hypothetical protein B456_002G185100                    110   7e-25   Gossypium raimondii
ref|XP_001781678.1|  predicted protein                                  105   8e-24   
ref|XP_010925764.1|  PREDICTED: uncharacterized protein LOC105048...    104   1e-22   Elaeis guineensis
ref|XP_006303494.1|  hypothetical protein CARUB_v10010830mg           96.3    5e-20   
ref|XP_010477660.1|  PREDICTED: uncharacterized protein LOC104756729  95.5    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010498904.1|  PREDICTED: uncharacterized protein LOC104776515  91.7    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006306513.1|  hypothetical protein CARUB_v10012512mg           90.5    5e-18   
ref|NP_173781.1|  uncharacterized protein                             90.5    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893302.1|  hypothetical protein ARALYDRAFT_313228           90.5    6e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_002893292.1|  hypothetical protein ARALYDRAFT_889900           88.6    2e-17   
ref|XP_006416069.1|  hypothetical protein EUTSA_v10009760mg           90.5    2e-17   
ref|NP_973899.1|  uncharacterized protein                             88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001175778.1|  Os09g0327550                                     83.6    3e-17   
gb|AAC98018.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  88.2    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65908.1|  putative OBP32pep protein                             87.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477663.1|  PREDICTED: uncharacterized protein LOC104756...  87.4    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010477662.1|  PREDICTED: uncharacterized protein LOC104756731  86.7    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006304415.1|  hypothetical protein CARUB_v10010990mg           86.7    1e-16   
ref|NP_173773.1|  uncharacterized protein                             86.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893300.1|  hypothetical protein ARALYDRAFT_472628           85.9    2e-16   
ref|XP_010477659.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  87.4    3e-16   
ref|XP_002893290.1|  hypothetical protein ARALYDRAFT_889898           84.7    5e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010498871.1|  PREDICTED: uncharacterized protein LOC104776...  84.7    6e-16   
ref|XP_010498870.1|  PREDICTED: uncharacterized protein LOC104776...  84.7    6e-16   Camelina sativa [gold-of-pleasure]
gb|KFK44442.1|  hypothetical protein AALP_AA1G257000                  83.6    1e-15   Arabis alpina [alpine rockcress]
ref|XP_005645855.1|  hypothetical protein COCSUDRAFT_43073            83.2    1e-15   Coccomyxa subellipsoidea C-169
ref|NP_173771.1|  uncharacterized protein                             82.8    2e-15   
ref|XP_006416070.1|  hypothetical protein EUTSA_v10008632mg           82.4    3e-15   
ref|XP_006304618.1|  hypothetical protein CARUB_v10011702mg           82.4    4e-15   
ref|XP_006416071.1|  hypothetical protein EUTSA_v10010034mg           82.0    5e-15   Eutrema salsugineum [saltwater cress]
ref|XP_001751964.1|  predicted protein                                79.3    6e-15   
ref|NP_001077590.1|  uncharacterized protein                          81.3    7e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25792.1|  BnaA07g09900D                                        81.6    7e-15   Brassica napus [oilseed rape]
ref|XP_010477655.1|  PREDICTED: uncharacterized protein LOC104756...  80.9    7e-15   
ref|XP_002893298.1|  hypothetical protein ARALYDRAFT_335602           81.3    7e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_010477661.1|  PREDICTED: uncharacterized protein LOC104756730  81.3    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010477654.1|  PREDICTED: uncharacterized protein LOC104756...  81.3    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006304377.1|  hypothetical protein CARUB_v10010870mg           80.9    9e-15   
ref|XP_002893287.1|  hypothetical protein ARALYDRAFT_472615           80.9    1e-14   
ref|XP_010480622.1|  PREDICTED: uncharacterized protein LOC104759384  81.3    1e-14   
ref|XP_009103161.1|  PREDICTED: uncharacterized protein LOC103829263  81.3    1e-14   Brassica rapa
ref|XP_002893294.1|  hypothetical protein ARALYDRAFT_889902           81.3    1e-14   
emb|CDY54285.1|  BnaC07g48260D                                        80.9    1e-14   Brassica napus [oilseed rape]
ref|NP_173778.1|  uncharacterized protein                             80.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498860.1|  PREDICTED: uncharacterized protein LOC104776...  79.3    3e-14   
ref|XP_010498861.1|  PREDICTED: uncharacterized protein LOC104776...  79.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|NP_564199.1|  uncharacterized protein                             78.6    4e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25797.1|  BnaA07g09850D                                        79.7    4e-14   Brassica napus [oilseed rape]
ref|NP_001077588.1|  uncharacterized protein                          78.2    4e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54284.1|  BnaC07g48250D                                        79.7    5e-14   Brassica napus [oilseed rape]
gb|AAC98015.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  78.2    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185072.1|  uncharacterized protein                          77.4    5e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAC98021.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  78.6    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477666.1|  PREDICTED: uncharacterized protein LOC104756...  77.8    8e-14   
ref|XP_006416065.1|  hypothetical protein EUTSA_v10008137mg           78.2    1e-13   
ref|NP_173766.1|  uncharacterized protein                             77.8    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103162.1|  PREDICTED: uncharacterized protein LOC103829264  78.6    1e-13   Brassica rapa
emb|CDY25794.1|  BnaA07g09880D                                        79.0    1e-13   Brassica napus [oilseed rape]
emb|CDY25796.1|  BnaA07g09860D                                        79.0    1e-13   Brassica napus [oilseed rape]
ref|XP_006304583.1|  hypothetical protein CARUB_v10011627mg           77.4    2e-13   Capsella rubella
ref|XP_010477665.1|  PREDICTED: uncharacterized protein LOC104756...  77.0    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006396882.1|  hypothetical protein EUTSA_v10028680mg           79.0    2e-13   
ref|XP_006306553.1|  hypothetical protein CARUB_v10012640mg           76.6    3e-13   Capsella rubella
ref|XP_006416064.1|  hypothetical protein EUTSA_v10009581mg           75.9    3e-13   
gb|KFK40097.1|  hypothetical protein AALP_AA3G330000                  76.3    4e-13   Arabis alpina [alpine rockcress]
gb|AAC98019.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  75.9    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306474.1|  hypothetical protein CARUB_v10012439mg           75.5    6e-13   
ref|XP_010460143.1|  PREDICTED: uncharacterized protein LOC104741068  75.1    7e-13   
ref|XP_010498869.1|  PREDICTED: uncharacterized protein LOC104776...  75.1    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010460137.1|  PREDICTED: uncharacterized protein LOC104741...  75.1    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010460138.1|  PREDICTED: uncharacterized protein LOC104741...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
gb|KFK44439.1|  hypothetical protein AALP_AA1G256700                  73.9    2e-12   Arabis alpina [alpine rockcress]
emb|CDY25791.1|  BnaA07g09910D                                        73.9    3e-12   Brassica napus [oilseed rape]
ref|XP_009103163.1|  PREDICTED: uncharacterized protein LOC103829265  73.9    3e-12   Brassica rapa
ref|XP_010498902.1|  PREDICTED: uncharacterized protein LOC104776...  73.9    3e-12   Camelina sativa [gold-of-pleasure]
ref|NP_173776.2|  uncharacterized protein                             75.5    3e-12   
ref|XP_002893297.1|  hypothetical protein ARALYDRAFT_889905           73.2    4e-12   
gb|AAC98013.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  73.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893296.1|  hypothetical protein ARALYDRAFT_889904           71.6    6e-12   
gb|KFK44440.1|  hypothetical protein AALP_AA1G256800                  73.6    7e-12   Arabis alpina [alpine rockcress]
ref|XP_010477651.1|  PREDICTED: uncharacterized protein LOC104756721  72.8    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002893291.1|  hypothetical protein ARALYDRAFT_313224           71.6    2e-11   Arabidopsis lyrata subsp. lyrata
emb|CDY54286.1|  BnaC07g48270D                                        70.9    3e-11   Brassica napus [oilseed rape]
ref|XP_005845419.1|  hypothetical protein CHLNCDRAFT_137004           71.2    4e-11   Chlorella variabilis
gb|KFK44436.1|  hypothetical protein AALP_AA1G256300                  68.9    8e-11   Arabis alpina [alpine rockcress]
ref|XP_006416066.1|  hypothetical protein EUTSA_v10008137mg           70.1    1e-10   
ref|XP_010477658.1|  PREDICTED: uncharacterized protein LOC104756...  67.8    3e-10   
ref|XP_006416076.1|  hypothetical protein EUTSA_v10008486mg           67.8    4e-10   
ref|NP_564196.3|  uncharacterized protein                             66.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477644.1|  PREDICTED: uncharacterized protein LOC104756716  67.4    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011400565.1|  hypothetical protein F751_0254                   66.2    6e-10   Auxenochlorella protothecoides
ref|NP_973898.2|  uncharacterized protein                             65.1    8e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51642.1|  BnaC05g50890D                                        67.0    8e-10   Brassica napus [oilseed rape]
gb|AAC98007.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  66.6    9e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79594.1|AC007945_14  F28C11.14                                  66.6    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893286.1|  hypothetical protein ARALYDRAFT_472613           66.6    1e-09   
ref|XP_010477657.1|  PREDICTED: uncharacterized protein LOC104756...  67.0    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009115510.1|  PREDICTED: uncharacterized protein LOC103840745  66.6    1e-09   Brassica rapa
ref|XP_006306462.1|  hypothetical protein CARUB_v10012413mg           66.6    2e-09   Capsella rubella
ref|XP_010510745.1|  PREDICTED: uncharacterized protein LOC104786963  66.6    2e-09   Camelina sativa [gold-of-pleasure]
emb|CDX91720.1|  BnaC08g06390D                                        65.9    3e-09   
ref|XP_002879144.1|  predicted protein                                65.5    4e-09   
emb|CDY20855.1|  BnaC05g26370D                                        64.3    7e-09   Brassica napus [oilseed rape]
ref|XP_010498901.1|  PREDICTED: uncharacterized protein LOC104776...  64.7    8e-09   
emb|CDY41441.1|  BnaA08g20430D                                        65.5    8e-09   Brassica napus [oilseed rape]
emb|CDX91721.1|  BnaC08g06400D                                        65.1    9e-09   
ref|XP_009110091.1|  PREDICTED: uncharacterized protein LOC103835654  64.3    9e-09   
ref|XP_005849858.1|  hypothetical protein CHLNCDRAFT_57275            63.9    1e-08   Chlorella variabilis
ref|XP_006296266.1|  hypothetical protein CARUB_v10025431mg           64.3    1e-08   Capsella rubella
gb|KFK44435.1|  hypothetical protein AALP_AA1G256300                  62.8    1e-08   Arabis alpina [alpine rockcress]
ref|XP_009110093.1|  PREDICTED: uncharacterized protein LOC103835656  63.9    1e-08   Brassica rapa
ref|NP_180335.2|  uncharacterized protein                             63.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY16800.1|  BnaA09g05820D                                        63.2    2e-08   Brassica napus [oilseed rape]
ref|XP_009112003.1|  PREDICTED: uncharacterized protein LOC103837396  63.2    2e-08   Brassica rapa
gb|KDO35994.1|  hypothetical protein CISIN_1g044713mg                 59.7    3e-08   Citrus sinensis [apfelsine]
ref|XP_006303770.1|  hypothetical protein CARUB_v10011997mg           62.0    5e-08   Capsella rubella
gb|KDO36897.1|  hypothetical protein CISIN_1g034097mg                 59.3    5e-08   Citrus sinensis [apfelsine]
ref|XP_009110095.1|  PREDICTED: uncharacterized protein LOC103835660  60.8    1e-07   
emb|CDY59740.1|  BnaCnng35460D                                        60.5    2e-07   Brassica napus [oilseed rape]
emb|CDX87227.1|  BnaC09g05420D                                        60.5    2e-07   
emb|CDY41435.1|  BnaA08g20370D                                        59.3    6e-07   Brassica napus [oilseed rape]
ref|XP_002893299.1|  hypothetical protein ARALYDRAFT_313226           57.4    2e-06   
ref|XP_010480623.1|  PREDICTED: uncharacterized protein LOC104759388  55.8    2e-06   Camelina sativa [gold-of-pleasure]
emb|CDY57833.1|  BnaCnng32530D                                        57.4    3e-06   Brassica napus [oilseed rape]
ref|XP_009116772.1|  PREDICTED: uncharacterized protein LOC103841...  55.8    7e-06   Brassica rapa
ref|XP_009110094.1|  PREDICTED: uncharacterized protein LOC103835657  55.5    1e-05   
gb|AAC98020.1|  Similar to OBP32pep protein gb|U37698 from Arabid...  54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185073.1|  uncharacterized protein                          54.3    2e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY72266.1|  BnaCnng76800D                                        53.5    3e-05   Brassica napus [oilseed rape]
emb|CDY52335.1|  BnaA09g38840D                                        53.9    4e-05   Brassica napus [oilseed rape]
ref|XP_002958776.1|  hypothetical protein VOLCADRAFT_108304           53.9    4e-05   Volvox carteri f. nagariensis
gb|KFK39653.1|  hypothetical protein AALP_AA3G272000                  52.0    4e-05   Arabis alpina [alpine rockcress]
ref|XP_006416078.1|  hypothetical protein EUTSA_v10010008mg           53.1    6e-05   
ref|XP_009110750.1|  PREDICTED: uncharacterized protein LOC103836254  53.5    6e-05   
ref|XP_002893301.1|  hypothetical protein ARALYDRAFT_889909           41.6    1e-04   
emb|CDY70554.1|  BnaCnng68830D                                        52.0    2e-04   Brassica napus [oilseed rape]
gb|KIY98108.1|  hypothetical protein MNEG_9855                        51.6    2e-04   Monoraphidium neglectum
ref|NP_001077589.1|  uncharacterized protein                          50.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ52692.1|  expressed protein                                     48.9    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115516.1|  PREDICTED: uncharacterized protein LOC103840...  50.8    4e-04   Brassica rapa
emb|CDY04704.1|  BnaC05g18850D                                        50.8    5e-04   
ref|XP_009115518.1|  PREDICTED: uncharacterized protein LOC103840...  50.4    5e-04   Brassica rapa
ref|XP_009115048.1|  PREDICTED: uncharacterized protein LOC103840304  50.1    8e-04   Brassica rapa
emb|CDY57836.1|  BnaCnng32560D                                        50.1    8e-04   Brassica napus [oilseed rape]



>ref|XP_009625617.1| PREDICTED: uncharacterized protein LOC104116463 [Nicotiana tomentosiformis]
 ref|XP_009625618.1| PREDICTED: uncharacterized protein LOC104116463 [Nicotiana tomentosiformis]
Length=337

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = +2

Query  221  MKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFV  400
            MK + Q+ +I  + S+   +L+  ++H F S FQ K+++ +KSNFKR++   D  +SS +
Sbjct  1    MKTEGQSTDILENTSNVHNKLAHPMIHSFFSGFQEKVQECVKSNFKRLKMRHDTSISSII  60

Query  401  --GKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAV  574
                +GA  ++ VD EKQ+Q WKENP+W D PP+IKV+VPKGSLCNL  KVNVGLPP+ V
Sbjct  61   RGNNRGASAVIDVDKEKQLQSWKENPSWVDQPPDIKVSVPKGSLCNLCVKVNVGLPPETV  120

Query  575  YNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            Y+IV DPENKRVFKNI++V+SRKVL+DEG RQVVELEQAA+W+FLWWSGTI+VHVLVDQN
Sbjct  121  YDIVTDPENKRVFKNIKEVVSRKVLVDEGLRQVVELEQAAIWRFLWWSGTIAVHVLVDQN  180

Query  755  R  757
            R
Sbjct  181  R  181



>ref|XP_009781567.1| PREDICTED: uncharacterized protein LOC104230446 [Nicotiana sylvestris]
 ref|XP_009781568.1| PREDICTED: uncharacterized protein LOC104230446 [Nicotiana sylvestris]
 ref|XP_009781569.1| PREDICTED: uncharacterized protein LOC104230446 [Nicotiana sylvestris]
Length=334

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 142/181 (78%), Gaps = 5/181 (3%)
 Frame = +2

Query  221  MKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKR--MRRDGDVLMSS  394
            M+ + Q+ +I  + S+   +L+  ++H F S FQ K+++ +KSNFKR  MR D  ++  +
Sbjct  1    MRTEGQSTDILENTSNVHNKLAHPMIHSFFSGFQEKVQECVKSNFKRLKMRHDTSIMRGN  60

Query  395  FVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAV  574
                +GA  ++ +D EKQ+Q WKENP+W D PP+IKV+VPKGSLCNL  KVNVGLPP+ V
Sbjct  61   ---NRGASAVIDLDKEKQLQSWKENPSWVDQPPDIKVSVPKGSLCNLCVKVNVGLPPETV  117

Query  575  YNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            Y+IV DPENKRVFKNI++V+SRKVL+DEG RQVVELEQAA+W+FLWWSGTI+VHVLVDQN
Sbjct  118  YDIVTDPENKRVFKNIKEVVSRKVLVDEGLRQVVELEQAAIWRFLWWSGTIAVHVLVDQN  177

Query  755  R  757
            R
Sbjct  178  R  178



>ref|XP_004228549.1| PREDICTED: uncharacterized protein LOC101249752 [Solanum lycopersicum]
Length=331

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 1/179 (1%)
 Frame = +2

Query  221  MKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFV  400
            MK + Q  EI  + S+   RL   ++    S FQ K+++ +KSNFKR++   D  ++   
Sbjct  1    MKTEGQGIEILENTSNVHNRLPRPMIQSIFSGFQEKVQECVKSNFKRLKIAHDKSITRG-  59

Query  401  GKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYN  580
              KGA  ++ VD EKQ+Q WKENP+W D PP +KV+VPKGSLCNLN KVN+GLPPD V++
Sbjct  60   NNKGATLVIDVDKEKQLQSWKENPSWVDPPPYVKVSVPKGSLCNLNVKVNIGLPPDTVFD  119

Query  581  IVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            IV DPEN+RVFKNI++V+SRKVL+DEG RQVVEL+QAA+WKFLWWSGTISVHVLVDQNR
Sbjct  120  IVTDPENRRVFKNIKEVLSRKVLVDEGSRQVVELDQAAIWKFLWWSGTISVHVLVDQNR  178



>ref|XP_006348525.1| PREDICTED: uncharacterized protein LOC102597312 isoform X3 [Solanum 
tuberosum]
Length=351

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 139/186 (75%), Gaps = 5/186 (3%)
 Frame = +2

Query  206  LVAGEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMR--RDGD  379
            ++   MK + Q  +I  + S    RL   ++    S FQ K+++ +KSNFKR++   D  
Sbjct  16   VLISSMKTEGQGIDILENTSDVHNRLPRPMIQSIFSGFQEKVQECVKSNFKRLKIAHDKS  75

Query  380  VLMSSFVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGL  559
            ++  +    KGA  ++ VD EKQ+Q WKENP+W D PP +KV+VPKGSLCNLN KVN+GL
Sbjct  76   IMRGN---NKGATVVIDVDKEKQLQSWKENPSWVDPPPFVKVSVPKGSLCNLNVKVNIGL  132

Query  560  PPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHV  739
            PPD V++IV DPEN+RVFKNI++V+SRKVL+DEG RQVVEL+QAA+W+FLWWSGTISVHV
Sbjct  133  PPDTVFDIVTDPENRRVFKNIKEVLSRKVLVDEGSRQVVELDQAAIWRFLWWSGTISVHV  192

Query  740  LVDQNR  757
            LVDQNR
Sbjct  193  LVDQNR  198



>ref|XP_006348523.1| PREDICTED: uncharacterized protein LOC102597312 isoform X1 [Solanum 
tuberosum]
 ref|XP_006348524.1| PREDICTED: uncharacterized protein LOC102597312 isoform X2 [Solanum 
tuberosum]
Length=331

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 137/181 (76%), Gaps = 5/181 (3%)
 Frame = +2

Query  221  MKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMR--RDGDVLMSS  394
            MK + Q  +I  + S    RL   ++    S FQ K+++ +KSNFKR++   D  ++  +
Sbjct  1    MKTEGQGIDILENTSDVHNRLPRPMIQSIFSGFQEKVQECVKSNFKRLKIAHDKSIMRGN  60

Query  395  FVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAV  574
                KGA  ++ VD EKQ+Q WKENP+W D PP +KV+VPKGSLCNLN KVN+GLPPD V
Sbjct  61   ---NKGATVVIDVDKEKQLQSWKENPSWVDPPPFVKVSVPKGSLCNLNVKVNIGLPPDTV  117

Query  575  YNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            ++IV DPEN+RVFKNI++V+SRKVL+DEG RQVVEL+QAA+W+FLWWSGTISVHVLVDQN
Sbjct  118  FDIVTDPENRRVFKNIKEVLSRKVLVDEGSRQVVELDQAAIWRFLWWSGTISVHVLVDQN  177

Query  755  R  757
            R
Sbjct  178  R  178



>ref|XP_011086570.1| PREDICTED: uncharacterized protein LOC105168260 isoform X2 [Sesamum 
indicum]
Length=335

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 135/183 (74%), Gaps = 5/183 (3%)
 Frame = +2

Query  215  GEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSS  394
            GE+     N+    ++ S    L +  +H F S F  K+ +++  NFK+++ + ++  S 
Sbjct  3    GEVHTTTNNSS---EKGSGHPNLITDALHGFFSHFPKKVCESVAFNFKQLKSNDNIKTSE  59

Query  395  F--VGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPD  568
            F   G K     + + LEKQM  WKENP W D+PP+IKVTVPKGSLCNL+ KV+VGLPPD
Sbjct  60   FPSGGSKKESSTIDLSLEKQMHAWKENPVWADYPPDIKVTVPKGSLCNLSLKVDVGLPPD  119

Query  569  AVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
            AVYNIV DP+NKRVFKNI++VISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLVD
Sbjct  120  AVYNIVTDPDNKRVFKNIKEVISRKVLVDEGLRQVVEVEQAAIWRFLWWSGTISVHVLVD  179

Query  749  QNR  757
            QNR
Sbjct  180  QNR  182



>ref|XP_007044668.1| Domain of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
 gb|EOY00500.1| Domain of Uncharacterized protein function isoform 1 [Theobroma 
cacao]
Length=387

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 138/193 (72%), Gaps = 7/193 (4%)
 Frame = +2

Query  200  CRLVAGEMKLDKQNNEIPVDESSERARLSSSVMHPFLS----DFQSKIEKALKSNFKRMR  367
            C  ++ + +   + N+I +D S         V+ P  S        K+   LKS  KR+ 
Sbjct  37   CIFLSPDQRCKMEGNKISIDISRTDRNGRPKVLDPAFSAIFVQLPHKLRNCLKSQLKRLA  96

Query  368  RDGDVLMS--SFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLN  538
             D D + S  SF+GK K +   L VDLEKQ+Q W++NP+W D P EIKV+VPKGSLCNL 
Sbjct  97   EDNDRIKSVNSFLGKEKSSSTGLGVDLEKQLQAWRDNPSWVDQPSEIKVSVPKGSLCNLK  156

Query  539  AKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWS  718
            AKV+VGLPPDAVYNIV DP+NKRVFKNI++VISRKVL+DEG RQVVE+EQAA+W+FLWWS
Sbjct  157  AKVDVGLPPDAVYNIVTDPDNKRVFKNIKEVISRKVLVDEGQRQVVEVEQAALWRFLWWS  216

Query  719  GTISVHVLVDQNR  757
            GTISVHVLVDQNR
Sbjct  217  GTISVHVLVDQNR  229



>ref|XP_007044669.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
 gb|EOY00501.1| Domain of Uncharacterized protein function isoform 2 [Theobroma 
cacao]
Length=347

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = +2

Query  212  AGEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMS  391
            +G+M+ +K + +I   + + R ++              K+   LKS  KR+  D D + S
Sbjct  5    SGKMEGNKISIDISRTDRNGRPKVLDPAFSAIFVQLPHKLRNCLKSQLKRLAEDNDRIKS  64

Query  392  --SFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLP  562
              SF+GK K +   L VDLEKQ+Q W++NP+W D P EIKV+VPKGSLCNL AKV+VGLP
Sbjct  65   VNSFLGKEKSSSTGLGVDLEKQLQAWRDNPSWVDQPSEIKVSVPKGSLCNLKAKVDVGLP  124

Query  563  PDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVL  742
            PDAVYNIV DP+NKRVFKNI++VISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVL
Sbjct  125  PDAVYNIVTDPDNKRVFKNIKEVISRKVLVDEGQRQVVEVEQAALWRFLWWSGTISVHVL  184

Query  743  VDQNR  757
            VDQNR
Sbjct  185  VDQNR  189



>ref|XP_011086569.1| PREDICTED: uncharacterized protein LOC105168260 isoform X1 [Sesamum 
indicum]
Length=336

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 134/184 (73%), Gaps = 6/184 (3%)
 Frame = +2

Query  215  GEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKI-EKALKSNFKRMRRDGDVLMS  391
            GE+     N+    ++ S    L +  +H F S F  K+ E   + NFK+++ + ++  S
Sbjct  3    GEVHTTTNNSS---EKGSGHPNLITDALHGFFSHFPKKVCESVAQFNFKQLKSNDNIKTS  59

Query  392  SF--VGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPP  565
             F   G K     + + LEKQM  WKENP W D+PP+IKVTVPKGSLCNL+ KV+VGLPP
Sbjct  60   EFPSGGSKKESSTIDLSLEKQMHAWKENPVWADYPPDIKVTVPKGSLCNLSLKVDVGLPP  119

Query  566  DAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLV  745
            DAVYNIV DP+NKRVFKNI++VISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLV
Sbjct  120  DAVYNIVTDPDNKRVFKNIKEVISRKVLVDEGLRQVVEVEQAAIWRFLWWSGTISVHVLV  179

Query  746  DQNR  757
            DQNR
Sbjct  180  DQNR  183



>gb|KDP26597.1| hypothetical protein JCGZ_17755 [Jatropha curcas]
Length=322

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 122/152 (80%), Gaps = 3/152 (2%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAF-GILXVDLEKQMQPWKENPTWT  481
            FL   Q+K++  LKS   ++ +D D   S  VGK+      L +DLE+Q+Q W+ENP+W 
Sbjct  19   FLVQLQNKLQNCLKSQISKLAKDNDGATS--VGKEEVLPSALRIDLERQLQNWRENPSWV  76

Query  482  DHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEG  661
            D  PEIKV+VPKGSLCNLN K NVGLPPDAVYNIV DP+N+RVFKNI++VISRKVLLDEG
Sbjct  77   DQSPEIKVSVPKGSLCNLNVKCNVGLPPDAVYNIVIDPDNRRVFKNIKEVISRKVLLDEG  136

Query  662  PRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             RQVVE+EQAA+WKFLWWSGTISVHVLVDQNR
Sbjct  137  HRQVVEVEQAAIWKFLWWSGTISVHVLVDQNR  168



>ref|XP_002525367.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37005.1| conserved hypothetical protein [Ricinus communis]
Length=329

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +2

Query  308  LSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTWTDH  487
            L    +K++  LKS F+++ +D +   +S   + G+F  + +DL++Q+Q W+ENP+W D 
Sbjct  30   LVQLPNKLQNCLKSQFRKLAKDNEG-ATSVTMEGGSFDAVKIDLDRQLQTWRENPSWIDQ  88

Query  488  PPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPR  667
            PPEIKV+VPKGSLCNLN K NVGLPPDAVYNIV DP+N+RVFKNI++VISR+VLLDEG R
Sbjct  89   PPEIKVSVPKGSLCNLNVKFNVGLPPDAVYNIVTDPDNRRVFKNIKEVISREVLLDEGHR  148

Query  668  QVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            QVVELEQAA+WKFLWWSGTISVHVLVDQNR
Sbjct  149  QVVELEQAAIWKFLWWSGTISVHVLVDQNR  178



>ref|XP_008221831.1| PREDICTED: uncharacterized protein LOC103321776 [Prunus mume]
Length=334

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = +2

Query  326  KIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKV  505
            K++  LKS  KR+ +D  V     V KK     L VDLEKQ+Q W+ENP+W D PP+IKV
Sbjct  39   KLQNCLKSQLKRLAKDDGVKTVISVPKKATS--LEVDLEKQLQAWRENPSWADQPPDIKV  96

Query  506  TVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELE  685
            +VPKGSLCNL+ +VNVGLPPDAVYNIV DP+NKRVFKNI++VISRKVL+DEG RQVVELE
Sbjct  97   SVPKGSLCNLSVRVNVGLPPDAVYNIVTDPDNKRVFKNIKEVISRKVLVDEGSRQVVELE  156

Query  686  QAAMWKFLWWSGTISVHVLVDQNR  757
            QAA+W+FLWWSGTI+VHVLVDQNR
Sbjct  157  QAALWRFLWWSGTIAVHVLVDQNR  180



>gb|KJB15570.1| hypothetical protein B456_002G185100 [Gossypium raimondii]
Length=326

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = +2

Query  272  RARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMS--SFVGK-KGAFGILXVDLE  442
            + +L       F     +K++  LKS FK + +D D   S  SF+ K KG+F  L +DLE
Sbjct  7    KPKLLDQAFSVFFVQLPNKLQNHLKSQFKGLAKDNDGFESANSFLEKEKGSFAGLRIDLE  66

Query  443  KQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNI  622
            KQ+Q W+ENP+W + PPEIKV+VPKGSLCNL AK++VGLPPDAVY+I+ DP++KR+FKNI
Sbjct  67   KQLQAWRENPSWVNQPPEIKVSVPKGSLCNLKAKLDVGLPPDAVYDILTDPDSKRIFKNI  126

Query  623  QKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ++VISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISV VLVDQNR
Sbjct  127  KEVISRKVLVDEGQRQVVEVEQAALWRFLWWSGTISVRVLVDQNR  171



>gb|KJB15571.1| hypothetical protein B456_002G185100 [Gossypium raimondii]
Length=332

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = +2

Query  272  RARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMS--SFVGK-KGAFGILXVDLE  442
            + +L       F     +K++  LKS FK + +D D   S  SF+ K KG+F  L +DLE
Sbjct  13   KPKLLDQAFSVFFVQLPNKLQNHLKSQFKGLAKDNDGFESANSFLEKEKGSFAGLRIDLE  72

Query  443  KQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNI  622
            KQ+Q W+ENP+W + PPEIKV+VPKGSLCNL AK++VGLPPDAVY+I+ DP++KR+FKNI
Sbjct  73   KQLQAWRENPSWVNQPPEIKVSVPKGSLCNLKAKLDVGLPPDAVYDILTDPDSKRIFKNI  132

Query  623  QKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ++VISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISV VLVDQNR
Sbjct  133  KEVISRKVLVDEGQRQVVEVEQAALWRFLWWSGTISVRVLVDQNR  177



>ref|XP_007044670.1| Domain of Uncharacterized protein function isoform 3 [Theobroma 
cacao]
 gb|EOY00502.1| Domain of Uncharacterized protein function isoform 3 [Theobroma 
cacao]
Length=338

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 133/179 (74%), Gaps = 5/179 (3%)
 Frame = +2

Query  236  QNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKS--NFKRMRRDGDVLMS--SFVG  403
            + N+I +D S         V+ P  S    ++   L++    KR+  D D + S  SF+G
Sbjct  2    EGNKISIDISRTDRNGRPKVLDPAFSAIFVQLPHKLRNCLKLKRLAEDNDRIKSVNSFLG  61

Query  404  K-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYN  580
            K K +   L VDLEKQ+Q W++NP+W D P EIKV+VPKGSLCNL AKV+VGLPPDAVYN
Sbjct  62   KEKSSSTGLGVDLEKQLQAWRDNPSWVDQPSEIKVSVPKGSLCNLKAKVDVGLPPDAVYN  121

Query  581  IVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            IV DP+NKRVFKNI++VISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  122  IVTDPDNKRVFKNIKEVISRKVLVDEGQRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  180



>ref|XP_006483874.1| PREDICTED: uncharacterized protein LOC102618931 isoform X4 [Citrus 
sinensis]
Length=304

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 137/183 (75%), Gaps = 7/183 (4%)
 Frame = +2

Query  230  DKQNNEIPVDESSERARLSSSVMHPFLSDF----QSKIEKALKSNFKRMRRDGDV--LMS  391
            +K+  +  +D  + + + +  V  P +S F      KI+  LK+  K + +D +    MS
Sbjct  3    EKEETKNTIDVHNNKIKSTPKVFDPAISSFFVQLPHKIQNYLKAPLKGLTKDNETSSTMS  62

Query  392  SFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPD  568
            S +G+ KG+   L VD+E+Q++ W+ENPTWTD PP IKV+VPKGSLCNLN KVNVGLPPD
Sbjct  63   SDLGEGKGSTTALEVDMERQLEHWRENPTWTDQPPIIKVSVPKGSLCNLNVKVNVGLPPD  122

Query  569  AVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
            AVYNIV DP+N+RVFKNI++V+SR+VL+DEG RQVVE+EQAA+WKFLWWSG + VHVLVD
Sbjct  123  AVYNIVTDPDNRRVFKNIKEVLSRRVLIDEGHRQVVEVEQAALWKFLWWSGVMLVHVLVD  182

Query  749  QNR  757
            Q+R
Sbjct  183  QDR  185



>ref|XP_007222563.1| hypothetical protein PRUPE_ppa008383mg [Prunus persica]
 gb|EMJ23762.1| hypothetical protein PRUPE_ppa008383mg [Prunus persica]
Length=334

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +2

Query  215  GEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSS  394
            GE ++   +  +  +E +   +    V+   L      ++  LKS  KR+ +D  V    
Sbjct  2    GETEVTTTSVNVTKNERNGHLKAFDLVISKTLLQVPHMLQNCLKSQLKRLAKDDGVKTVI  61

Query  395  FVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAV  574
             V KK     L VDLEKQ+Q W+ENP+W D PP+IKV+VPKGS CNL+  VNVGLPPDAV
Sbjct  62   SVPKKATS--LEVDLEKQLQAWRENPSWADQPPDIKVSVPKGSFCNLSVNVNVGLPPDAV  119

Query  575  YNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            YNIV DP+NKRVFKNI++VISRKVL+DEG RQVVELEQAA+W+FLWWSGTI+VHVLVDQN
Sbjct  120  YNIVTDPDNKRVFKNIKEVISRKVLVDEGSRQVVELEQAALWRFLWWSGTIAVHVLVDQN  179

Query  755  R  757
            R
Sbjct  180  R  180



>ref|XP_006438370.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
 gb|ESR51610.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
Length=338

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 137/183 (75%), Gaps = 7/183 (4%)
 Frame = +2

Query  230  DKQNNEIPVDESSERARLSSSVMHPFLSDF----QSKIEKALKSNFKRMRRDGDV--LMS  391
            +K+  +  +D  + + + +  V  P +S F      KI+  LK+  K + +D +    MS
Sbjct  3    EKEETKNTIDVHNNKIKSTPKVFDPAISSFFVQLPHKIQNYLKAPLKGLTKDNETSSTMS  62

Query  392  SFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPD  568
            S +G+ KG+   L VD+E+Q++ W+ENPTWTD PP IKV+VPKGSLCNLN KVNVGLPPD
Sbjct  63   SDLGEGKGSTTALEVDMERQLEHWRENPTWTDQPPIIKVSVPKGSLCNLNVKVNVGLPPD  122

Query  569  AVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
            AVYNIV DP+N+RVFKNI++V+SR+VL+DEG RQVVE+EQAA+WKFLWWSG + VHVLVD
Sbjct  123  AVYNIVTDPDNRRVFKNIKEVLSRRVLIDEGHRQVVEVEQAALWKFLWWSGVMLVHVLVD  182

Query  749  QNR  757
            Q+R
Sbjct  183  QDR  185



>ref|XP_002315692.2| hypothetical protein POPTR_0010s05140g [Populus trichocarpa]
 gb|EEF01863.2| hypothetical protein POPTR_0010s05140g [Populus trichocarpa]
Length=341

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 8/157 (5%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGK-KGAFG-----ILXVDLEKQMQPWKE  466
            FL    +K++  +KS  K + +DG     + V K KG+F       L +DLE+Q+Q W+E
Sbjct  29   FLVQLPNKLQDCIKSQLKNLLKDGK--GENLVRKEKGSFASTAAPALGIDLERQLQAWRE  86

Query  467  NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKV  646
            NP WTD PP+IKV+VP+GSLCNLNAKV++GLPPDAVY+IV DP+N+RVFKNI++V+SR+V
Sbjct  87   NPAWTDQPPQIKVSVPRGSLCNLNAKVDIGLPPDAVYDIVTDPDNRRVFKNIKEVLSRRV  146

Query  647  LLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            LLDEG RQVV++EQAA+WKFLWWSGTISVHVLVDQNR
Sbjct  147  LLDEGHRQVVDVEQAAIWKFLWWSGTISVHVLVDQNR  183



>ref|XP_010251230.1| PREDICTED: uncharacterized protein LOC104593182 [Nelumbo nucifera]
 ref|XP_010251234.1| PREDICTED: uncharacterized protein LOC104593182 [Nelumbo nucifera]
Length=341

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 119/154 (77%), Gaps = 3/154 (2%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKR---MRRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPT  475
            FL     K++  LK + K+      + D L S      G++  L ++LEKQ+Q WKENPT
Sbjct  32   FLVQIPQKLQNCLKMHLKKNVKSEEEADFLSSGVQKDPGSYAALNINLEKQLQAWKENPT  91

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLD  655
            W D PP +KV+VPKGSLCNL+ K NVGLPPDA+YNIV DP+NKRVFKNI++VISR+VL+D
Sbjct  92   WVDQPPHLKVSVPKGSLCNLDVKFNVGLPPDAIYNIVIDPDNKRVFKNIKEVISRRVLVD  151

Query  656  EGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            EG RQVVE+EQAA+WKFLWWSGTISVHV+VDQNR
Sbjct  152  EGLRQVVEVEQAALWKFLWWSGTISVHVIVDQNR  185



>ref|XP_006483871.1| PREDICTED: uncharacterized protein LOC102618931 isoform X1 [Citrus 
sinensis]
 ref|XP_006483872.1| PREDICTED: uncharacterized protein LOC102618931 isoform X2 [Citrus 
sinensis]
 ref|XP_006483873.1| PREDICTED: uncharacterized protein LOC102618931 isoform X3 [Citrus 
sinensis]
Length=338

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 137/183 (75%), Gaps = 7/183 (4%)
 Frame = +2

Query  230  DKQNNEIPVDESSERARLSSSVMHPFLSDF----QSKIEKALKSNFKRMRRDGDV--LMS  391
            +K+  +  +D  + + + +  V  P +S F      KI+  LK+  K + +D +    MS
Sbjct  3    EKEETKNTIDVHNNKIKSTPKVFDPAISSFFVQLPHKIQNYLKAPLKGLTKDNETSSTMS  62

Query  392  SFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPD  568
            S +G+ KG+   L VD+E+Q++ W+ENPTWTD PP IKV+VPKGSLCNLN KVNVGLPPD
Sbjct  63   SDLGEGKGSTTALEVDMERQLEHWRENPTWTDQPPIIKVSVPKGSLCNLNVKVNVGLPPD  122

Query  569  AVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
            AVYNIV DP+N+RVFKNI++V+SR+VL+DEG RQVVE+EQAA+WKFLWWSG + VHVLVD
Sbjct  123  AVYNIVTDPDNRRVFKNIKEVLSRRVLIDEGHRQVVEVEQAALWKFLWWSGVMLVHVLVD  182

Query  749  QNR  757
            Q+R
Sbjct  183  QDR  185



>ref|XP_008389656.1| PREDICTED: uncharacterized protein LOC103451974 [Malus domestica]
Length=196

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 116/144 (81%), Gaps = 2/144 (1%)
 Frame = +2

Query  326  KIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKV  505
            +++  LKS  KR+ +D  V   S V KK A   L  DLEKQ+Q W+ENP+W D PP IKV
Sbjct  41   RLQNCLKSQLKRLAKDDGVKKVSSVPKKAAS--LEDDLEKQLQAWRENPSWVDQPPYIKV  98

Query  506  TVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELE  685
            +VPKGSLCNL+  VNVGLPPDAVYNIV DP+NKRVFKNI++VISR VL+DEG RQVV+LE
Sbjct  99   SVPKGSLCNLSVNVNVGLPPDAVYNIVTDPDNKRVFKNIKEVISRNVLVDEGHRQVVDLE  158

Query  686  QAAMWKFLWWSGTISVHVLVDQNR  757
            QAA+WKFLWWSGTI+V V+VDQNR
Sbjct  159  QAAIWKFLWWSGTIAVRVIVDQNR  182



>gb|KJB61048.1| hypothetical protein B456_009G337600 [Gossypium raimondii]
 gb|KJB61049.1| hypothetical protein B456_009G337600 [Gossypium raimondii]
Length=339

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 129/164 (79%), Gaps = 7/164 (4%)
 Frame = +2

Query  287  SSVMHP----FLSDFQSKIEKALKSNFKRMRRDGDVL--MSSFVGKK-GAFGILXVDLEK  445
            S V+ P    FL     K++  LKS  KR+ +DGD +  ++SF+ KK G+   L ++LEK
Sbjct  16   SKVLDPAFSAFLVQLPCKLQNCLKSQLKRLAKDGDRIKPLNSFLEKKNGSSSGLGINLEK  75

Query  446  QMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ  625
            Q+Q W+ENP+W + PPEI+V+V KGSLC L A ++VGLPPDAVYNIV DP+N+RVFKN++
Sbjct  76   QLQAWRENPSWVNPPPEIEVSVAKGSLCYLKATIDVGLPPDAVYNIVTDPDNRRVFKNVK  135

Query  626  KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +VISRKVL+DEG RQVVE+EQAA W+FLWWSGTISVHVLVDQNR
Sbjct  136  EVISRKVLIDEGQRQVVEVEQAAWWRFLWWSGTISVHVLVDQNR  179



>ref|XP_006390884.1| hypothetical protein EUTSA_v10019595mg, partial [Eutrema salsugineum]
 gb|ESQ28170.1| hypothetical protein EUTSA_v10019595mg, partial [Eutrema salsugineum]
Length=310

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = +2

Query  287  SSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSFV-GKKGAFGILXVDLEKQMQ  454
            SSV  P LS    F  K++  LKS  K +  D   + SS++  K+ +   + +DL+KQ+ 
Sbjct  7    SSVFDPALSRFVGFSQKLQTCLKSQLKNLTADKQGIGSSWMQDKESSSSSIQIDLDKQLD  66

Query  455  PWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVI  634
             W+ENP+WTD  P IKV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+RVFKNI++V+
Sbjct  67   SWRENPSWTDQTPVIKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNRRVFKNIKEVL  126

Query  635  SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            SRKV++DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  127  SRKVVVDEGLRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  167



>emb|CDP00160.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = +2

Query  290  SVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFV--GKKGAFGILXVDLEKQMQPWK  463
            S  H FL +F  +++K LK N K  + D     S+      K +     V+LEKQ+Q WK
Sbjct  4    SEFHAFLVNFPKQVQKYLKLNSKTSKEDDRTTSSASTDSNDKDSSIAAKVNLEKQLQAWK  63

Query  464  ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRK  643
            ENP W +  PE+KV+VPKGSLCNLN KVN+GLPPDAVY+I+ DP+N+RVFKNI++VISR+
Sbjct  64   ENPIWVNSTPEVKVSVPKGSLCNLNVKVNIGLPPDAVYDIIIDPDNRRVFKNIKEVISRR  123

Query  644  VLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VL+DEG RQVVELEQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  124  VLVDEGLRQVVELEQAALWRFLWWSGTISVHVLVDQNR  161



>ref|XP_008353017.1| PREDICTED: uncharacterized protein LOC103416549 isoform X1 [Malus 
domestica]
 ref|XP_008353018.1| PREDICTED: uncharacterized protein LOC103416549 isoform X1 [Malus 
domestica]
 ref|XP_008353019.1| PREDICTED: uncharacterized protein LOC103416549 isoform X1 [Malus 
domestica]
Length=334

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +2

Query  215  GEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSS  394
            GE ++   N  +  +E + + +         L     K++  +KS  +R+ +D  V   S
Sbjct  2    GETEVTTTNVNVGKNERNGQLKAFDLAFSKALLQVPQKLQNCVKSQLRRLVKDDGVKTVS  61

Query  395  FVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAV  574
             + KK A   L +DLEKQ+Q W+ENP+W D PP++KV+VPKGSLCNL   V+VGLPPDAV
Sbjct  62   CLPKKAAS--LELDLEKQLQAWRENPSWVDQPPDMKVSVPKGSLCNLGVSVDVGLPPDAV  119

Query  575  YNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            YNIV DP+NKRVFKNI++VISR VL+DEG RQVVELEQAA+WKFLWWSGT +VHVLVDQN
Sbjct  120  YNIVTDPDNKRVFKNIKEVISRNVLVDEGHRQVVELEQAAIWKFLWWSGTFAVHVLVDQN  179

Query  755  R  757
            R
Sbjct  180  R  180



>ref|XP_002887303.1| hypothetical protein ARALYDRAFT_894859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63562.1| hypothetical protein ARALYDRAFT_894859 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 4/171 (2%)
 Frame = +2

Query  257  DESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSFV-GKKGAFGI  424
            D    +  + SSV  P LS    F  K++  LKS  K +  D   + SS+   K+G+   
Sbjct  7    DTERNKRNVVSSVFDPALSRFVGFSQKLQTCLKSQLKNLTDDKHGIGSSWRHDKEGSSSS  66

Query  425  LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + +DLEKQ+  W+ENP+WTD  P +KV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+
Sbjct  67   MEIDLEKQLDMWRENPSWTDQIPVVKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNR  126

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVFKNI++V+SRKVL+D+G RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  127  RVFKNIKEVMSRKVLVDDGLRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  177



>ref|XP_010427823.1| PREDICTED: uncharacterized protein LOC104712594 [Camelina sativa]
 ref|XP_010427824.1| PREDICTED: uncharacterized protein LOC104712594 [Camelina sativa]
 ref|XP_010427825.1| PREDICTED: uncharacterized protein LOC104712594 [Camelina sativa]
Length=320

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 4/172 (2%)
 Frame = +2

Query  254  VDESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSFV-GKKGAFG  421
             D    +  + +SV  P +S    F  K++  LKS  K ++ D   + SS+   K+ +  
Sbjct  6    TDTERNKNNVVTSVFDPAISRFVGFSQKLQNCLKSQLKNLKADKHGIGSSWRRDKESSSS  65

Query  422  ILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
             + +DLEKQ+  W+ENP+WTD  P IKV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N
Sbjct  66   SMQIDLEKQLGIWRENPSWTDQIPVIKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDN  125

Query  602  KRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +RVFKNI++V+SRKVL+DEG RQVVE+EQAA+WKFLWWSGTISVHVLVDQNR
Sbjct  126  RRVFKNIKEVMSRKVLVDEGLRQVVEVEQAALWKFLWWSGTISVHVLVDQNR  177



>ref|XP_002265077.1| PREDICTED: uncharacterized protein LOC100244891 [Vitis vinifera]
 emb|CBI28544.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 4/153 (3%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRR--DGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTW  478
            F      KI+  LKS+ KR +   +G  L +S   +KG    L ++LEKQ+Q WKENP W
Sbjct  24   FFVQLPQKIQTCLKSHLKRSKNGNEGTNLKASV--EKGPSTALGLNLEKQLQHWKENPVW  81

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
            T+ PPEIKV+VPKGSLC L+ +V+VGLPPDAVYNIV DP+NKRVFKNI++VISR+VLLDE
Sbjct  82   TEQPPEIKVSVPKGSLCKLSVEVDVGLPPDAVYNIVIDPDNKRVFKNIKEVISRRVLLDE  141

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVVE+EQAA+W+FLWWSGTISVHV+VDQNR
Sbjct  142  GLRQVVEVEQAALWRFLWWSGTISVHVIVDQNR  174



>ref|XP_010552646.1| PREDICTED: uncharacterized protein LOC104822970 [Tarenaya hassleriana]
 ref|XP_010552647.1| PREDICTED: uncharacterized protein LOC104822970 [Tarenaya hassleriana]
Length=336

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 124/163 (76%), Gaps = 7/163 (4%)
 Frame = +2

Query  290  SVMHPFLSD---FQSKIEKALKSNFKRMRRD--GDVLMSSF--VGKKGAFGILXVDLEKQ  448
            SV +P +S       K +  L+S  KR+  D  G  L+ S    GK+     + VDLEKQ
Sbjct  23   SVFNPAVSGILGLSQKFQSGLQSQLKRLSADKPGMKLIGSSWRNGKECLSSSIEVDLEKQ  82

Query  449  MQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQK  628
            +Q W+ENP WTD PP IKV++PKGSLCNL+  VNVGLPPDAVYNIV DP+N+RVFKNI++
Sbjct  83   LQRWRENPAWTDQPPAIKVSIPKGSLCNLSVDVNVGLPPDAVYNIVTDPDNRRVFKNIKE  142

Query  629  VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLV+QNR
Sbjct  143  VISRKVLVDEGTRQVVEVEQAAIWRFLWWSGTISVHVLVEQNR  185



>ref|XP_011463200.1| PREDICTED: uncharacterized protein LOC101307881 [Fragaria vesca 
subsp. vesca]
Length=332

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +2

Query  215  GEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSS  394
            GE ++   + +I  +E + R +    V+         K++  LKS  +R+     V   S
Sbjct  2    GETEVPTTSIDISKNEKNGRLKALDVVLLKAFVQVPHKLQNFLKSRLRRLSNADGVKTVS  61

Query  395  FVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAV  574
             V K      L VDLEKQ+Q W+ENP+W D  P+IKV+VPKGSLCNL+  VNVGLPPDAV
Sbjct  62   SVPK--VTSSLEVDLEKQLQAWRENPSWEDQTPQIKVSVPKGSLCNLSVNVNVGLPPDAV  119

Query  575  YNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            YNIV DP+NKRVFKNI++VISR+VL+DEG RQVVELEQAA+W+FLWWSGTI+VHVLVDQN
Sbjct  120  YNIVTDPDNKRVFKNIKEVISRRVLVDEGLRQVVELEQAALWRFLWWSGTIAVHVLVDQN  179

Query  755  R  757
            R
Sbjct  180  R  180



>ref|XP_010415726.1| PREDICTED: uncharacterized protein LOC104701686 [Camelina sativa]
 ref|XP_010415727.1| PREDICTED: uncharacterized protein LOC104701686 [Camelina sativa]
Length=320

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 129/171 (75%), Gaps = 4/171 (2%)
 Frame = +2

Query  257  DESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSF-VGKKGAFGI  424
            D    +  + +SV  P +S    F  K++  LKS  K ++ D   + SS+   K+ +   
Sbjct  7    DTERNKNNVVTSVFDPAISRFVGFSQKLQTCLKSQLKNLKADKHGIGSSWRQDKESSSSS  66

Query  425  LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + +DLEKQ+  W+ENP+WTD  P IKV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+
Sbjct  67   MQIDLEKQLGIWRENPSWTDQIPVIKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNR  126

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVFKNI++V+SRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  127  RVFKNIKEVMSRKVLVDEGLRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  177



>ref|XP_006300944.1| hypothetical protein CARUB_v10021325mg [Capsella rubella]
 gb|EOA33842.1| hypothetical protein CARUB_v10021325mg [Capsella rubella]
Length=320

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +2

Query  257  DESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSF-VGKKGAFGI  424
            D    +  + +SV  P +S    F  K+   LKS  K ++ D     SS+   K+ +   
Sbjct  7    DTERNKKNVVTSVFDPAISRFVGFSQKLHTRLKSQLKNLKADKHGFGSSWRQDKENSSSS  66

Query  425  LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + +DLEKQM  W+ENP+WTD  P IKV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+
Sbjct  67   IQIDLEKQMDIWRENPSWTDQIPVIKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNR  126

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVFKNI++V+SRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  127  RVFKNIKEVMSRKVLVDEGLRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  177



>ref|XP_011011119.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
 ref|XP_011011120.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
 ref|XP_011011121.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
 ref|XP_011011122.1| PREDICTED: uncharacterized protein LOC105115796 isoform X2 [Populus 
euphratica]
Length=341

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGD----VLMSSFVGKKGAFGILXVDLEKQMQPWKENP  472
            FL    +K++  +KS  K + +DG     V          A   L +DLE+Q+Q W+ENP
Sbjct  29   FLVRLPNKLQDCIKSQLKNLLKDGKGENLVRQERGSSASDAAPALGIDLERQLQAWRENP  88

Query  473  TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLL  652
             WTD PP+IKV+VP+GSLCNLNA+V++GLPPDAVY+IV DP+N+RVFKNI++V+SR+VLL
Sbjct  89   AWTDQPPQIKVSVPRGSLCNLNARVDIGLPPDAVYDIVTDPDNRRVFKNIKEVVSRRVLL  148

Query  653  DEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            DEG RQVV++EQAA+WKFLWWSGTISVHV VDQNR
Sbjct  149  DEGHRQVVDVEQAAIWKFLWWSGTISVHVSVDQNR  183



>ref|NP_564989.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG52482.1|AC010796_21 unknown protein; 12217-13521 [Arabidopsis thaliana]
 gb|AAK96834.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10118.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35066.1| uncharacterized protein AT1G70480 [Arabidopsis thaliana]
Length=320

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +2

Query  257  DESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGI-  424
            D    +  + SSV  P LS    F  K++  LKS  K +  D   + SS+   KG   I 
Sbjct  7    DTERNKGNVVSSVFDPALSRFVGFSQKLQTRLKSQLKNLTDDKHGIGSSWRQDKGNSSIS  66

Query  425  LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + +DLEKQ+  W+ENP+WTD  P +KV +PKGSLCNL A+VNVGLPPDAVYNIV DP+N+
Sbjct  67   MQIDLEKQLDCWRENPSWTDQIPVVKVGIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNR  126

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVFKNI++V+SRKVL+D+G RQVVE+EQAA+W+FLWWSGTISVHVLVDQ+R
Sbjct  127  RVFKNIKEVMSRKVLVDDGLRQVVEVEQAALWRFLWWSGTISVHVLVDQDR  177



>ref|XP_010471039.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
 ref|XP_010471040.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
 ref|XP_010471041.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
 ref|XP_010471042.1| PREDICTED: uncharacterized protein LOC104750885 [Camelina sativa]
Length=320

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 129/171 (75%), Gaps = 4/171 (2%)
 Frame = +2

Query  257  DESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSF-VGKKGAFGI  424
            D    +  + +SV  P +S    F  K++  LKS  K ++ D   + SS+   K+ +   
Sbjct  7    DTERNKNNVVTSVFDPAISRFVGFSQKLQTCLKSQLKNLKADKHGIGSSWRQDKESSSSS  66

Query  425  LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + +DLEKQ+  W+ENP+WTD  P IKV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+
Sbjct  67   MQIDLEKQLGIWRENPSWTDQIPVIKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNR  126

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVFKNI++V+SRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  127  RVFKNIKEVMSRKVLVDEGFRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  177



>ref|XP_011011117.1| PREDICTED: uncharacterized protein LOC105115796 isoform X1 [Populus 
euphratica]
Length=355

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGD----VLMSSFVGKKGAFGILXVDLEKQMQPWKENP  472
            FL    +K++  +KS  K + +DG     V          A   L +DLE+Q+Q W+ENP
Sbjct  43   FLVRLPNKLQDCIKSQLKNLLKDGKGENLVRQERGSSASDAAPALGIDLERQLQAWRENP  102

Query  473  TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLL  652
             WTD PP+IKV+VP+GSLCNLNA+V++GLPPDAVY+IV DP+N+RVFKNI++V+SR+VLL
Sbjct  103  AWTDQPPQIKVSVPRGSLCNLNARVDIGLPPDAVYDIVTDPDNRRVFKNIKEVVSRRVLL  162

Query  653  DEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            DEG RQVV++EQAA+WKFLWWSGTISVHV VDQNR
Sbjct  163  DEGHRQVVDVEQAAIWKFLWWSGTISVHVSVDQNR  197



>ref|NP_001031261.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35067.1| uncharacterized protein AT1G70480 [Arabidopsis thaliana]
Length=338

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +2

Query  257  DESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGI-  424
            D    +  + SSV  P LS    F  K++  LKS  K +  D   + SS+   KG   I 
Sbjct  25   DTERNKGNVVSSVFDPALSRFVGFSQKLQTRLKSQLKNLTDDKHGIGSSWRQDKGNSSIS  84

Query  425  LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + +DLEKQ+  W+ENP+WTD  P +KV +PKGSLCNL A+VNVGLPPDAVYNIV DP+N+
Sbjct  85   MQIDLEKQLDCWRENPSWTDQIPVVKVGIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNR  144

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVFKNI++V+SRKVL+D+G RQVVE+EQAA+W+FLWWSGTISVHVLVDQ+R
Sbjct  145  RVFKNIKEVMSRKVLVDDGLRQVVEVEQAALWRFLWWSGTISVHVLVDQDR  195



>ref|XP_003552022.1| PREDICTED: uncharacterized protein LOC100781672 isoform X1 [Glycine 
max]
Length=330

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = +2

Query  296  MHPFLSDFQSKIEKALKSNFKRM-RRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENP  472
            + P +S F  +++  +KS   R+ ++DG  LM S   K G+F     +L +Q+Q W+ENP
Sbjct  23   LDPAISKFFVQLQIVVKSQLSRLAKQDGMSLMRSVQRKGGSFSYSEAELNEQLQAWRENP  82

Query  473  TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLL  652
            +W D PP IKVTVPKGSLCNL+ +V+VGLPPDAVYNIV DP+N+RVFKNI++V+SRKVL+
Sbjct  83   SWVDKPPLIKVTVPKGSLCNLDVEVDVGLPPDAVYNIVIDPDNRRVFKNIKEVVSRKVLV  142

Query  653  DEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            D+G RQVV+L+QAA+WKFLWWSGTIS++VLVDQNR
Sbjct  143  DQGHRQVVDLDQAAIWKFLWWSGTISINVLVDQNR  177



>gb|AAM64384.1| unknown [Arabidopsis thaliana]
Length=320

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +2

Query  257  DESSERARLSSSVMHPFLS---DFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGI-  424
            D    +  + SSV  P LS    F  K++  LKS  K +  D   + SS+   KG   I 
Sbjct  7    DTERNKRNVVSSVFDPALSRFVGFSQKLQTRLKSQLKNLTDDKHGIGSSWRQDKGNSSIS  66

Query  425  LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + +DLEKQ+  W+ENP+WTD  P +KV +PKGSLCNL A+VNVGLPPDAVYNIV DP+N+
Sbjct  67   MQIDLEKQLDCWRENPSWTDQIPVVKVGIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNR  126

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVFKNI++V+SRKVL+D+G RQVVE+EQAA+W+FLWWSGTISVHVLVDQ+R
Sbjct  127  RVFKNIKEVMSRKVLVDDGLRQVVEVEQAALWRFLWWSGTISVHVLVDQDR  177



>gb|KJB50220.1| hypothetical protein B456_008G159400 [Gossypium raimondii]
 gb|KJB50221.1| hypothetical protein B456_008G159400 [Gossypium raimondii]
Length=343

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 132/182 (73%), Gaps = 12/182 (7%)
 Frame = +2

Query  245  EIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNF---------KRMRRD--GDVLMS  391
            ++P  + + + ++       FL    ++++  LK  F         KR+ +D  G   ++
Sbjct  9    DVPRSDRNGKPKVLDPAFSAFLVQLPNQLQDCLKGKFHFLLSKSQIKRLAKDNVGIKSVN  68

Query  392  SFVGKKGAFGI-LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPD  568
             F+GK+ +    L +DLEKQ+Q W+ENP W + PPEIKV+VPKGSLCNL AKV+VGLPPD
Sbjct  69   PFLGKEKSLSTGLGIDLEKQLQAWRENPIWVNQPPEIKVSVPKGSLCNLKAKVDVGLPPD  128

Query  569  AVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
            AVYNIV DP+NKRVFKNI++VISRKVL+DEG RQVV++EQ A+W+FLWWSGTISVHVLVD
Sbjct  129  AVYNIVTDPDNKRVFKNIKEVISRKVLVDEGKRQVVDVEQKALWRFLWWSGTISVHVLVD  188

Query  749  QN  754
            QN
Sbjct  189  QN  190



>gb|KHN25530.1| hypothetical protein glysoja_043966 [Glycine soja]
Length=330

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 123/155 (79%), Gaps = 1/155 (1%)
 Frame = +2

Query  296  MHPFLSDFQSKIEKALKSNFKRM-RRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENP  472
            + P +S F  +++  +KS   R+ ++DG  LM S   K G+F     +L +Q+Q W+ENP
Sbjct  23   LDPAISKFFVQLQIVVKSQLSRLAKQDGMSLMRSVQRKGGSFSYSEAELNEQLQAWRENP  82

Query  473  TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLL  652
            +W D PP IKVTVPKGSLCNL+ +V+VGLPPDAVYNIV DP+N+RVFKNI+ V+SRKVL+
Sbjct  83   SWVDKPPLIKVTVPKGSLCNLDVEVDVGLPPDAVYNIVIDPDNRRVFKNIKVVVSRKVLV  142

Query  653  DEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            D+G RQVV+L+QAA+WKFLWWSGTIS++VLVDQNR
Sbjct  143  DQGHRQVVDLDQAAIWKFLWWSGTISINVLVDQNR  177



>gb|AAA79703.1| OBP32pep, partial [Arabidopsis thaliana]
Length=255

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  317  FQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGI-LXVDLEKQMQPWKENPTWTDHPP  493
            F  K++  LKS  K +  D   + SS+   KG   I + +DLEKQ+  W+ENP+WTD  P
Sbjct  3    FSQKLQTRLKSQLKNLTDDKHGIGSSWRQDKGNSSISMQIDLEKQLDCWRENPSWTDQIP  62

Query  494  EIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQV  673
             +KV +PKGSLCNL A+VNVGLPPDAVYNIV DP+N+RVFKNI++V+SRKVL+D+G RQV
Sbjct  63   VVKVGIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNRRVFKNIKEVMSRKVLVDDGLRQV  122

Query  674  VELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VE+EQAA+W+FLWWSGTISVHVLVDQ+R
Sbjct  123  VEVEQAALWRFLWWSGTISVHVLVDQDR  150



>gb|KHG03137.1| hypothetical protein F383_26743 [Gossypium arboreum]
Length=343

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 12/191 (6%)
 Frame = +2

Query  221  MKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNF---------KRMRRD  373
            M+  K + ++P  + +   +        FL    ++++  LK  F         KR+ +D
Sbjct  1    MEGRKVSMDVPRSDRNGTLKFLDPAFSAFLLQLPNQLQNCLKGKFRFLLSKSQIKRLGKD  60

Query  374  --GDVLMSSFVGKKGAFGI-LXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAK  544
              G   ++ F+GK+ +    L +DLEKQ+Q W+ENP W + PPEIKV+VPKGSLCNL AK
Sbjct  61   NVGIKSVNPFLGKEKSLSTALGIDLEKQLQAWRENPIWVNQPPEIKVSVPKGSLCNLKAK  120

Query  545  VNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGT  724
            V+VGLPPDAVYNIV DP+NKRVFKNI++VISRKVL+D G RQVV++EQ A+W+FLWWSGT
Sbjct  121  VDVGLPPDAVYNIVTDPDNKRVFKNIKEVISRKVLVDIGKRQVVDVEQKALWRFLWWSGT  180

Query  725  ISVHVLVDQNR  757
            ISVHVLVDQNR
Sbjct  181  ISVHVLVDQNR  191



>ref|XP_006438371.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
 gb|ESR51611.1| hypothetical protein CICLE_v10032036mg [Citrus clementina]
Length=278

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +2

Query  386  MSSFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLP  562
            MSS +G+ KG+   L VD+E+Q++ W+ENPTWTD PP IKV+VPKGSLCNLN KVNVGLP
Sbjct  1    MSSDLGEGKGSTTALEVDMERQLEHWRENPTWTDQPPIIKVSVPKGSLCNLNVKVNVGLP  60

Query  563  PDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVL  742
            PDAVYNIV DP+N+RVFKNI++V+SR+VL+DEG RQVVE+EQAA+WKFLWWSG + VHVL
Sbjct  61   PDAVYNIVTDPDNRRVFKNIKEVLSRRVLIDEGHRQVVEVEQAALWKFLWWSGVMLVHVL  120

Query  743  VDQNR  757
            VDQ+R
Sbjct  121  VDQDR  125



>ref|XP_008353020.1| PREDICTED: uncharacterized protein LOC103416549 isoform X2 [Malus 
domestica]
Length=332

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = +2

Query  215  GEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSS  394
            GE ++   N  +  +E + + +         L     K++  +K   +R+ +D  V   S
Sbjct  2    GETEVTTTNVNVGKNERNGQLKAFDLAFSKALLQVPQKLQNCVK--LRRLVKDDGVKTVS  59

Query  395  FVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAV  574
             + KK A   L +DLEKQ+Q W+ENP+W D PP++KV+VPKGSLCNL   V+VGLPPDAV
Sbjct  60   CLPKKAAS--LELDLEKQLQAWRENPSWVDQPPDMKVSVPKGSLCNLGVSVDVGLPPDAV  117

Query  575  YNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            YNIV DP+NKRVFKNI++VISR VL+DEG RQVVELEQAA+WKFLWWSGT +VHVLVDQN
Sbjct  118  YNIVTDPDNKRVFKNIKEVISRNVLVDEGHRQVVELEQAAIWKFLWWSGTFAVHVLVDQN  177

Query  755  R  757
            R
Sbjct  178  R  178



>ref|XP_003532005.1| PREDICTED: uncharacterized protein LOC100808684 isoform X1 [Glycine 
max]
Length=334

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +2

Query  296  MHPFLSDFQSKIEKALKSNFKRM-RRDGDVLMSSFVGKKG--AFGILXVDLEKQMQPWKE  466
            + P +S F  +++  +KS   R+ ++DG  LMSS V +KG  +F     +L +Q+Q W+E
Sbjct  26   LDPAISKFFVQLQSVVKSRLSRLAKQDGMSLMSS-VQRKGDKSFSYSEAELNEQLQAWRE  84

Query  467  NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKV  646
            NP+W D PP IKVT PKGSLCNL+ +V+VGLPPDAVYNIV DP+N+RVFKNI++V+SRKV
Sbjct  85   NPSWVDKPPLIKVTAPKGSLCNLDVEVDVGLPPDAVYNIVIDPDNRRVFKNIKEVVSRKV  144

Query  647  LLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            L+DEG RQVV+L+QAA+WKFLWWSGTIS++VLVDQNR
Sbjct  145  LVDEGHRQVVDLDQAAIWKFLWWSGTISINVLVDQNR  181



>gb|KHN26884.1| hypothetical protein glysoja_035523 [Glycine soja]
Length=334

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +2

Query  296  MHPFLSDFQSKIEKALKSNFKRM-RRDGDVLMSSFVGKKG--AFGILXVDLEKQMQPWKE  466
            + P +S F  +++  +KS   R+ ++DG  LMSS V +KG  +F     +L +Q+Q W+E
Sbjct  26   LDPAISKFFVQLQSVVKSRLSRLAKQDGMSLMSS-VQRKGDKSFSYSEAELNEQLQAWRE  84

Query  467  NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKV  646
            NP+W D PP IKVT PKGSLCNL+ +V+VGLPPDAVYNIV DP+N+RVFKNI++V+SRKV
Sbjct  85   NPSWVDKPPLIKVTAPKGSLCNLDVEVDVGLPPDAVYNIVIDPDNRRVFKNIKEVVSRKV  144

Query  647  LLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            L+DEG RQVV+L+QAA+WKFLWWSGTIS++VLVDQNR
Sbjct  145  LVDEGHRQVVDLDQAAIWKFLWWSGTISINVLVDQNR  181



>ref|XP_006840743.1| hypothetical protein AMTR_s00096p00135790 [Amborella trichopoda]
 gb|ERN02418.1| hypothetical protein AMTR_s00096p00135790 [Amborella trichopoda]
Length=334

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = +2

Query  305  FLSDFQSKIEKALK--SNFKRMRRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTW  478
            FL     K +  LK     ++ +   D   S F+   G   ++   LEKQ+Q WKENPTW
Sbjct  29   FLMQIPEKFQNCLKHLEQSQKHQNIQDSETSMFLKNHGFDSVMDASLEKQLQAWKENPTW  88

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
             DHPPEIKV+VPKGSLCNLN K  VGLPPDAVYNIV DPENKRVFKNI++VISR+V+++E
Sbjct  89   VDHPPEIKVSVPKGSLCNLNVKFEVGLPPDAVYNIVTDPENKRVFKNIKEVISRRVMVNE  148

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVVE+EQAA+W+FLWWSG + VHV VDQNR
Sbjct  149  GQRQVVEVEQAALWRFLWWSGVMLVHVFVDQNR  181



>ref|XP_010100449.1| hypothetical protein L484_027761 [Morus notabilis]
 gb|EXB82583.1| hypothetical protein L484_027761 [Morus notabilis]
Length=340

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 132/187 (71%), Gaps = 6/187 (3%)
 Frame = +2

Query  215  GEMKLDKQNNEIPVDESSERARLSSSVMHPFLSDFQSKIEKALK----SNFKRMRRDGDV  382
             ++++ +++ EI   E +  ++  +  +  FL     K++ +LK    S  KR  +D   
Sbjct  2    AKIEMKRRSVEIQEKERNGSSKEFNMAVPKFLVQLPHKLQNSLKASTLSQLKRFAKDDGH  61

Query  383  LMSSFVGKKG--AFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVG  556
               ++  K+G        VDL+KQ+Q W+ENP+W D   EIKV+VPKGSLCNL   VNVG
Sbjct  62   FSLNYDRKRGKRTLTFSDVDLKKQLQAWRENPSWADQHSEIKVSVPKGSLCNLKVNVNVG  121

Query  557  LPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVH  736
            LPPDAV+NIV DP+NK+VFKNI++VISRKVL+DEG RQVVELEQAA+WKFLWWSGTI+VH
Sbjct  122  LPPDAVFNIVIDPDNKKVFKNIKEVISRKVLVDEGHRQVVELEQAALWKFLWWSGTIAVH  181

Query  737  VLVDQNR  757
            VLVDQNR
Sbjct  182  VLVDQNR  188



>ref|XP_010023547.1| PREDICTED: uncharacterized protein LOC104414205 [Eucalyptus grandis]
 gb|KCW59846.1| hypothetical protein EUGRSUZ_H02587 [Eucalyptus grandis]
 gb|KCW59847.1| hypothetical protein EUGRSUZ_H02587 [Eucalyptus grandis]
Length=338

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 120/162 (74%), Gaps = 7/162 (4%)
 Frame = +2

Query  293  VMHPFLSDFQSKIEKALKSNFK----RMRRDGDVLMSSFVGKKGAFGILX---VDLEKQM  451
            V+ P +S F  ++ + L + FK     ++R+ +   S     +     L    V+LEKQM
Sbjct  24   VLDPAISRFFEQLPQKLGNGFKLPLKMIKRENERANSRSSSLRNLSKTLTDFEVNLEKQM  83

Query  452  QPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKV  631
            Q W ENP W D  PE+KV+VPKGSLCNLN  VNVGLPPDAVYNIV DP+NKRVFKNI++V
Sbjct  84   QAWHENPVWVDQAPEVKVSVPKGSLCNLNVNVNVGLPPDAVYNIVTDPDNKRVFKNIKEV  143

Query  632  ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ISR+VL+DEG RQVVELEQAA+WKFLWWSGTISVHVLVDQNR
Sbjct  144  ISRRVLVDEGLRQVVELEQAALWKFLWWSGTISVHVLVDQNR  185



>ref|XP_010925756.1| PREDICTED: uncharacterized protein LOC105048213 isoform X1 [Elaeis 
guineensis]
Length=333

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = +2

Query  254  VDESSERARLSSSVMHP---FLSDFQSKIEKALKSNFKRM---RRDGDVLMSSFVGKKGA  415
            +D  + + +   S ++P   F      K++  LK++ K +    +  D+     + +K  
Sbjct  10   LDNHAGKRKGRQSTLNPAFDFFVQMPQKLQNFLKTHLKHISMNEQKFDIAKPLMLTEKEP  69

Query  416  FGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADP  595
               L V+L+KQ++ W+ENP W D PPEIKV+VPKGSLCNL+AK  VGLPPDA+YNI+ DP
Sbjct  70   CTALEVNLDKQLEAWRENPKWVDPPPEIKVSVPKGSLCNLHAKFKVGLPPDAIYNIIVDP  129

Query  596  ENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             NKRVFKNI++VISRKVL+DEG RQV+E+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  130  HNKRVFKNIKEVISRKVLIDEGLRQVIEVEQAAIWRFLWWSGTISVHVLVDQNR  183



>ref|XP_004956598.1| PREDICTED: uncharacterized protein LOC101756968 [Setaria italica]
Length=387

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 117/150 (78%), Gaps = 6/150 (4%)
 Frame = +2

Query  326  KIEKALKSNFKR-MRRDG-----DVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTWTDH  487
            KI+ +LK +F R +++DG     +  MS  +GK+         L++Q+Q W+ NP+WTD 
Sbjct  82   KIQNSLKVHFGRFLKKDGAGRGMNAQMSPEMGKESCTAAAQFSLDRQLQAWRNNPSWTDE  141

Query  488  PPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPR  667
            PPEIKVTVP+GSLCNLN +   GLPPDAVYNI+ DPENKRVFKNI++VISRKVLLDEG R
Sbjct  142  PPEIKVTVPEGSLCNLNLRFKAGLPPDAVYNIIIDPENKRVFKNIKEVISRKVLLDEGSR  201

Query  668  QVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            QVVE+EQAA+WKFLWWSG ++VHV V+QNR
Sbjct  202  QVVEVEQAAIWKFLWWSGILAVHVFVEQNR  231



>ref|XP_009105709.1| PREDICTED: uncharacterized protein LOC103831578 isoform X1 [Brassica 
rapa]
 ref|XP_009105710.1| PREDICTED: uncharacterized protein LOC103831578 isoform X2 [Brassica 
rapa]
Length=320

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +2

Query  263  SSERARLSSSVMHPFLSDF---QSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXV  433
            S  +  + SSV  P LS F     K++  +KS  K +  D      + +        + +
Sbjct  11   SDTKRNVVSSVFDPALSRFVGLSQKLQARVKSQLKNLTADKHGREDNEISSNS----IQM  66

Query  434  DLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF  613
            DLEKQ+  W+ NP+WTD PP +KV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+RVF
Sbjct  67   DLEKQLDSWRGNPSWTDQPPVVKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNRRVF  126

Query  614  KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KNI++V+SRKV++DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  127  KNIKEVLSRKVVVDEGLRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  174



>ref|XP_004509756.1| PREDICTED: uncharacterized protein LOC101489238 [Cicer arietinum]
Length=335

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRM--RRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTW  478
            F     +K +  LK    R+   +  + + S      G F     +L +Q+Q WK NP+W
Sbjct  33   FFVQLPNKFQNVLKYQLSRLAKHKGMNFVRSDQRNGSGTFSASEAELIEQLQAWKTNPSW  92

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
             D PPEIKVTVPKGSLCNLNA+V+VGLPPDAVYNIV DP+N+RVFKNI++VISRKVL+DE
Sbjct  93   VDKPPEIKVTVPKGSLCNLNAEVDVGLPPDAVYNIVTDPDNRRVFKNIKEVISRKVLVDE  152

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVV+LEQAA+WKFLWWSGTIS++VLVDQNR
Sbjct  153  GDRQVVDLEQAAIWKFLWWSGTISINVLVDQNR  185



>gb|ACJ86261.1| unknown [Medicago truncatula]
Length=224

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGA--FGILXVDLEKQMQPWKENPTW  478
            F      K +  +K+   R+ +   +     V + G+  F     +L++Q+Q WKENP+W
Sbjct  33   FFVQLPHKFQNIVKNQMSRLAKHEGMNWGRSVQRNGSVTFSASEAELKEQLQAWKENPSW  92

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
             D PPEIKVTVPKGSLCNLN +V+VGLPPDAVYNIV DP+N+RVFKNI++VISRKVL+DE
Sbjct  93   VDKPPEIKVTVPKGSLCNLNVEVDVGLPPDAVYNIVIDPDNRRVFKNIKEVISRKVLVDE  152

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVV+L+QAA+W+FLWWSGTIS++VLVDQNR
Sbjct  153  GHRQVVDLQQAAIWRFLWWSGTISINVLVDQNR  185



>emb|CDY47136.1| BnaA08g05470D [Brassica napus]
Length=320

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 122/168 (73%), Gaps = 7/168 (4%)
 Frame = +2

Query  263  SSERARLSSSVMHPFLSDF---QSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXV  433
            S  +  + SSV  P  S F     K++  +KS  K +  D      + +        + +
Sbjct  11   SDTKRNVVSSVFDPAFSRFVGLSQKLQARVKSQLKNLTADKHGREDNEISSNS----IQM  66

Query  434  DLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF  613
            DLEKQ+  W+ NP+WTD PP +KV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+RVF
Sbjct  67   DLEKQLDSWRGNPSWTDQPPVVKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNRRVF  126

Query  614  KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KNI++V+SRKV++DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  127  KNIKEVLSRKVVVDEGLRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  174



>ref|XP_008812484.1| PREDICTED: uncharacterized protein LOC103723369 isoform X2 [Phoenix 
dactylifera]
Length=333

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 121/162 (75%), Gaps = 6/162 (4%)
 Frame = +2

Query  290  SVMHP---FLSDFQSKIEKALKSNFKRMRRDG---DVLMSSFVGKKGAFGILXVDLEKQM  451
            S ++P   F      KI+  LK++ K + ++    D+     + +K     L V+L+KQ+
Sbjct  22   STLNPAFDFFVQMPQKIQNCLKTHLKHISKNEQKFDIAKPLMLTEKEPCTALDVNLDKQL  81

Query  452  QPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKV  631
            + W+ENP W D PPEIKV+VPKGSLC L+ K  VGLPPDA+YNI+ DP+NKRVFKNI++V
Sbjct  82   EAWRENPKWIDPPPEIKVSVPKGSLCKLHVKFKVGLPPDAIYNIIVDPDNKRVFKNIKEV  141

Query  632  ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  142  ISRKVLVDEGLRQVVEVEQAAIWRFLWWSGTISVHVLVDQNR  183



>ref|XP_008812483.1| PREDICTED: uncharacterized protein LOC103723369 isoform X1 [Phoenix 
dactylifera]
Length=341

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 121/162 (75%), Gaps = 6/162 (4%)
 Frame = +2

Query  290  SVMHP---FLSDFQSKIEKALKSNFKRMRRDG---DVLMSSFVGKKGAFGILXVDLEKQM  451
            S ++P   F      KI+  LK++ K + ++    D+     + +K     L V+L+KQ+
Sbjct  30   STLNPAFDFFVQMPQKIQNCLKTHLKHISKNEQKFDIAKPLMLTEKEPCTALDVNLDKQL  89

Query  452  QPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKV  631
            + W+ENP W D PPEIKV+VPKGSLC L+ K  VGLPPDA+YNI+ DP+NKRVFKNI++V
Sbjct  90   EAWRENPKWIDPPPEIKVSVPKGSLCKLHVKFKVGLPPDAIYNIIVDPDNKRVFKNIKEV  149

Query  632  ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ISRKVL+DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  150  ISRKVLVDEGLRQVVEVEQAAIWRFLWWSGTISVHVLVDQNR  191



>gb|KHG05657.1| Trimethylamine-N-oxide reductase [Gossypium arboreum]
Length=360

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 26/183 (14%)
 Frame = +2

Query  287  SSVMHP----FLSDFQSKIEKALKSNFKRMRRDGDVL--MSSFVGKK-GAFGILXVDLEK  445
            S V+ P    FL    SK++  LKS  KR+ +DG  +  ++SF+ KK G+   L ++LEK
Sbjct  18   SKVLDPAFSAFLVQLPSKLQNCLKSQLKRLAKDGARIKPLNSFLEKKNGSSSGLQINLEK  77

Query  446  QMQPWKENPTWTDHPPEI-------------------KVTVPKGSLCNLNAKVNVGLPPD  568
            Q+Q W+ENP+W + PPEI                   +V+V KGSLC L A ++VGLPPD
Sbjct  78   QLQAWRENPSWVNPPPEIEVLGYDPPKILQLHKPAHIRVSVAKGSLCYLKATIDVGLPPD  137

Query  569  AVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
            AVYNIV DP+N+RVFKN+++VISRKVL+DEG RQVVE+EQAA W+FLWWSGTISVHVLVD
Sbjct  138  AVYNIVTDPDNRRVFKNVKEVISRKVLIDEGQRQVVEVEQAAWWRFLWWSGTISVHVLVD  197

Query  749  QNR  757
            QNR
Sbjct  198  QNR  200



>ref|XP_004143071.1| PREDICTED: uncharacterized protein LOC101212235 [Cucumis sativus]
 gb|KGN62288.1| hypothetical protein Csa_2G348260 [Cucumis sativus]
Length=337

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = +2

Query  371  DGDVLMSSFVG------KKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCN  532
            DG  LMS          KKG      +D+EKQ+Q W+ENP+WTD PP+IKV+VPK +L  
Sbjct  47   DGQKLMSMTTSPFTKGEKKGPSTSWELDVEKQLQAWRENPSWTDKPPQIKVSVPKDTLSR  106

Query  533  LNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLW  712
            LN KV+VGLPPDAVYNIV DP+NKRVFKNI++VISR+VL+DEG RQVVELEQAA+W+FLW
Sbjct  107  LNVKVDVGLPPDAVYNIVTDPDNKRVFKNIKEVISRRVLIDEGSRQVVELEQAALWRFLW  166

Query  713  WSGTISVHVLVDQNR  757
            WSGTISVHVLVDQNR
Sbjct  167  WSGTISVHVLVDQNR  181



>emb|CDY11589.1| BnaC06g31500D [Brassica napus]
Length=318

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 121/168 (72%), Gaps = 7/168 (4%)
 Frame = +2

Query  263  SSERARLSSSVMHPFLSDF---QSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXV  433
            S  +  + SSV  P  S F     K++  +KS  K +  D      + +        + +
Sbjct  9    SDTKRNIVSSVFDPAFSRFVGLSQKLQARVKSQLKNLTADKHGRQDNEISSNS----IQM  64

Query  434  DLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF  613
            DLEKQ+  W+ NP+W D PP +KV++PKGSLCNL A+VNVGLPPDAVYNIV DP+N+RVF
Sbjct  65   DLEKQLDSWRGNPSWADQPPVVKVSIPKGSLCNLKAEVNVGLPPDAVYNIVIDPDNRRVF  124

Query  614  KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KNI++V+SRKV++DEG RQVVE+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  125  KNIKEVLSRKVVVDEGLRQVVEVEQAALWRFLWWSGTISVHVLVDQNR  172



>ref|XP_004166540.1| PREDICTED: uncharacterized protein LOC101230152 [Cucumis sativus]
Length=337

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = +2

Query  371  DGDVLMSSFVG------KKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCN  532
            DG  LMS          KKG      +D+EKQ+Q W+ENP+WTD PP+IKV+VPK +L  
Sbjct  47   DGQKLMSMTTSPFTKGEKKGPSTSWELDVEKQLQAWRENPSWTDKPPQIKVSVPKDTLSR  106

Query  533  LNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLW  712
            LN KV+VGLPPDAVYNIV DP+NKRVFKNI++VISR+VL+DEG RQVVELEQAA+W+FLW
Sbjct  107  LNVKVDVGLPPDAVYNIVTDPDNKRVFKNIKEVISRRVLIDEGSRQVVELEQAALWRFLW  166

Query  713  WSGTISVHVLVDQNR  757
            WSGTISVHVLVDQNR
Sbjct  167  WSGTISVHVLVDQNR  181



>ref|XP_008444321.1| PREDICTED: uncharacterized protein LOC103487688 [Cucumis melo]
Length=337

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  404  KKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNI  583
            KKG+     +D+EKQ+Q W+ENP+WTD PP+IKV+VPK +L  LN KV+VGLPPDAVYNI
Sbjct  64   KKGSSTSWELDVEKQLQAWRENPSWTDKPPQIKVSVPKDTLSRLNVKVDVGLPPDAVYNI  123

Query  584  VADPENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            V DP+NKRVFKNI++VISR+VL+DEG RQVVELEQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  124  VTDPDNKRVFKNIKEVISRRVLVDEGSRQVVELEQAALWRFLWWSGTISVHVLVDQNR  181



>gb|KEH20028.1| OBP32pep, putative [Medicago truncatula]
Length=337

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGA--FGILXVDLEKQMQPWKENPTW  478
            F      K +  +K+   R+ +   +     V + G+  F     +L++Q+Q WKENP+W
Sbjct  33   FFVQLPHKFQNIVKNQMSRLAKHEGMNWGRSVQRNGSVTFSASEAELKEQLQAWKENPSW  92

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
             D PPEIKVTVPKGSLCNLN +V+VGLPPDAVYNIV DP+N+RVFKNI++VISRKVL+DE
Sbjct  93   VDKPPEIKVTVPKGSLCNLNVEVDVGLPPDAVYNIVIDPDNRRVFKNIKEVISRKVLVDE  152

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVV+L+QAA+W+FLWWSGTIS++VLVDQNR
Sbjct  153  GHRQVVDLQQAAIWRFLWWSGTISINVLVDQNR  185



>gb|KEH20026.1| OBP32pep, putative [Medicago truncatula]
Length=386

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGA--FGILXVDLEKQMQPWKENPTW  478
            F      K +  +K+   R+ +   +     V + G+  F     +L++Q+Q WKENP+W
Sbjct  82   FFVQLPHKFQNIVKNQMSRLAKHEGMNWGRSVQRNGSVTFSASEAELKEQLQAWKENPSW  141

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
             D PPEIKVTVPKGSLCNLN +V+VGLPPDAVYNIV DP+N+RVFKNI++VISRKVL+DE
Sbjct  142  VDKPPEIKVTVPKGSLCNLNVEVDVGLPPDAVYNIVIDPDNRRVFKNIKEVISRKVLVDE  201

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVV+L+QAA+W+FLWWSGTIS++VLVDQNR
Sbjct  202  GHRQVVDLQQAAIWRFLWWSGTISINVLVDQNR  234



>gb|KEH20027.1| OBP32pep, putative [Medicago truncatula]
Length=374

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGA--FGILXVDLEKQMQPWKENPTW  478
            F      K +  +K+   R+ +   +     V + G+  F     +L++Q+Q WKENP+W
Sbjct  70   FFVQLPHKFQNIVKNQMSRLAKHEGMNWGRSVQRNGSVTFSASEAELKEQLQAWKENPSW  129

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
             D PPEIKVTVPKGSLCNLN +V+VGLPPDAVYNIV DP+N+RVFKNI++VISRKVL+DE
Sbjct  130  VDKPPEIKVTVPKGSLCNLNVEVDVGLPPDAVYNIVIDPDNRRVFKNIKEVISRKVLVDE  189

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVV+L+QAA+W+FLWWSGTIS++VLVDQNR
Sbjct  190  GHRQVVDLQQAAIWRFLWWSGTISINVLVDQNR  222



>ref|XP_007153742.1| hypothetical protein PHAVU_003G061200g [Phaseolus vulgaris]
 gb|ESW25736.1| hypothetical protein PHAVU_003G061200g [Phaseolus vulgaris]
Length=335

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = +2

Query  296  MHPFLSDFQSKIEKALKSNFKRM-RRDG-DVLMSSFVGKKGAFGILXVDLEKQMQPWKEN  469
            + P +S F  +++  +K+   R+ ++DG +++ S+       F     +L +Q+Q W+EN
Sbjct  26   LDPAISKFFVQLQSVVKARLSRLAKQDGMNLVRSAQKNDHKPFSYSEAELNEQLQAWREN  85

Query  470  PTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVL  649
            P W D  P IKVTVPKGSLCNLN +V+VGLPPDAVYNIV DP+N+RVFKNI++VISRKVL
Sbjct  86   PAWVDRSPLIKVTVPKGSLCNLNVEVDVGLPPDAVYNIVTDPDNRRVFKNIKEVISRKVL  145

Query  650  LDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +DEG RQVV+L+QAA+WKFLWWSGTIS++VLVDQNR
Sbjct  146  VDEGHRQVVDLDQAAIWKFLWWSGTISINVLVDQNR  181



>ref|XP_006661122.1| PREDICTED: uncharacterized protein LOC102713573 [Oryza brachyantha]
Length=339

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 7/157 (4%)
 Frame = +2

Query  308  LSDFQSKIEKALKSNFKR-MRRDG------DVLMSSFVGKKGAFGILXVDLEKQMQPWKE  466
            L     +I+ +LK +  R +R++G      ++L   F           + LEKQ+Q WK 
Sbjct  28   LVQIPDRIQNSLKVHLGRFLRKNGVGGTEAEMLPMQFQETCSTAAATEIKLEKQLQAWKN  87

Query  467  NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKV  646
            NP+W+D PPEIKVTVP+GSLCNLN K   GLPPDAVYNI+ DPENKRVFKNI++VISRKV
Sbjct  88   NPSWSDEPPEIKVTVPQGSLCNLNLKFKAGLPPDAVYNIIIDPENKRVFKNIKEVISRKV  147

Query  647  LLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +LDEG RQ+VE+EQAA+W+FLWWSG +SVHV VDQNR
Sbjct  148  VLDEGSRQIVEVEQAAIWRFLWWSGVLSVHVFVDQNR  184



>ref|XP_009394240.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394241.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394242.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394243.1| PREDICTED: uncharacterized protein LOC103979763 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = +2

Query  308  LSDFQSKIEKALKSNFKRM---RRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTW  478
            L  F   ++  LK++ +++   R+  D      +  + +   L +D  KQ+  WKEN  W
Sbjct  31   LVQFHQNLQNCLKAHLRKVVKNRQKFDARSPLTLVDRESPIALDIDFHKQLDAWKENSFW  90

Query  479  TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDE  658
             D PPEIKV+VPKGSLCNLN    VGLPPDA+YNIV DPENKRVFKNI++VISRKVL+DE
Sbjct  91   VDQPPEIKVSVPKGSLCNLNVNFKVGLPPDAIYNIVTDPENKRVFKNIKEVISRKVLIDE  150

Query  659  GPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            G RQVVE+EQAA+W+FLWWSGTISVHV+VDQNR
Sbjct  151  GLRQVVEVEQAAIWRFLWWSGTISVHVIVDQNR  183



>gb|EMT22456.1| hypothetical protein F775_02661 [Aegilops tauschii]
Length=344

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 114/159 (72%), Gaps = 9/159 (6%)
 Frame = +2

Query  308  LSDFQSKIEKALKSNFKRMRRDGDV--------LMSSFVG-KKGAFGILXVDLEKQMQPW  460
            L     KI+ +LK +F R  +   V        + S  VG    A     V L++Q+Q W
Sbjct  25   LMQIPDKIQNSLKLHFGRFLKTDGVSGGGIKAQMPSEKVGVACTAAAASEVSLDRQLQAW  84

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR  640
            ++NP+WTD PPEIKVTVP+GSLCNLN +   GLPPDAVYNI+ DPENKRVFKNI++V+SR
Sbjct  85   RDNPSWTDQPPEIKVTVPQGSLCNLNLRFQAGLPPDAVYNIIIDPENKRVFKNIKEVVSR  144

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             VLLDEG RQ+VE+EQAA+WKFLWWSG +SVHV VDQ+R
Sbjct  145  NVLLDEGSRQIVEVEQAAIWKFLWWSGILSVHVFVDQDR  183



>ref|XP_003577995.1| PREDICTED: uncharacterized protein LOC100824540 [Brachypodium 
distachyon]
Length=335

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = +2

Query  308  LSDFQSKIEKALKSNFKRMRRDGDV------LMSSFV-GKKGAFGILXVDLEKQMQPWKE  466
            L     KI+ +LK +F R  + G V      + S  V G         + LE+Q+Q W++
Sbjct  25   LMQIPDKIQSSLKLHFGRFLKMGGVGGIKAQMPSEKVRGSCSTAATAGICLERQLQAWRD  84

Query  467  NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKV  646
            + +WTD PPEIKVTVP+GSLCNLN +   GLPPDAVYNI+ DPEN+RVFKNI++V+SRKV
Sbjct  85   DSSWTDQPPEIKVTVPQGSLCNLNLRFKAGLPPDAVYNIIIDPENRRVFKNIKEVVSRKV  144

Query  647  LLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            LLDEG RQVVE+EQAA+WKFLWWSG +SVHV VDQNR
Sbjct  145  LLDEGLRQVVEVEQAAIWKFLWWSGILSVHVFVDQNR  181



>gb|EYU31258.1| hypothetical protein MIMGU_mgv1a009978mg [Erythranthe guttata]
Length=325

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 117/157 (75%), Gaps = 10/157 (6%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDV------LMSSFVGKKGAFGILXVDLEKQMQPWKE  466
            F+S FQ K+ ++L+  +K+   +  V      L++    K+ +F    + LE Q+  WK+
Sbjct  24   FVSFFQKKVLESLEYLYKQSMTEDRVAALESDLLTVSRDKENSF----LSLESQLCAWKD  79

Query  467  NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKV  646
            NP W D P +IKVT+PKG+L  L+  V+VGLPPDAVYNIV DP+NKRVFKNI++VISRKV
Sbjct  80   NPAWVDRPADIKVTIPKGTLSKLSLSVDVGLPPDAVYNIVTDPDNKRVFKNIKEVISRKV  139

Query  647  LLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ++DEG RQVVELEQAAMW+FL WSGTISV+VLVDQNR
Sbjct  140  IVDEGSRQVVELEQAAMWRFLLWSGTISVNVLVDQNR  176



>dbj|BAD23602.1| hypothetical protein [Oryza sativa Japonica Group]
Length=378

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 112/158 (71%), Gaps = 9/158 (6%)
 Frame = +2

Query  308  LSDFQSKIEKALKSNFKR-MRRDG-------DVLMSSFVGKKGAFGILXVDLEKQMQPWK  463
            L     KI+ +LK +F R ++++G       ++L     G         V L+KQ+Q WK
Sbjct  78   LVQIPDKIQNSLKVHFGRFLKKNGFGGGSEAEMLPMQMQGTCTTVAP-EVRLDKQLQAWK  136

Query  464  ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRK  643
             NP W+D PPEIKVTVP+GSLCNLN K   GLPPDAVYNI+ DPENKRVFKNI++VISRK
Sbjct  137  NNPIWSDEPPEIKVTVPQGSLCNLNLKFKAGLPPDAVYNIIIDPENKRVFKNIKEVISRK  196

Query  644  VLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            V+LDEG RQ+VE+EQAA+W+FLWWSG +SVHV   Q R
Sbjct  197  VVLDEGQRQIVEVEQAAIWRFLWWSGVLSVHVKFKQGR  234



>ref|XP_002462231.1| hypothetical protein SORBIDRAFT_02g022180 [Sorghum bicolor]
 gb|EER98752.1| hypothetical protein SORBIDRAFT_02g022180 [Sorghum bicolor]
Length=1479

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 10/154 (6%)
 Frame = +2

Query  326   KIEKALKSNFKR-MRRDGDVL-MSSFVGKKGA--------FGILXVDLEKQMQPWKENPT  475
             KI+ +LK +F R + +DG    MS+ V  + A               L++Q+Q W +NP+
Sbjct  859   KIQSSLKVHFGRFLNKDGHGRRMSAEVSSEKAKQSCSAAASASAEFRLDRQLQAWWDNPS  918

Query  476   WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLD  655
             WTD PPEIKVTVP+ SLCNLN +   GLPPDAVYNI+ DPENKRVFKNI++VISRKVLLD
Sbjct  919   WTDEPPEIKVTVPEDSLCNLNLRFKAGLPPDAVYNIIIDPENKRVFKNIKEVISRKVLLD  978

Query  656   EGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             EG RQ+VE+EQAA+WKFLWWSG +SVHV VDQNR
Sbjct  979   EGSRQIVEVEQAAIWKFLWWSGILSVHVFVDQNR  1012



>ref|XP_010682540.1| PREDICTED: uncharacterized protein LOC104897377 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682541.1| PREDICTED: uncharacterized protein LOC104897377 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682542.1| PREDICTED: uncharacterized protein LOC104897377 [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  431  VDLEKQMQPWKENPTW--TDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
             DL+KQ+Q W+ +P W   D PPEI VTVP GSLCNL+ K +VGLPPDAVYNIV DP++K
Sbjct  74   ADLQKQLQLWRADPYWGDQDQPPEINVTVPTGSLCNLHVKFDVGLPPDAVYNIVIDPDSK  133

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RVF+NI++VISRKVL+D+G RQVVE+EQAA+WKFLW SGTI+VHVLVDQNR
Sbjct  134  RVFRNIKEVISRKVLVDDGSRQVVEVEQAAIWKFLWLSGTIAVHVLVDQNR  184



>gb|EPS62234.1| hypothetical protein M569_12558, partial [Genlisea aurea]
Length=262

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  431  VDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
            + LEKQM  W++NP+W D PP IKVT+P+GSL  L+  V+VGLPPDAV++IV DPENKRV
Sbjct  3    LSLEKQMNNWRDNPSWEDRPPLIKVTIPEGSLSFLSLTVDVGLPPDAVFDIVIDPENKRV  62

Query  611  FKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            FKNI++VISRKVL+DEG RQVVE+EQ+A+W+FLW SGT+S++VLVDQNR
Sbjct  63   FKNIKEVISRKVLVDEGSRQVVEVEQSAIWRFLWLSGTLSINVLVDQNR  111



>ref|XP_006416072.1| hypothetical protein EUTSA_v10008158mg [Eutrema salsugineum]
 gb|ESQ34425.1| hypothetical protein EUTSA_v10008158mg [Eutrema salsugineum]
Length=332

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 108/152 (71%), Gaps = 12/152 (8%)
 Frame = +2

Query  329  IEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD---------LEKQMQPWKENPTWT  481
            I++ LK+ FKR+R   +V   S + K  +  I+  +         LEKQ+Q W++NP+WT
Sbjct  38   IQEPLKAEFKRLRNVKEV---SLITKPASSEIVTTNYDEERYEEKLEKQLQAWRDNPSWT  94

Query  482  DHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEG  661
            D PP+++V   KGS C+LN +VNVGLPP++VYNI   P+NKR FKNI++ ISRKVL++EG
Sbjct  95   DQPPKVQVKTQKGSFCHLNVEVNVGLPPESVYNIFTHPDNKRYFKNIKECISRKVLMEEG  154

Query  662  PRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              Q VE++QAA WKFLWW+GT  +H++V +NR
Sbjct  155  AVQTVEVKQAAAWKFLWWAGTFPIHLIVQENR  186



>ref|XP_010551585.1| PREDICTED: uncharacterized protein LOC104822153 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551586.1| PREDICTED: uncharacterized protein LOC104822153 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551588.1| PREDICTED: uncharacterized protein LOC104822153 isoform X1 [Tarenaya 
hassleriana]
Length=337

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +2

Query  326  KIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENPTWTDHPPEIKV  505
            K++  +K+  KRMR   + L S     +     +  D EK++Q W++NP+WTD PP++KV
Sbjct  36   KLQDPIKAELKRMRNAKEELSSIKCTAERERNNVERDQEKELQAWRDNPSWTDQPPKVKV  95

Query  506  TVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVELE  685
               KGS C+LN +V VGLPPD V++I   P+NKR F+NI++ ISRK+L++E  RQVVE+E
Sbjct  96   KTQKGSFCHLNIEVTVGLPPDTVFDIFTHPDNKRYFRNIKENISRKILINEESRQVVEVE  155

Query  686  QAAMWKFLWWSGTISVHVLVDQNR  757
            QAA W FLWWSGT  VH+LVD+NR
Sbjct  156  QAAAWNFLWWSGTFPVHLLVDENR  179



>ref|XP_009110090.1| PREDICTED: uncharacterized protein LOC103835653 isoform X2 [Brassica 
rapa]
Length=317

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = +2

Query  293  VMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGIL-----XVDLEKQMQP  457
            V+  F+      I++ LK+ FKR+R   +  +   + K  A            LE+Q+Q 
Sbjct  7    VLPGFVVWINQTIQEPLKAEFKRLRNIKEQSLVKSLNKIEAETTYDKHRDEEKLERQLQS  66

Query  458  WKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVIS  637
            W+ NP+W D PP+++V    GS C+LN +VNVGLPP++VYNI   P+NKR FKNI++ IS
Sbjct  67   WRNNPSWIDQPPKVQVKTQNGSFCHLNVEVNVGLPPESVYNIFTHPDNKRYFKNIKECIS  126

Query  638  RKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RKVL++EGP Q VE++QAA WKFLWW+GT  VH++V +NR
Sbjct  127  RKVLMEEGPMQTVEVKQAAAWKFLWWAGTFPVHLIVQENR  166



>ref|XP_009110088.1| PREDICTED: uncharacterized protein LOC103835653 isoform X1 [Brassica 
rapa]
 ref|XP_009110089.1| PREDICTED: uncharacterized protein LOC103835653 isoform X1 [Brassica 
rapa]
Length=348

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = +2

Query  293  VMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGIL-----XVDLEKQMQP  457
            V+  F+      I++ LK+ FKR+R   +  +   + K  A            LE+Q+Q 
Sbjct  7    VLPGFVVWINQTIQEPLKAEFKRLRNIKEQSLVKSLNKIEAETTYDKHRDEEKLERQLQS  66

Query  458  WKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVIS  637
            W+ NP+W D PP+++V    GS C+LN +VNVGLPP++VYNI   P+NKR FKNI++ IS
Sbjct  67   WRNNPSWIDQPPKVQVKTQNGSFCHLNVEVNVGLPPESVYNIFTHPDNKRYFKNIKECIS  126

Query  638  RKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RKVL++EGP Q VE++QAA WKFLWW+GT  VH++V +NR
Sbjct  127  RKVLMEEGPMQTVEVKQAAAWKFLWWAGTFPVHLIVQENR  166



>ref|XP_009109809.1| PREDICTED: uncharacterized protein LOC103835402 [Brassica rapa]
 ref|XP_009109810.1| PREDICTED: uncharacterized protein LOC103835402 [Brassica rapa]
Length=317

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 102/148 (69%), Gaps = 5/148 (3%)
 Frame = +2

Query  329  IEKALKSNFKRMRRDGDVLMSSFVGKKGAFGIL-----XVDLEKQMQPWKENPTWTDHPP  493
            I++ LK+ FKR+R   +  +   + K  A            LE+Q+Q W+ NP+W D PP
Sbjct  19   IQEPLKAEFKRLRNIKEQSLVKSLNKIEAETTYDKHRDEEKLERQLQSWRNNPSWIDQPP  78

Query  494  EIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQV  673
            +++V    GS C+LN +VNVGLPP++VYNI   P+NKR FKNI++ ISRKVL++EGP Q 
Sbjct  79   KVQVKTQNGSFCHLNVEVNVGLPPESVYNIFTHPDNKRYFKNIKECISRKVLMEEGPMQT  138

Query  674  VELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VE++QAA WKFLWW+GT  VH++V +NR
Sbjct  139  VEVKQAAAWKFLWWAGTFPVHLIVQENR  166



>gb|AAM63743.1| unknown [Arabidopsis thaliana]
Length=332

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +2

Query  281  LSSSVMHP-FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD--LEKQM  451
              ++V+ P FL      I++ LK+ FKR+R   ++ + S    + A+     +  LEKQ+
Sbjct  21   FENNVVFPGFLVWMNQTIQEPLKAEFKRLRNVKELSLKSVSKIETAYEEHRDEEKLEKQL  80

Query  452  QPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKV  631
            Q W++NP+W D PP++ V    G  C+LN + +VGLPP+ VYNI   P+NKR FKNI++ 
Sbjct  81   QAWRDNPSWIDQPPKVVVKSQNGLFCHLNIEADVGLPPELVYNIFTHPDNKRYFKNIKEN  140

Query  632  ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ISRKVL+DEGP+Q VE++QAA WKFLWW GT  +H++V++NR
Sbjct  141  ISRKVLIDEGPKQTVEVKQAAAWKFLWWDGTCPIHLIVEENR  182



>ref|NP_564197.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98012.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AEE30403.1| uncharacterized protein AT1G23560 [Arabidopsis thaliana]
Length=332

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +2

Query  281  LSSSVMHP-FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD--LEKQM  451
              ++V+ P FL      I++ LK+ FKR+R   ++ + S    + A+     +  LEKQ+
Sbjct  21   FENNVVFPGFLVWMNQTIQEPLKAEFKRLRNVKELSLKSVSKIETAYEEHRDEEKLEKQL  80

Query  452  QPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKV  631
            Q W++NP+W D PP++ V    G  C+LN + +VGLPP+ VYNI   P+NKR FKNI++ 
Sbjct  81   QAWRDNPSWIDQPPKVVVKSQNGLFCHLNIEADVGLPPELVYNIFTHPDNKRYFKNIKEN  140

Query  632  ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ISRKVL+DEGP+Q VE++QAA WKFLWW GT  +H++V++NR
Sbjct  141  ISRKVLIDEGPKQTVEVKQAAAWKFLWWDGTCPIHLIVEENR  182



>ref|XP_010551589.1| PREDICTED: uncharacterized protein LOC104822153 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010551590.1| PREDICTED: uncharacterized protein LOC104822153 isoform X2 [Tarenaya 
hassleriana]
Length=290

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  434  DLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF  613
            D EK++Q W++NP+WTD PP++KV   KGS C+LN +V VGLPPD V++I   P+NKR F
Sbjct  25   DQEKELQAWRDNPSWTDQPPKVKVKTQKGSFCHLNIEVTVGLPPDTVFDIFTHPDNKRYF  84

Query  614  KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +NI++ ISRK+L++E  RQVVE+EQAA W FLWWSGT  VH+LVD+NR
Sbjct  85   RNIKENISRKILINEESRQVVEVEQAAAWNFLWWSGTFPVHLLVDENR  132



>emb|CDY57831.1| BnaCnng32520D [Brassica napus]
Length=316

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = +2

Query  329  IEKALKSNFKRMRR-DGDVLMSSFVGKKGAFGILXVD---LEKQMQPWKENPTWTDHPPE  496
            I + LK+ FKR++    + L+ S   +         D   LEKQ+Q W+ NP+W D PP+
Sbjct  19   IREPLKAEFKRLKNVKEENLVKSLKAEIETTHDKHRDEEKLEKQLQAWRNNPSWIDQPPK  78

Query  497  IKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVV  676
            ++V    GS C+LN +VNVGLPP+ VYNI   P+NKR FKNI++ ISRKVL++EGP Q V
Sbjct  79   VQVKTQNGSFCHLNVEVNVGLPPETVYNIFTHPDNKRYFKNIKECISRKVLMEEGPMQTV  138

Query  677  ELEQAAMWKFLWWSGTISVHVLVDQNR  757
            E++QAA WKFLWW+GT  VH++V +NR
Sbjct  139  EVKQAAAWKFLWWAGTFPVHLIVQENR  165



>emb|CDY41434.1| BnaA08g20360D [Brassica napus]
Length=382

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 100/148 (68%), Gaps = 5/148 (3%)
 Frame = +2

Query  329  IEKALKSNFKRMRRDGDVLMSSFVGKKGAFGIL-----XVDLEKQMQPWKENPTWTDHPP  493
            I++ LK+ FKR+R   +  +   + K  A            LE+Q+Q W+ NP+W D PP
Sbjct  84   IQEPLKAEFKRLRNIKEQSLVKSLNKIEAETTYDKHRDEEKLERQLQSWRNNPSWIDQPP  143

Query  494  EIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQV  673
            +++V    GS C+LN   NVGLPP++VYNI   P+NKR FKNI++ ISRKVL++EGP Q 
Sbjct  144  KVQVKTQNGSFCHLNVYFNVGLPPESVYNIFTHPDNKRYFKNIKECISRKVLMEEGPMQT  203

Query  674  VELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VE++QAA WKFLWW+GT  VH++V +NR
Sbjct  204  VEVKQAAAWKFLWWAGTFPVHLIVQENR  231



>gb|KDO82400.1| hypothetical protein CISIN_1g040266mg, partial [Citrus sinensis]
Length=238

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  503  VTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQVVEL  682
            V+VPKGSLCNLN KVNVGLPPDAVYNIV DP+N+RVFKNI++V+SR+VL+DEG RQVVE+
Sbjct  1    VSVPKGSLCNLNVKVNVGLPPDAVYNIVTDPDNRRVFKNIKEVLSRRVLIDEGHRQVVEV  60

Query  683  EQAAMWKFLWWSGTISVHVLVDQNR  757
            EQAA+WKFLWWSG + VHVLVDQ+R
Sbjct  61   EQAALWKFLWWSGVMLVHVLVDQDR  85



>gb|KFK44441.1| hypothetical protein AALP_AA1G256900 [Arabis alpina]
Length=334

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  437  LEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK  616
            LE+Q+Q W++NP+W D PP+++V    GS C+LN +V+VGLPP++VYNI   P+NKR FK
Sbjct  80   LEEQLQAWRDNPSWIDQPPKVQVKTQNGSFCHLNIEVDVGLPPESVYNIFTHPDNKRYFK  139

Query  617  NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            NI++ ISRKVL++EGP+Q VE++QAA WKFLWW+GT  +H++V +NR
Sbjct  140  NIKENISRKVLMEEGPKQTVEVKQAAAWKFLWWAGTFPIHLIVQENR  186



>ref|XP_006305312.1| hypothetical protein CARUB_v10009689mg [Capsella rubella]
 gb|EOA38210.1| hypothetical protein CARUB_v10009689mg [Capsella rubella]
Length=333

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = +2

Query  293  VMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD---LEKQMQPWK  463
            V   FL      I++ LK+ FKR+R   ++ +   V +         D   LEKQ+Q W+
Sbjct  26   VFSGFLVWINQTIQEPLKAEFKRLRSVKELSLIKSVSEIETNYEKHRDEEKLEKQLQAWR  85

Query  464  ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRK  643
            +NP+W D PP++ V    G  C+LN +V+VGLPP++VYNI   P+NKR FKNI++ ISR 
Sbjct  86   DNPSWIDQPPKVVVKSQNGLFCHLNVEVDVGLPPESVYNIFTHPDNKRYFKNIKENISRT  145

Query  644  VLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VL+DEG +Q+VE++QAA WKFLWW GT  +H++V +NR
Sbjct  146  VLIDEGLKQIVEVKQAAAWKFLWWDGTFPIHLIVKENR  183



>ref|XP_010477648.1| PREDICTED: uncharacterized protein LOC104756719 [Camelina sativa]
 ref|XP_010477649.1| PREDICTED: uncharacterized protein LOC104756719 [Camelina sativa]
Length=337

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 103/154 (67%), Gaps = 3/154 (2%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD---LEKQMQPWKENPT  475
            FL      I++ LK+ FKR+R   ++ +   V +         D   LEKQ+Q W++NP+
Sbjct  30   FLVWMNQTIQEPLKAEFKRLRNVKELSLIKSVSEIETTYEKHRDEEKLEKQLQAWRDNPS  89

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLD  655
            W D PP++ V    G  C+LN +V+VGLPP++VYNI   P+NKR FKNI++ ISR VL+D
Sbjct  90   WIDQPPKVVVKSQNGLFCHLNIEVDVGLPPESVYNIFTHPDNKRYFKNIKENISRTVLID  149

Query  656  EGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            EG +Q VE++QAA WKFLWW GT  +H++V+++R
Sbjct  150  EGLKQTVEVKQAAAWKFLWWDGTFPIHLIVEEDR  183



>gb|AAF79591.1|AC007945_11 F28C11.19 [Arabidopsis thaliana]
Length=3134

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +2

Query  281   LSSSVMHP-FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD--LEKQM  451
               ++V+ P FL      I++ LK+ FKR+R   ++ + S    + A+     +  LEKQ+
Sbjct  2823  FENNVVFPGFLVWMNQTIQEPLKAEFKRLRNVKELSLKSVSKIETAYEEHRDEEKLEKQL  2882

Query  452   QPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKV  631
             Q W++NP+W D PP++ V    G  C+LN + +VGLPP+ VYNI   P+NKR FKNI++ 
Sbjct  2883  QAWRDNPSWIDQPPKVVVKSQNGLFCHLNIEADVGLPPELVYNIFTHPDNKRYFKNIKEN  2942

Query  632   ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             ISRKVL+DEGP+Q VE++QAA WKFLWW GT  +H++V++NR
Sbjct  2943  ISRKVLIDEGPKQTVEVKQAAAWKFLWWDGTCPIHLIVEENR  2984


 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  434   DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
             +++KQ + W    K++P W D PP++KVT  KG LC++N ++ +G  P+ V+ +  +P +
Sbjct  1304  EMKKQYELWSASEKKHP-WYDAPPKVKVTTKKG-LCHMNIELTLGWNPNGVFELFTNPND  1361

Query  602   KRVFKNIQK-----------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
               +F ++ K             SRKVL  +G RQ+V++EQA  W FLWWSG I + ++VD
Sbjct  1362  GPLFFDMNKHGQCDIFLMKEYKSRKVLKKDGRRQIVKVEQALAWDFLWWSGAIPIELIVD  1421

Query  749   QNR  757
             +N+
Sbjct  1422  ENQ  1424


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = +2

Query  443   KQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
             KQ+  W    K++P W D PP++KVT+ KG LC++N ++ +G+PPD  Y +  +P N   
Sbjct  1673  KQLNLWSDAEKKHP-WYDPPPKVKVTMKKG-LCHMNIELTLGVPPDGAYELFINPTNIPF  1730

Query  611   F---KNIQKVI---SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             F   K+ ++++   SRK+L  +GPRQ V++++A  W FLW+SG++ ++++V++N+
Sbjct  1731  FVIDKSGRQLLANKSRKILKKDGPRQTVKVKKAVAWDFLWFSGSLPINLIVNENK  1785


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = +2

Query  440   EKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
             E+Q + W    K++P W D PP++KVT  KG +C+++ ++ +GLPPD V+ +  +P N  
Sbjct  2212  ERQDKLWTAAEKKHP-WKDAPPKVKVTTKKG-ICHMHIELTLGLPPDGVFELFTNPHNGP  2269

Query  608   VFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + + K  SRKVL D+GPRQ+ ++++A  W F   S  I + ++VD+NR
Sbjct  2270  NTEPLLKSKSRKVLKDDGPRQIAKVKKAVAWNFSGRSIAIPISLIVDENR  2319


 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +2

Query  476   WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN-----KRVFKNIQKVISR  640
             W D PP++KVT  KG LC++  ++  GLPP +V+ +  +P+N      + ++ +     R
Sbjct  1961  WYDAPPKVKVTTKKG-LCHMYIELTFGLPPRSVFELFTNPDNLPLVSDKSWRQLLVNKKR  2019

Query  641   KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
             KVL  +GPRQ+VE+++   W FLWWSG + +++   +N
Sbjct  2020  KVLKRDGPRQIVEVDKVVAWDFLWWSGGMPININAVEN  2057


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 77/147 (52%), Gaps = 41/147 (28%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +L+KQ++ W    K++P W D+PP++KVT  K  L +LN K  +GLPP+AV++I+   EN
Sbjct  104  ELKKQLKLWRASDKKSP-WYDYPPKVKVTNEK-DLYHLNMKFTIGLPPEAVFDILTTYEN  161

Query  602  KRVFKNIQKV----------------------------------ISRKVLLDEGPRQV-V  676
               F  ++K                                   +S KV  D GP +  V
Sbjct  162  PSYFTMMKKRQTLVFISYFLLLYCLICELIIAVLANVIFLMKEHVSSKVFSDLGPTEKHV  221

Query  677  ELEQAAMWKFLWWSGTISVHVLVDQNR  757
             +E+AA W+FLWWSG+I VH+  +++R
Sbjct  222  RVEKAAPWRFLWWSGSIPVHLTFNESR  248


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 7/100 (7%)
 Frame = +2

Query  476   WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR-----  640
             W D P ++KVT  K  LC+LN +  +GLPP+AVY +  +P N   FK  +    R     
Sbjct  996   WYDAPAKVKVTT-KKCLCHLNIEFKLGLPPEAVYEMFTNPNNFPFFKEDKAGRQRLENKS  1054

Query  641   -KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              KVL  +GPRQ  E+E+A  W FL  S  I +H+++ +N 
Sbjct  1055  TKVLKKDGPRQTTEVEKALSWNFLGCSVDIPIHLIIHENH  1094


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 27/125 (22%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK----NIQK  628
            +E   W D P ++KVT   G LC++N +  +GLPP+ VY +  +P N  VFK      Q+
Sbjct  431  EEKHPWYDAPAKVKVTTKNG-LCHMNIEFKLGLPPEGVYEMFTNPNNYPVFKKDKAGRQR  489

Query  629  VI----------------------SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVL  742
            ++                      SRKVL   GPRQ  E+E+   W FL+ S  I +H++
Sbjct  490  LVFFSFFSLKMIGSVGFSPMKENKSRKVLKKNGPRQTTEMEKDLYWNFLFISRAIPIHLV  549

Query  743  VDQNR  757
            +D+N 
Sbjct  550  IDENH  554


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +2

Query  431   VDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK--  604
             +D EK M PW       D PP++KVT   G LC++N ++ +G  PD V+    +P N   
Sbjct  2565  IDAEK-MHPW------NDAPPKVKVTTKNG-LCHMNIELTLGFSPDKVFGFFTNPSNGPF  2616

Query  605   ----RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
                  +F       S  VL+      + ++++   WKFL  S  + + ++VD+NR
Sbjct  2617  FLSPPLFSYHSLYYSDVVLIVARLESIAKVKKTVDWKFLGSSFAVPISLIVDENR  2671


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  620  IQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ++   SRKVL  +GPRQ+V L++A  W FLWWSG   ++++VD N+
Sbjct  794  VKATKSRKVLKKDGPRQIVRLKKAVAWDFLWWSGEFPINLIVDVNK  839



>ref|XP_002893289.1| hypothetical protein ARALYDRAFT_472619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69548.1| hypothetical protein ARALYDRAFT_472619 [Arabidopsis lyrata subsp. 
lyrata]
Length=333

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = +2

Query  293  VMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD---LEKQMQPWK  463
            V+  FL      I++ +K+  KR+R   ++ +   V K         D   LEKQ+Q W+
Sbjct  26   VLPGFLVWMNQTIQEPIKAELKRLRNVKELGLVKSVSKIETIYDEHRDEEKLEKQLQAWR  85

Query  464  ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRK  643
            +NP+W D PP++ V    G  C+LN + +VGLPP+ VYNI   P+NKR FKNI++ ISRK
Sbjct  86   DNPSWIDQPPKVVVKSQNGLFCHLNVEADVGLPPELVYNIFTHPDNKRYFKNIKENISRK  145

Query  644  VLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VL+ EG +Q VE++QAA WKFLWW+GT  +H++V++NR
Sbjct  146  VLISEGLKQTVEVKQAAAWKFLWWAGTCPIHLIVEENR  183



>ref|XP_010460141.1| PREDICTED: uncharacterized protein LOC104741066 [Camelina sativa]
 ref|XP_010460142.1| PREDICTED: uncharacterized protein LOC104741066 [Camelina sativa]
Length=335

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 103/154 (67%), Gaps = 3/154 (2%)
 Frame = +2

Query  305  FLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD---LEKQMQPWKENPT  475
            FL      I++ LK+ FKR+R   ++ +   V +         D   LEKQ+Q W++NP+
Sbjct  30   FLVWMNQTIQEPLKAEFKRLRNVKELSLIKSVSEIETTYEKHRDEEKLEKQLQAWRDNPS  89

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLD  655
            W D PP++ V    G  C+LN +V+VGLPP++VYNI   P+NK+ FKNI++ ISR VL+D
Sbjct  90   WIDQPPKVVVKSQNGLFCHLNIEVDVGLPPESVYNIFTHPDNKKYFKNIKENISRTVLID  149

Query  656  EGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            EG +Q VE++QAA WKFLWW GT  +H++V+++R
Sbjct  150  EGLKQTVEVKQAAAWKFLWWDGTYPIHLIVEEDR  183



>ref|XP_001766483.1| predicted protein [Physcomitrella patens]
 gb|EDQ68811.1| predicted protein [Physcomitrella patens]
Length=279

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  431  VDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
            + LEK+M+ W+ N  W D  P I+V VP+ + C + ++  +G+PPDAV+NI+ DP NKRV
Sbjct  27   LSLEKEMEAWRRNSRWVDETPVIEVKVPREAFCEVYSQFKIGIPPDAVWNILTDPGNKRV  86

Query  611  FKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            FKNIQ V SRKVL D+G RQ+VE++QAA+WKFLW+SGT+SV VLVDQ+R
Sbjct  87   FKNIQAVTSRKVLKDDGLRQLVEVDQAAIWKFLWFSGTLSVCVLVDQDR  135



>emb|CDY69075.1| BnaCnng61760D, partial [Brassica napus]
Length=369

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 100/148 (68%), Gaps = 4/148 (3%)
 Frame = +2

Query  326  KIEKALKSNFKRMR--RDGDVLMSSFVGKKGAFGILXVDLEK--QMQPWKENPTWTDHPP  493
            KI++ LK+ FK++R  ++   ++   +  +        + +   Q+Q W++NP+W D PP
Sbjct  61   KIQEPLKAEFKKLRSVKEQQSMIKPVLEIQTTHDEEREEEKLEKQLQAWRDNPSWIDQPP  120

Query  494  EIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQV  673
             ++V    G  C+LNA+ NVGLPP +VY I   P+NKR FKNI++ ISRKVL+++GP Q 
Sbjct  121  NVQVKSQNGLFCHLNAEFNVGLPPKSVYKIFTHPDNKRYFKNIKECISRKVLMEDGPMQT  180

Query  674  VELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VE++QAA WKFLWW+GT  +H++V +NR
Sbjct  181  VEVKQAAAWKFLWWAGTFPIHLIVQENR  208



>ref|XP_001771562.1| predicted protein [Physcomitrella patens]
 gb|EDQ63592.1| predicted protein [Physcomitrella patens]
Length=330

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  437  LEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK  616
            LE+Q+  W+ N +W D  P ++VTVPKG+LC  ++   +G+PPDAVYNI+ DP NKRVFK
Sbjct  80   LERQLAAWRRNSSWVDEIPVLEVTVPKGALCKFDSHFELGIPPDAVYNILTDPGNKRVFK  139

Query  617  NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            NI++V  RKVL D+G  Q+VELEQ A W+FLW SGT+S  VLVDQ+R
Sbjct  140  NIEEVKYRKVLQDDGDHQLVELEQLASWRFLWLSGTLSACVLVDQDR  186



>ref|XP_001766244.1| predicted protein [Physcomitrella patens]
 gb|EDQ68876.1| predicted protein [Physcomitrella patens]
Length=266

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  437  LEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK  616
            LEK+M  W+ N  W    P I+V VPK + C L ++  +GLPP AV+NI+ DP NKRVFK
Sbjct  15   LEKEMAAWRRNSQWKVDSPAIEVKVPKEAFCELRSQFKIGLPPHAVWNILIDPGNKRVFK  74

Query  617  NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            NI++V SRKVL D+G RQ+VE++QAA+W+FLW+SGT+SV VLVDQ+R
Sbjct  75   NIKEVTSRKVLEDDGHRQLVEVDQAAIWRFLWFSGTLSVCVLVDQDR  121



>emb|CDY25798.1| BnaA07g09840D [Brassica napus]
Length=365

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = +2

Query  326  KIEKALKSNFKRMR--RDGDVLMSSFVGKKGAFGILXVDLEK--QMQPWKENPTWTDHPP  493
            KI++ LK+ FK++R  ++   ++   +  +        + +   Q+Q W++NP+W D PP
Sbjct  71   KIQEPLKAEFKKLRTVKEQQSMIKPVLEIETTHDEEREEEKLEKQLQAWRDNPSWIDQPP  130

Query  494  EIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQV  673
             ++V    G  C+LNA+ NVGLPP +VY I   P+NKR FKNI++ ISRKVL+++GP Q 
Sbjct  131  NVQVKSQNGLFCHLNAEFNVGLPPKSVYKIFTHPDNKRYFKNIKECISRKVLMEDGPMQT  190

Query  674  VELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VE++QAA W FLWW+GT  +H++V +NR
Sbjct  191  VEVKQAAAWNFLWWAGTFPIHLIVQENR  218



>ref|XP_002964647.1| hypothetical protein SELMODRAFT_82450, partial [Selaginella moellendorffii]
 gb|EFJ34980.1| hypothetical protein SELMODRAFT_82450, partial [Selaginella moellendorffii]
Length=239

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  446  QMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ  625
            Q++ W+ NP+W D PP   VTVPKG+LC+L +   VGLPP+AV+ I+ DP NKRVFKNI+
Sbjct  1    QLKLWRSNPSWVDEPPITAVTVPKGTLCHLKSTFKVGLPPEAVFGIITDPGNKRVFKNIK  60

Query  626  KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +V  RKV+  E  RQ+VE+EQAA+WKFLW+SGTI V VLVD+++
Sbjct  61   EVKYRKVIKAENNRQLVEVEQAAIWKFLWFSGTIDVRVLVDEDQ  104



>ref|XP_009103781.1| PREDICTED: uncharacterized protein LOC103829839 [Brassica rapa]
Length=625

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  446  QMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ  625
            Q+Q W++NP+W D PP ++V    G  C+LNA+ NVGLPP +VY I   P+NKR FKNI+
Sbjct  70   QLQAWRDNPSWIDQPPNVQVKSQNGLFCHLNAEFNVGLPPKSVYKIFTHPDNKRYFKNIK  129

Query  626  KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            + ISRKVL+++GP Q VE++QAA WKFLWW+GT  +H++V +NR
Sbjct  130  ECISRKVLMEDGPMQTVEVKQAAAWKFLWWAGTFPIHLIVQENR  173


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  431  VDLEKQMQPWKENPT---WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
             +L +Q++ W+   +   W D P ++K+   KG LC+LN    +G PP AVY +  +P N
Sbjct  404  AELWRQVRLWRSENSKHPWYDAPAKVKMKTKKG-LCHLNIDFTLGWPPQAVYEMFTNPRN  462

Query  602  KRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
               F ++   I+  VL  +GPRQ+ E+E+   WK L ++G I +HV++D+N
Sbjct  463  LNFFHSMD-TIATMVLKKDGPRQITEVEKVLRWKILGYNGAIPIHVIIDEN  512



>ref|XP_006602384.1| PREDICTED: uncharacterized protein LOC100781672 isoform X2 [Glycine 
max]
Length=282

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +2

Query  296  MHPFLSDFQSKIEKALKSNFKRM-RRDGDVLMSSFVGKKGAFGILXVDLEKQMQPWKENP  472
            + P +S F  +++  +KS   R+ ++DG  LM S   K G+F     +L +Q+Q W+ENP
Sbjct  23   LDPAISKFFVQLQIVVKSQLSRLAKQDGMSLMRSVQRKGGSFSYSEAELNEQLQAWRENP  82

Query  473  TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ  625
            +W D PP IKVTVPKGSLCNL+ +V+VGLPPDAVYNIV DP+N+RVFKNI+
Sbjct  83   SWVDKPPLIKVTVPKGSLCNLDVEVDVGLPPDAVYNIVIDPDNRRVFKNIK  133



>ref|XP_006585947.1| PREDICTED: uncharacterized protein LOC100808684 isoform X2 [Glycine 
max]
Length=286

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = +2

Query  296  MHPFLSDFQSKIEKALKSNFKRM-RRDGDVLMSSFVGKKG--AFGILXVDLEKQMQPWKE  466
            + P +S F  +++  +KS   R+ ++DG  LMSS V +KG  +F     +L +Q+Q W+E
Sbjct  26   LDPAISKFFVQLQSVVKSRLSRLAKQDGMSLMSS-VQRKGDKSFSYSEAELNEQLQAWRE  84

Query  467  NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ  625
            NP+W D PP IKVT PKGSLCNL+ +V+VGLPPDAVYNIV DP+N+RVFKNI+
Sbjct  85   NPSWVDKPPLIKVTAPKGSLCNLDVEVDVGLPPDAVYNIVIDPDNRRVFKNIK  137



>ref|XP_001752924.1| predicted protein [Physcomitrella patens]
 gb|EDQ82428.1| predicted protein [Physcomitrella patens]
Length=222

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +2

Query  464  ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRK  643
            E+  +   PP +K+T PKGS C ++A+ +V LPPD V+NI+ DP N+RVFKNI++V+ RK
Sbjct  30   ESAEFVHEPPMLKITQPKGSFCQIDARFSVALPPDGVFNIITDPNNRRVFKNIKEVVYRK  89

Query  644  VLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VL D+G RQ+VE+EQ   W+FL  SGT S  V+V+QNR
Sbjct  90   VLEDDGNRQLVEVEQLGRWRFLMLSGTFSSRVIVEQNR  127



>gb|KJB61050.1| hypothetical protein B456_009G337600 [Gossypium raimondii]
Length=298

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 93/164 (57%), Gaps = 48/164 (29%)
 Frame = +2

Query  287  SSVMHP----FLSDFQSKIEKALKSNFKRMRRDGDVL--MSSFVGKK-GAFGILXVDLEK  445
            S V+ P    FL     K++  LKS  KR+ +DGD +  ++SF+ KK G+   L ++LEK
Sbjct  16   SKVLDPAFSAFLVQLPCKLQNCLKSQLKRLAKDGDRIKPLNSFLEKKNGSSSGLGINLEK  75

Query  446  QMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ  625
            Q+Q W+ENP+W + PPEI                                         +
Sbjct  76   QLQAWRENPSWVNPPPEI-----------------------------------------E  94

Query  626  KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +VISRKVL+DEG RQVVE+EQAA W+FLWWSGTISVHVLVDQNR
Sbjct  95   EVISRKVLIDEGQRQVVEVEQAAWWRFLWWSGTISVHVLVDQNR  138



>gb|EMS64572.1| hypothetical protein TRIUR3_17734 [Triticum urartu]
Length=302

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  431  VDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
            V L++Q+Q W++NP+WTD PPEIKVTVP+GSLCNLN +   GLPPDAVYNI+ DPENKRV
Sbjct  81   VSLDRQLQAWRDNPSWTDQPPEIKVTVPQGSLCNLNLRFQAGLPPDAVYNIIIDPENKRV  140

Query  611  FKNIQ  625
            FKNI+
Sbjct  141  FKNIK  145



>gb|KJB15572.1| hypothetical protein B456_002G185100 [Gossypium raimondii]
Length=285

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 84/165 (51%), Gaps = 50/165 (30%)
 Frame = +2

Query  272  RARLSSSVMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMS--SFVGK-KGAFGILXVDLE  442
            + +L       F     +K++  LKS FK + +D D   S  SF+ K KG+F  L +DLE
Sbjct  13   KPKLLDQAFSVFFVQLPNKLQNHLKSQFKGLAKDNDGFESANSFLEKEKGSFAGLRIDLE  72

Query  443  KQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNI  622
            KQ+Q W+ENP+W + PPEIK                                        
Sbjct  73   KQLQAWRENPSWVNQPPEIK----------------------------------------  92

Query  623  QKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
                   VL+DEG RQVVE+EQAA+W+FLWWSGTISV VLVDQNR
Sbjct  93   -------VLVDEGQRQVVEVEQAALWRFLWWSGTISVRVLVDQNR  130



>ref|XP_001781678.1| predicted protein [Physcomitrella patens]
 gb|EDQ53491.1| predicted protein, partial [Physcomitrella patens]
Length=192

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  491  PEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLDEGPRQ  670
            P ++VT PKGS C ++ +    L PD VY+I+ DP N RVFKNI++VI RKVL D+G RQ
Sbjct  1    PLLQVTQPKGSFCTIDCRFATTLEPDGVYDILTDPNNHRVFKNIKEVIYRKVLEDDGNRQ  60

Query  671  VVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            VVE+EQ   WKFL+ SGT    V+++Q R
Sbjct  61   VVEVEQLGRWKFLFLSGTFPTRVMIEQKR  89



>ref|XP_010925764.1| PREDICTED: uncharacterized protein LOC105048213 isoform X2 [Elaeis 
guineensis]
Length=292

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 89/174 (51%), Gaps = 47/174 (27%)
 Frame = +2

Query  254  VDESSERARLSSSVMHP---FLSDFQSKIEKALKSNFKRM---RRDGDVLMSSFVGKKGA  415
            +D  + + +   S ++P   F      K++  LK++ K +    +  D+     + +K  
Sbjct  10   LDNHAGKRKGRQSTLNPAFDFFVQMPQKLQNFLKTHLKHISMNEQKFDIAKPLMLTEKEP  69

Query  416  FGILXVDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADP  595
               L V+L+KQ++ W+ENP W D PPEIK                               
Sbjct  70   CTALEVNLDKQLEAWRENPKWVDPPPEIK-------------------------------  98

Query  596  ENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
                      +VISRKVL+DEG RQV+E+EQAA+W+FLWWSGTISVHVLVDQNR
Sbjct  99   ----------EVISRKVLIDEGLRQVIEVEQAAIWRFLWWSGTISVHVLVDQNR  142



>ref|XP_006303494.1| hypothetical protein CARUB_v10010830mg, partial [Capsella rubella]
 gb|EOA36392.1| hypothetical protein CARUB_v10010830mg, partial [Capsella rubella]
Length=251

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 78/119 (66%), Gaps = 13/119 (11%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            D++KQ++ W    K +P W D PP++KVT  KG LC++N ++ +G  PD V+ +  +P +
Sbjct  30   DMKKQLELWSAGEKTHP-WYDAPPKVKVTTKKG-LCHMNIEMTLGWIPDGVFELFTNPND  87

Query  602  KRVFKNIQK-------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              +F ++ K         SRKVL  +GPRQ+V+++QA  W FLWWSG+I + ++VD+N+
Sbjct  88   GPLFFDMNKHGRQLLEYKSRKVLKKDGPRQIVKVKQALAWDFLWWSGSIPIELIVDENK  146



>ref|XP_010477660.1| PREDICTED: uncharacterized protein LOC104756729 [Camelina sativa]
Length=270

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 78/119 (66%), Gaps = 13/119 (11%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            D++KQ + W    K++P W D PP++KVT  KG LC++N ++ +G  PD V+ +  +P +
Sbjct  49   DMKKQYELWSVGEKKHP-WYDAPPKVKVTTKKG-LCHMNIEMTLGWIPDGVFELFTNPND  106

Query  602  KRVFKNIQK-------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              +F ++ K         SRKVL  +GPRQ+V+++QA  W FLWWSG+I + ++VD+N+
Sbjct  107  GPLFFDMNKHGRQLLEYKSRKVLKKDGPRQIVKVQQALAWDFLWWSGSIPIELIVDENQ  165



>ref|XP_010498904.1| PREDICTED: uncharacterized protein LOC104776515 [Camelina sativa]
 ref|XP_010498905.1| PREDICTED: uncharacterized protein LOC104776515 [Camelina sativa]
 ref|XP_010498907.1| PREDICTED: uncharacterized protein LOC104776515 [Camelina sativa]
Length=159

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 3/118 (3%)
 Frame = +2

Query  293  VMHPFLSDFQSKIEKALKSNFKRMRRDGDVLMSSFVGKKGAFGILXVD---LEKQMQPWK  463
            V   FL      I++ LK+ FKR+R   ++ +   V +         D   LEKQ+Q W+
Sbjct  26   VFSGFLVWMNQTIQEPLKAEFKRLRNVKELSLIKSVSEIETTYEKHRDEEKLEKQLQAWR  85

Query  464  ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVIS  637
            +NP+W D PP++ V    G  C+LN +V+VGLPP++VYNI   P+NK+ FKNI++ IS
Sbjct  86   DNPSWIDQPPKVVVKSQNGLFCHLNIEVDVGLPPESVYNIFTHPDNKKYFKNIKENIS  143



>ref|XP_006306513.1| hypothetical protein CARUB_v10012512mg, partial [Capsella rubella]
 gb|EOA39411.1| hypothetical protein CARUB_v10012512mg, partial [Capsella rubella]
Length=249

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 9/117 (8%)
 Frame = +2

Query  434  DLEKQMQPWKENP---TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            +L+KQ++ W+ +     W D+PP++KVT  K  LC+LN +  +GLPP+AV+++    +N 
Sbjct  25   ELKKQLKLWRASEKRGAWHDYPPKVKVTKEKDGLCHLNIQFTIGLPPEAVFDMFTTYKNP  84

Query  605  RVF-----KNIQKVISRKVLLDEGPRQV-VELEQAAMWKFLWWSGTISVHVLVDQNR  757
              +     + I +  S KV  D GP +  V++E+AA W+FLWWSG+I VH+  +++R
Sbjct  85   SYYSMMKKRQILEHRSSKVFSDLGPTEKHVKVEKAAPWRFLWWSGSIPVHLTFNESR  141



>ref|NP_173781.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98023.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAZ52694.1| expressed protein [Arabidopsis thaliana]
 gb|AEE30419.1| uncharacterized protein AT1G23690 [Arabidopsis thaliana]
Length=273

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 74/127 (58%), Gaps = 11/127 (9%)
 Frame = +2

Query  407  KGAFGILXVDLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVY  577
            K AF     + +KQ + W+   +   W D PP++KVT  KG LC+++ ++ VGLPP+ VY
Sbjct  42   KRAFYYDKAEAKKQGKLWRAAEKKKPWYDAPPKVKVTTKKG-LCHMHIELTVGLPPEGVY  100

Query  578  NIVADPENKRVFK-------NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVH  736
            ++ A+P +   F+        + +  SRKVL+ +GPRQ   LE+A  W  LWW G     
Sbjct  101  DLFANPNDFPFFRIDNETGRELLENKSRKVLMKDGPRQSARLEKALTWDVLWWCGAFPFT  160

Query  737  VLVDQNR  757
            ++VD+N+
Sbjct  161  LIVDENQ  167



>ref|XP_002893302.1| hypothetical protein ARALYDRAFT_313228 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69561.1| hypothetical protein ARALYDRAFT_313228 [Arabidopsis lyrata subsp. 
lyrata]
Length=273

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 11/127 (9%)
 Frame = +2

Query  407  KGAFGILXVDLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVY  577
            K  F     + +KQ + W+   +   W D P ++KVT  KG LC+++ ++ VGLPP+ VY
Sbjct  42   KQEFYYDKAEAKKQGKLWRAAEKKKPWYDAPAKVKVTTKKG-LCHMHIELTVGLPPEGVY  100

Query  578  NIVADPENKRVFK-------NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVH  736
            ++ A+P +   F+        + +  SRKVL+ +GPRQ+  LE+A  W FLWW G     
Sbjct  101  DLFANPNDFPFFRIDNETGRELLENKSRKVLMKDGPRQIARLEKAVTWDFLWWCGAFPFT  160

Query  737  VLVDQNR  757
            ++VD+N+
Sbjct  161  LIVDENQ  167



>ref|XP_002893292.1| hypothetical protein ARALYDRAFT_889900 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69551.1| hypothetical protein ARALYDRAFT_889900 [Arabidopsis lyrata subsp. 
lyrata]
Length=224

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF--KNIQKVI---SR  640
            W D PP++KVT  KG LC++  K+  GLPP +VY +  +P N  +F  K+ ++++    R
Sbjct  26   WFDAPPKVKVTTKKG-LCHMYVKMTFGLPPRSVYELFTNPNNLPLFSDKSWRQLLVNKRR  84

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            KVL  +GPRQ+VE+E+   W FLWWSG + ++++ D+N
Sbjct  85   KVLKRDGPRQIVEVEKVVAWDFLWWSGGMPINLIADEN  122



>ref|XP_006416069.1| hypothetical protein EUTSA_v10009760mg [Eutrema salsugineum]
 gb|ESQ34422.1| hypothetical protein EUTSA_v10009760mg [Eutrema salsugineum]
Length=420

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR  640
            +E   W D P ++KV    G LC++N +  +GLPP+AVY +  +P N   F+  +     
Sbjct  213  EEKHPWYDAPAKVKVKTKNG-LCHMNMQFTIGLPPEAVYEMFTNPNNLPFFREDEAGRQL  271

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
             V   +GPRQ  E+E+A  W FLWWSG I +H+++D+N
Sbjct  272  LVFKKDGPRQTTEVEKALTWNFLWWSGAIPIHLIIDEN  309


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  635  SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            SRKVL  +GPR++ E ++A    FLWWSG+I + ++VD+N+
Sbjct  79   SRKVLKKDGPREIAETKKAVAMNFLWWSGSIPITLIVDENK  119



>ref|NP_973899.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98022.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AEE30416.1| uncharacterized protein AT1G23670 [Arabidopsis thaliana]
Length=264

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 77/118 (65%), Gaps = 12/118 (10%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +L+KQ++ W    K++P W D+PP++KVT  K  L +LN K  +GLPP+AV++I+   EN
Sbjct  41   ELKKQLKLWRASDKKSP-WYDYPPKVKVTNEK-DLYHLNMKFTIGLPPEAVFDILTTYEN  98

Query  602  KRVFKNIQKV-----ISRKVLLDEGPRQV-VELEQAAMWKFLWWSGTISVHVLVDQNR  757
               F  ++K      +S KV  D GP +  V +E+AA W+FLWWSG+I VH+  +++R
Sbjct  99   PSYFTMMKKRQTLEHVSSKVFSDLGPTEKHVRVEKAAPWRFLWWSGSIPVHLTFNESR  156



>ref|NP_001175778.1| Os09g0327550 [Oryza sativa Japonica Group]
 dbj|BAH94506.1| Os09g0327550, partial [Oryza sativa Japonica Group]
Length=59

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  617  NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            N Q+VISRKV+LDEG RQ+VE+EQAA+W+FLWWSG +SVHV VDQNR
Sbjct  6    NFQEVISRKVVLDEGQRQIVEVEQAAIWRFLWWSGVLSVHVFVDQNR  52



>gb|AAC98018.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=276

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +++KQ + W    K++P W D PP++KVT  KG LC++N ++ +G  P+ V+ +  +P +
Sbjct  74   EMKKQYELWSASEKKHP-WYDAPPKVKVTTKKG-LCHMNIELTLGWNPNGVFELFTNPND  131

Query  602  KRVFKNIQK-----------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
              +F ++ K             SRKVL  +G RQ+V++EQA  W FLWWSG I + ++VD
Sbjct  132  GPLFFDMNKHGRQLLDFMKEYKSRKVLKKDGRRQIVKVEQALAWDFLWWSGAIPIELIVD  191

Query  749  QNR  757
            +N+
Sbjct  192  ENQ  194



>gb|AAM65908.1| putative OBP32pep protein [Arabidopsis thaliana]
Length=217

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 67/98 (68%), Gaps = 6/98 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF--KNIQKVI---SR  640
            W D PP++KVT  KG LC++  ++  GLPP +V+ +  +P+N  +F  K+ ++++    R
Sbjct  48   WYDAPPKVKVTTKKG-LCHMYIELTFGLPPRSVFELFTNPDNLPLFSDKSWRQLLVNKKR  106

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            KVL  +GPRQ+VE+E+   W FLWWSG + ++++ D+N
Sbjct  107  KVLKRDGPRQIVEVEKVVAWDFLWWSGGMPINLIADEN  144



>ref|XP_010477663.1| PREDICTED: uncharacterized protein LOC104756732 isoform X1 [Camelina 
sativa]
 ref|XP_010477664.1| PREDICTED: uncharacterized protein LOC104756732 isoform X1 [Camelina 
sativa]
Length=273

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 89/167 (53%), Gaps = 12/167 (7%)
 Frame = +2

Query  290  SVMHPFLSDFQSKIEKALKSNFKRMRR-DGDVLMSSFVGKKGAFGILXVDLEKQMQPWKE  466
            SV   F+      I++ LK+  K+    + + +       K  F     + +KQ + W++
Sbjct  2    SVFPRFVGWINQNIQEPLKAESKKSENVESNSVSEEDSSNKREFYYDKAEAKKQGKLWRD  61

Query  467  ---NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK-------  616
                  W D P ++KVT  KG LC+++ ++ VGLPP+ VY++ A+P N   F+       
Sbjct  62   AQKKKPWYDAPGKVKVTTKKG-LCHMHIELTVGLPPEGVYDLFANPNNFPFFRIDNETGR  120

Query  617  NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             + +  SRKVL+ +GPRQVV+LE+A  + FLWW       ++ D+N+
Sbjct  121  ELLQNKSRKVLMKDGPRQVVQLEKALTYDFLWWYRAFPFTLIADENQ  167



>ref|XP_010477662.1| PREDICTED: uncharacterized protein LOC104756731 [Camelina sativa]
Length=265

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 76/117 (65%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWKENP---TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            +L+KQM+ W+ +     W D+PP++KVT  +  LC++N +  +GLPP+AV++I    EN 
Sbjct  43   ELKKQMKLWRASEKKYAWHDYPPKVKVTKYE-DLCHMNIQFTIGLPPEAVFDIFTTYENP  101

Query  605  RVFKNIQKVI-----SRKVLLDEGPRQ-VVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              +  ++K       S KVL D GP + +V++E+ A W+FLWWSG I VH+ ++++R
Sbjct  102  SWYSMMKKRPILEHRSSKVLSDRGPTEKLVQVEKEAPWRFLWWSGAIPVHLNLNESR  158



>ref|XP_006304415.1| hypothetical protein CARUB_v10010990mg, partial [Capsella rubella]
 gb|EOA37313.1| hypothetical protein CARUB_v10010990mg, partial [Capsella rubella]
Length=299

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 65/100 (65%), Gaps = 7/100 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF------KNIQKVIS  637
            W D PP++KVT+ KG +C+LN ++ +G+PPD  Y +  +P +   F      + + K  S
Sbjct  93   WYDPPPKVKVTMKKG-VCHLNIELTLGVPPDGAYELFINPTDVPFFVIDNSGRQLLKNKS  151

Query  638  RKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            RKVL  +GPRQ+V++ +A  W FLWWSG +   ++V++N+
Sbjct  152  RKVLKKDGPRQIVKVVKAVAWDFLWWSGALPFSLVVEENK  191



>ref|NP_173773.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98016.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAY78617.1| unknown [Arabidopsis thaliana]
 gb|AAZ52691.1| expressed protein [Arabidopsis thaliana]
 gb|AEE30410.1| uncharacterized protein AT1G23600 [Arabidopsis thaliana]
Length=270

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = +2

Query  443  KQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
            KQ+  W    K++P W D PP++KVT+ KG LC++N ++ +G+PPD  Y +  +P N   
Sbjct  49   KQLNLWSDAEKKHP-WYDPPPKVKVTMKKG-LCHMNIELTLGVPPDGAYELFINPTNIPF  106

Query  611  F---KNIQKVI---SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            F   K+ ++++   SRK+L  +GPRQ V++++A  W FLW+SG++ ++++V++N+
Sbjct  107  FVIDKSGRQLLANKSRKILKKDGPRQTVKVKKAVAWDFLWFSGSLPINLIVNENK  161



>ref|XP_002893300.1| hypothetical protein ARALYDRAFT_472628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69559.1| hypothetical protein ARALYDRAFT_472628 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 75/117 (64%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            +L+KQ++ W+   ++  W D+PP++KVT  K  L +LN K  +GLPP+AV++I+   EN 
Sbjct  41   ELKKQLKLWRASEKDSAWYDYPPKLKVTKEK-DLYHLNMKFTIGLPPEAVFDILTSYENP  99

Query  605  RVFKNI-----QKVISRKVLLDEG-PRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              F  +     Q+ +S KV  D G   + V +E+AA W+FLWWSG+I VH+  +++R
Sbjct  100  SYFTMMKKGKPQEHVSSKVFSDLGLTEKHVRVEKAAPWRFLWWSGSIPVHLTFNESR  156



>ref|XP_010477659.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756728 
[Camelina sativa]
Length=465

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 11/117 (9%)
 Frame = +2

Query  437  LEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            +++Q + WK   +   W D PP++KVT  KG LC++N ++  GL PD V+ +   P N  
Sbjct  43   MKRQDELWKAAQKKHPWYDAPPKVKVTTKKG-LCHMNIELTFGLTPDGVFELFTSPNNGS  101

Query  608  VFKNIQ-------KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +F ++           SRKVL  +GPRQ V+L +A  W FLWWSG   + ++VD N+
Sbjct  102  LFFDMDMNGRPLLATKSRKVLKKDGPRQTVKLVKAVAWDFLWWSGYFPIKLIVDVNK  158


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 8/101 (8%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR-----  640
            W D P ++KV+  KG LC++N +  +GLPP+AVY +  +P N   F+  +    R     
Sbjct  260  WHDAPAKVKVSNKKG-LCHMNIEFKLGLPPEAVYEMFTNPNNFPFFEEDKAGRQRLENKS  318

Query  641  -KVLLDEGPRQVVELEQAAMWKFL-WWSGTISVHVLVDQNR  757
             KVL  +GPRQ  ++E+A  W FL  +SG I +H+++ +N 
Sbjct  319  TKVLRKDGPRQTTKVEKALSWNFLGLFSGDIPIHLIIHENH  359



>ref|XP_002893290.1| hypothetical protein ARALYDRAFT_889898 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69549.1| hypothetical protein ARALYDRAFT_889898 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +++KQ Q W    K++P W D PP++KVT  K  LC++N ++ +G PPD V+    DP N
Sbjct  53   EMKKQDQLWIDAEKKHP-WNDAPPKVKVTT-KNGLCHMNIELTLGFPPDKVFGFFTDPSN  110

Query  602  KRVFKNIQ-KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               F +   +  SRKVL+++GPRQ+ ++++   WKFL  S  + + V+VD+NR
Sbjct  111  GPFFLSPPLENKSRKVLMEDGPRQIAKVKKTVDWKFLGSSFAVPISVIVDENR  163



>ref|XP_010498871.1| PREDICTED: uncharacterized protein LOC104776482 isoform X3 [Camelina 
sativa]
Length=308

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++E+Q+Q W   ++  TW D PP++KVT  KG LC++  ++ +G PPD V+ I+ DP N 
Sbjct  54   EVERQVQLWVDAEKKHTWHDAPPKVKVTTKKG-LCHIKIELRLGFPPDKVFRIITDPSNG  112

Query  605  RVFKNIQKV-ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              F        S+KVL ++GPRQ+ ++ +   WKFL  S  I + V+VD+NR
Sbjct  113  PFFLYPPLTGKSKKVLREDGPRQIAKVVKTVEWKFLGSSFAIPISVIVDENR  164



>ref|XP_010498870.1| PREDICTED: uncharacterized protein LOC104776482 isoform X2 [Camelina 
sativa]
Length=295

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++E+Q+Q W   ++  TW D PP++KVT  KG LC++  ++ +G PPD V+ I+ DP N 
Sbjct  54   EVERQVQLWVDAEKKHTWHDAPPKVKVTTKKG-LCHIKIELRLGFPPDKVFRIITDPSNG  112

Query  605  RVFKNIQKV-ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              F        S+KVL ++GPRQ+ ++ +   WKFL  S  I + V+VD+NR
Sbjct  113  PFFLYPPLTGKSKKVLREDGPRQIAKVVKTVEWKFLGSSFAIPISVIVDENR  164



>gb|KFK44442.1| hypothetical protein AALP_AA1G257000 [Arabis alpina]
Length=260

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 12/116 (10%)
 Frame = +2

Query  437  LEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            L K+++ W    K++P W D P ++KV   KG +C+L     +GLPP+ VY ++ +P N 
Sbjct  39   LRKEVRLWSAAEKKHP-WYDPPAKVKVKTEKG-VCHLKINFTLGLPPEGVYEMLTNPNNL  96

Query  605  RVFKNIQ------KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
              F+  +      + IS KVL  +GPRQ+ ++E+A  W FLW SG I +H+ +D+N
Sbjct  97   PFFREDKNGHQRLENISTKVLKKDGPRQITKVEKALTWNFLWLSGAIPIHLTIDEN  152



>ref|XP_005645855.1| hypothetical protein COCSUDRAFT_43073 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21311.1| hypothetical protein COCSUDRAFT_43073 [Coccomyxa subellipsoidea 
C-169]
Length=246

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  473  TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLL  652
            +W+D   +++VT P+G L  +  +  V L PD VY+I+  P+N  VFK I+KV  RKVL 
Sbjct  3    SWSDRDAKVEVTRPEGFLMKVALQAKVDLSPDEVYDILTAPDNASVFKGIKKVPYRKVLQ  62

Query  653  DEG-PRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            D+G  +Q VE+EQ A WKFL +SG+ +  + V Q++
Sbjct  63   DDGRGKQKVEVEQLAAWKFLMFSGSFATRLYVFQDK  98



>ref|NP_173771.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC98014.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAS65951.1| At1g23580 [Arabidopsis thaliana]
 gb|AAS92320.1| At1g23580 [Arabidopsis thaliana]
 gb|AEE30407.1| uncharacterized protein AT1G23580 [Arabidopsis thaliana]
Length=285

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLD  655
            W D PP++KVT  KG +C+++ ++ +GLPPD V+ +  +P N    + + K  SRKVL D
Sbjct  69   WKDAPPKVKVTTKKG-ICHMHIELTLGLPPDGVFELFTNPHNGPNTEPLLKSKSRKVLKD  127

Query  656  EGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +GPRQ+ ++++A  W F   S  I + ++VD+NR
Sbjct  128  DGPRQIAKVKKAVAWNFSGRSIAIPISLIVDENR  161



>ref|XP_006416070.1| hypothetical protein EUTSA_v10008632mg [Eutrema salsugineum]
 gb|ESQ34423.1| hypothetical protein EUTSA_v10008632mg [Eutrema salsugineum]
Length=241

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVI-------  634
            W D P  +KV   KG +C+LN +  +G PP  VY ++ +P N   F+   K         
Sbjct  32   WYDAPATVKVKTEKG-VCHLNIEFTLGWPPQGVYEMLTNPRNVFFFRRFDKQFRQRLDNK  90

Query  635  SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            S KVL  +GPRQ+ E+E+   WK L WSG I +H+++D+N
Sbjct  91   STKVLKKDGPRQITEVEKTLRWKLLRWSGAIPIHLIIDEN  130



>ref|XP_006304618.1| hypothetical protein CARUB_v10011702mg [Capsella rubella]
 gb|EOA37516.1| hypothetical protein CARUB_v10011702mg [Capsella rubella]
Length=296

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 3/96 (3%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKV--ISRKVL  649
            W DHPP++KVT  KG LC++  ++ +G  PD V+ ++ DP +K  F     +   SRKVL
Sbjct  72   WHDHPPKVKVTTKKG-LCHMKIELTLGFQPDKVFGLITDPSSKGSFFLDPPLGGKSRKVL  130

Query  650  LDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +++GPRQ+ ++ +   WKFL  S  I + V+VD+NR
Sbjct  131  MEDGPRQIAKVGKTVEWKFLGRSFAIPISVIVDENR  166



>ref|XP_006416071.1| hypothetical protein EUTSA_v10010034mg [Eutrema salsugineum]
 gb|ESQ34424.1| hypothetical protein EUTSA_v10010034mg [Eutrema salsugineum]
Length=280

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 72/115 (63%), Gaps = 11/115 (10%)
 Frame = +2

Query  440  EKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            EKQ Q W    KE+P W D PP++KVT  KG + ++N +   G+ P  VY ++  PE+  
Sbjct  58   EKQDQLWHHAEKEHP-WYDAPPKVKVTRKKG-IYHMNIEFTAGMTPYGVYFLLTVPEHGP  115

Query  608  VFKNIQKV-----ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             F  +++       S KVL+D+GPRQ+ ++E+  +W FLWWS  I +++++D+NR
Sbjct  116  FFDEVKRRRLMENKSVKVLMDDGPRQISKVEKFVVWDFLWWSIPIPINLILDENR  170



>ref|XP_001751964.1| predicted protein [Physcomitrella patens]
 gb|EDQ83399.1| predicted protein [Physcomitrella patens]
Length=136

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (61%), Gaps = 4/104 (4%)
 Frame = +2

Query  437  LEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF-  613
            LE+Q+  W    +W D    ++VTVPK +LC  +++  +G+PPDAVYNI+ D  NKRV  
Sbjct  31   LERQLAAWGWYSSWIDEILILEVTVPKEALCKFDSRFELGIPPDAVYNILTDLSNKRVIK  90

Query  614  KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLV  745
            KNI++V  RKVL D+G   + +L    + +F    G +++  L 
Sbjct  91   KNIEEVKYRKVLQDDGHHGLWDLSNLRVARF---CGFLALECLC  131



>ref|NP_001077590.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE65650.1| unknown [Arabidopsis thaliana]
 gb|AEE30420.1| uncharacterized protein AT1G23690 [Arabidopsis thaliana]
Length=268

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 16/127 (13%)
 Frame = +2

Query  407  KGAFGILXVDLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVY  577
            K AF     + +KQ + W+   +   W D PP++K       LC+++ ++ VGLPP+ VY
Sbjct  42   KRAFYYDKAEAKKQGKLWRAAEKKKPWYDAPPKVK------GLCHMHIELTVGLPPEGVY  95

Query  578  NIVADPENKRVFK-------NIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVH  736
            ++ A+P +   F+        + +  SRKVL+ +GPRQ   LE+A  W  LWW G     
Sbjct  96   DLFANPNDFPFFRIDNETGRELLENKSRKVLMKDGPRQSARLEKALTWDVLWWCGAFPFT  155

Query  737  VLVDQNR  757
            ++VD+N+
Sbjct  156  LIVDENQ  162



>emb|CDY25792.1| BnaA07g09900D [Brassica napus]
Length=296

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 16/122 (13%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +L +Q++ W    K++P W D P ++KV   +G +C+LN    +G PP AV+ +  DP N
Sbjct  82   ELVRQVRLWMSENKKHP-WHDEPDKVKVKTKEG-ICHLNINFTLGWPPQAVFEMFTDPRN  139

Query  602  KRVFKNIQK----------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQ  751
               F ++ K           I+ KV+  +GPRQ+ E+E+   WK L ++GTI +HV++D+
Sbjct  140  MGFFHSMGKYKDHFRTRLDTIATKVIKKDGPRQITEVEKVLRWKILGYNGTIPIHVIIDE  199

Query  752  NR  757
            N 
Sbjct  200  NH  201



>ref|XP_010477655.1| PREDICTED: uncharacterized protein LOC104756725 isoform X2 [Camelina 
sativa]
Length=231

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 71/114 (62%), Gaps = 14/114 (12%)
 Frame = +2

Query  443  KQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
            KQ+  W    K++P W D PP++KVT+ +G +C++N ++ +G+PPD  Y +  +P N   
Sbjct  12   KQLNLWSNAEKKHP-WYDPPPKVKVTMKRG-ICHMNIELTLGVPPDGAYELFINPTNIPF  69

Query  611  F------KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            F      + + +  SRKVL  +G  Q+V++E+A  W F WWSG + + ++VD+N
Sbjct  70   FVIDKFRRQLLENKSRKVLKKDG--QIVKVEKAVAWDFFWWSGALPISLIVDEN  121



>ref|XP_002893298.1| hypothetical protein ARALYDRAFT_335602 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69557.1| hypothetical protein ARALYDRAFT_335602 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR-----  640
            W D P ++KVT  KG LC+LN +  +GLPP+AVY +  +P N   FK  +    R     
Sbjct  60   WYDAPAKVKVTTKKG-LCHLNIEFKLGLPPEAVYEMFTNPNNFPFFKEDKDGRQRLENKS  118

Query  641  -KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             KVL  +GPRQ  E+E+A  W FL  SG I +H+++ +N 
Sbjct  119  TKVLKKDGPRQTTEVEKALSWNFLGCSGDIPIHLIIHENH  158



>ref|XP_010477661.1| PREDICTED: uncharacterized protein LOC104756730 [Camelina sativa]
Length=264

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ------KVIS  637
            W+D P ++KVT  K  LC++N +  +GLPP+ VY +  +P N  VFK  +      +  S
Sbjct  60   WSDAPAKVKVTT-KNGLCHMNIEFKLGLPPEGVYEMFTNPNNYPVFKKDKAGRQRLENKS  118

Query  638  RKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            RKVL   GPRQ  E+E+   W FL+ S  I +H+++D+N
Sbjct  119  RKVLKKNGPRQTTEMEKDLHWNFLFLSKAIPIHLIIDEN  157



>ref|XP_010477654.1| PREDICTED: uncharacterized protein LOC104756725 isoform X1 [Camelina 
sativa]
Length=267

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 71/114 (62%), Gaps = 14/114 (12%)
 Frame = +2

Query  443  KQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
            KQ+  W    K++P W D PP++KVT+ +G +C++N ++ +G+PPD  Y +  +P N   
Sbjct  48   KQLNLWSNAEKKHP-WYDPPPKVKVTMKRG-ICHMNIELTLGVPPDGAYELFINPTNIPF  105

Query  611  F------KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            F      + + +  SRKVL  +G  Q+V++E+A  W F WWSG + + ++VD+N
Sbjct  106  FVIDKFRRQLLENKSRKVLKKDG--QIVKVEKAVAWDFFWWSGALPISLIVDEN  157



>ref|XP_006304377.1| hypothetical protein CARUB_v10010870mg, partial [Capsella rubella]
 gb|EOA37275.1| hypothetical protein CARUB_v10010870mg, partial [Capsella rubella]
Length=259

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 7/99 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR-----  640
            W D P  +KVT  KG LC+LN +  +GLPP+AVY +  +P N   FK  +    R     
Sbjct  55   WHDAPARVKVTTKKG-LCHLNIEFKLGLPPEAVYEMFTNPNNFPFFKEDKAGRQRLENKS  113

Query  641  -KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
             KVL  +GPRQ  E+E+A  W FL  SG I +H+++ +N
Sbjct  114  TKVLKKDGPRQTTEVEKALSWNFLGCSGDIPIHLIIHEN  152



>ref|XP_002893287.1| hypothetical protein ARALYDRAFT_472615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69546.1| hypothetical protein ARALYDRAFT_472615 [Arabidopsis lyrata subsp. 
lyrata]
Length=271

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 72/117 (62%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W+   +   W D P ++KV    G LC+++    +GLPP A Y+++ +P+N+
Sbjct  45   EMKEQLKLWRHAEKKEQWQDVPAKVKVETENG-LCHVDMVFTLGLPPQAAYDVLTNPDNQ  103

Query  605  ---RVFKNIQKV---ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               R+  +  ++   +SRKVL D+G  Q VE E+A  WKFL WSGTI + +   +NR
Sbjct  104  PYSRIINHRHELLDNVSRKVLTDDGSSQTVEAEKAVAWKFLSWSGTIPISLDFVENR  160



>ref|XP_010480622.1| PREDICTED: uncharacterized protein LOC104759384 [Camelina sativa]
Length=302

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (58%), Gaps = 13/118 (11%)
 Frame = +2

Query  434  DLEKQMQPW-----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPE  598
            +L++Q   W     K+NP W D P E+KV    G +C++N    +G PP  VY ++ +P 
Sbjct  74   ELKRQAGLWLGSAKKKNP-WYDDPAEVKVETKNG-ICHMNIFFILGEPPQGVYEMLTNPR  131

Query  599  NKRVFKNIQKVISR------KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            N   F   ++   R      KVL  +GPRQV ++ +A  WKFL WSGTI +H+++D+N
Sbjct  132  NITYFNFDKRWRQRLENKSTKVLKKDGPRQVTDVRKALRWKFLLWSGTIPIHLIIDEN  189



>ref|XP_009103161.1| PREDICTED: uncharacterized protein LOC103829263 [Brassica rapa]
Length=312

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 14/121 (12%)
 Frame = +2

Query  434  DLEKQMQPW-KENP--TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            +L +Q++ W  EN    W D P ++KV   +G +C+LN    +G PP AV+ +  DP N 
Sbjct  82   ELVRQVRLWMSENKKHQWHDEPAKVKVKTKEG-ICHLNINFTLGWPPQAVFEMFTDPRNM  140

Query  605  RVFKNIQK----------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
              F ++ K           I+ KV+  +GPRQ+ E+E+   WK L ++GTI +HV++D+N
Sbjct  141  GFFHSMGKYKDHFRTRLDTIATKVIKKDGPRQITEVEKVLRWKILGYNGTIPIHVIIDEN  200

Query  755  R  757
             
Sbjct  201  H  201



>ref|XP_002893294.1| hypothetical protein ARALYDRAFT_889902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69553.1| hypothetical protein ARALYDRAFT_889902 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 8/105 (8%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR  640
            K+NP W D P ++KV   K  +C++N K  +G PP  VY ++ +P N   F   ++   R
Sbjct  31   KKNP-WYDAPAKVKVET-KNGICHMNIKFTLGEPPQGVYEMLTNPRNITYFDFDKRWRQR  88

Query  641  ------KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
                  KVL  +GPRQ+ ++ +A  WKFL WSGTI +H+++D+N 
Sbjct  89   LENKSTKVLKKDGPRQITDVRKALRWKFLLWSGTIPIHLIIDENH  133



>emb|CDY54285.1| BnaC07g48260D [Brassica napus]
Length=297

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +L +Q++ W    K++P W D P ++KV    G +C+LN    +G PP AVY +  DP N
Sbjct  82   ELVRQVRRWMSENKKHP-WHDEPAKVKVKTKNG-ICHLNINFTLGWPPQAVYEMFTDPRN  139

Query  602  KRVFKNIQK----------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQ  751
               F ++ K           I+ KV+  +GPRQ+ E+ +   WK L ++GTI +HV++D+
Sbjct  140  MGFFHSMGKYKDHFRTRLDTIATKVIKKDGPRQITEVGKVLRWKILGYNGTIPIHVIIDE  199

Query  752  NR  757
            N 
Sbjct  200  NH  201



>ref|NP_173778.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30415.1| uncharacterized protein AT1G23660 [Arabidopsis thaliana]
Length=264

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ-----  625
            +E   W D P ++KVT  K  LC++N +  +GLPP+ VY +  +P N  VFK  +     
Sbjct  55   EEKHPWYDAPAKVKVTT-KNGLCHMNIEFKLGLPPEGVYEMFTNPNNYPVFKKDKAGRQR  113

Query  626  -KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
             +  SRKVL   GPRQ  E+E+   W FL+ S  I +H+++D+N
Sbjct  114  LENKSRKVLKKNGPRQTTEMEKDLYWNFLFISRAIPIHLVIDEN  157



>ref|XP_010498860.1| PREDICTED: uncharacterized protein LOC104776477 isoform X1 [Camelina 
sativa]
Length=259

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 71/117 (61%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W+   +   W D P ++KV    G LC+++    +GLPP A Y+++ +P+N+
Sbjct  42   EMKEQLKLWRHAEKKEQWEDLPAKVKVETEDG-LCHVDIVFILGLPPQAAYDVLTNPDNQ  100

Query  605  RVFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + I +       +SRKV+ D+G RQ VE E+A  WKFL WSGTI + +   +NR
Sbjct  101  AYSRIINQRHELLENVSRKVVTDDGARQTVESEKAVAWKFLSWSGTIPITLDFVENR  157



>ref|XP_010498861.1| PREDICTED: uncharacterized protein LOC104776477 isoform X2 [Camelina 
sativa]
 ref|XP_010498862.1| PREDICTED: uncharacterized protein LOC104776477 isoform X2 [Camelina 
sativa]
Length=217

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 70/116 (60%), Gaps = 10/116 (9%)
 Frame = +2

Query  437  LEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            +++Q++ W+   +   W D P ++KV    G LC+++    +GLPP A Y+++ +P+N+ 
Sbjct  1    MKEQLKLWRHAEKKEQWEDLPAKVKVETEDG-LCHVDIVFILGLPPQAAYDVLTNPDNQA  59

Query  608  VFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              + I +       +SRKV+ D+G RQ VE E+A  WKFL WSGTI + +   +NR
Sbjct  60   YSRIINQRHELLENVSRKVVTDDGARQTVESEKAVAWKFLSWSGTIPITLDFVENR  115



>ref|NP_564199.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE65649.1| unknown [Arabidopsis thaliana]
 gb|AEE30408.1| uncharacterized protein AT1G23590 [Arabidopsis thaliana]
Length=217

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN-----KRVFKNIQKVISR  640
            W D PP++KVT  KG LC++  ++  GLPP +V+ +  +P+N      + ++ +     R
Sbjct  48   WYDAPPKVKVTTKKG-LCHMYIELTFGLPPRSVFELFTNPDNLPLVSDKSWRQLLVNKKR  106

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            KVL  +GPRQ+VE+++   W FLWWSG + +++   +N
Sbjct  107  KVLKRDGPRQIVEVDKVVAWDFLWWSGGMPININAVEN  144



>emb|CDY25797.1| BnaA07g09850D [Brassica napus]
Length=306

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 66/118 (56%), Gaps = 10/118 (8%)
 Frame = +2

Query  431  VDLEKQMQPWKENPT---WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
             +L +Q++ W+   +   W D P ++K+   KG LC+LN    +G PP AVY +  +P N
Sbjct  78   AELWRQVRLWRSENSKHPWYDAPAKVKMKTKKG-LCHLNIDFTLGWPPQAVYEMFTNPRN  136

Query  602  KRVFKNI------QKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
                 ++         I+  VL  +GPRQ+ E+E+   WK L ++GTI +HV++D+N 
Sbjct  137  LNFLHSVASTYGAHDTIATMVLKKDGPRQITEVEKVLRWKILGYNGTIPIHVIIDENH  194



>ref|NP_001077588.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30409.1| uncharacterized protein AT1G23590 [Arabidopsis thaliana]
Length=195

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN-----KRVFKNIQKVISR  640
            W D PP++KVT  KG LC++  ++  GLPP +V+ +  +P+N      + ++ +     R
Sbjct  26   WYDAPPKVKVTTKKG-LCHMYIELTFGLPPRSVFELFTNPDNLPLVSDKSWRQLLVNKKR  84

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            KVL  +GPRQ+VE+++   W FLWWSG + +++   +N
Sbjct  85   KVLKRDGPRQIVEVDKVVAWDFLWWSGGMPININAVEN  122



>emb|CDY54284.1| BnaC07g48250D [Brassica napus]
Length=335

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 65/109 (60%), Gaps = 12/109 (11%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQK----  628
            K++P W D P ++KV   KG LC+LN    +G PP +V+ +  DP N  +F ++ K    
Sbjct  95   KKHP-WNDAPAKVKVKTKKG-LCHLNIDFTLGSPPQSVFQMFTDPRNMGIFHSMGKYKKH  152

Query  629  ------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
                    + KVL  +GPRQ+ E+E+   WK L ++GTI +H+++D+N+
Sbjct  153  WRTRLDTRATKVLKKDGPRQITEVEKVLRWKILGYNGTIPIHLIIDENQ  201



>gb|AAC98015.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=232

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN-----KRVFKNIQKVISR  640
            W D PP++KVT  KG LC++  ++  GLPP +V+ +  +P+N      + ++ +     R
Sbjct  48   WYDAPPKVKVTTKKG-LCHMYIELTFGLPPRSVFELFTNPDNLPLVSDKSWRQLLVNKKR  106

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            KVL  +GPRQ+VE+++   W FLWWSG + +++   +N
Sbjct  107  KVLKRDGPRQIVEVDKVVAWDFLWWSGGMPININAVEN  144



>ref|NP_001185072.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30399.1| uncharacterized protein AT1G23520 [Arabidopsis thaliana]
Length=170

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W+   +   W D P ++KV    G LC+++    +GLPP A Y+++ +P+N+
Sbjct  42   EMKEQLKLWRHAEKKEQWEDVPAKVKVETEDG-LCHVDMVFTLGLPPQAAYDVLTNPDNQ  100

Query  605  RVFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + I +       +SR VL D G  Q VE E+A  WKFL WSGTI + +   +NR
Sbjct  101  SYSRIINQRHELLDNVSRNVLTDNGSSQTVEAEKAVAWKFLSWSGTIPISLDFVENR  157



>gb|AAC98021.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=287

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 63/114 (55%), Gaps = 17/114 (15%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK----NIQK  628
            +E   W D P ++KVT   G LC++N +  +GLPP+ VY +  +P N  VFK      Q+
Sbjct  66   EEKHPWYDAPAKVKVTTKNG-LCHMNIEFKLGLPPEGVYEMFTNPNNYPVFKKDKAGRQQ  124

Query  629  VI------------SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            +I            SRKVL   GPRQ  E+E+   W FL+ S  I +H+++D+N
Sbjct  125  MIGSVGFSPMKENKSRKVLKKNGPRQTTEMEKDLYWNFLFISRAIPIHLVIDEN  178



>ref|XP_010477666.1| PREDICTED: uncharacterized protein LOC104756732 isoform X3 [Camelina 
sativa]
Length=223

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = +2

Query  482  DHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK-------NIQKVISR  640
            +H   + VT  KG LC+++ ++ VGLPP+ VY++ A+P N   F+        + +  SR
Sbjct  20   NHGMMLLVTTKKG-LCHMHIELTVGLPPEGVYDLFANPNNFPFFRIDNETGRELLQNKSR  78

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KVL+ +GPRQVV+LE+A  + FLWW       ++ D+N+
Sbjct  79   KVLMKDGPRQVVQLEKALTYDFLWWYRAFPFTLIADENQ  117



>ref|XP_006416065.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
 gb|ESQ34418.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
Length=308

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 63/99 (64%), Gaps = 6/99 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF-----KNIQKVISR  640
            W + PP++ VT  KG LC++N ++ VGL PD VY +  +PE    F     + +    S 
Sbjct  91   WYNPPPKVTVTTKKG-LCHMNVELIVGLTPDGVYELFTNPETGAFFDKDKWRGLMTNKSI  149

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KVL+++GPRQV++++++  W  LW+S  I + ++VD+NR
Sbjct  150  KVLMEDGPRQVMKVKKSVAWDLLWFSIPIPIILIVDENR  188



>ref|NP_173766.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79593.1|AC007945_13 F28C11.15 [Arabidopsis thaliana]
 gb|AAC98008.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AEE30398.1| uncharacterized protein AT1G23520 [Arabidopsis thaliana]
Length=263

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W+   +   W D P ++KV    G LC+++    +GLPP A Y+++ +P+N+
Sbjct  42   EMKEQLKLWRHAEKKEQWEDVPAKVKVETEDG-LCHVDMVFTLGLPPQAAYDVLTNPDNQ  100

Query  605  RVFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + I +       +SR VL D G  Q VE E+A  WKFL WSGTI + +   +NR
Sbjct  101  SYSRIINQRHELLDNVSRNVLTDNGSSQTVEAEKAVAWKFLSWSGTIPISLDFVENR  157



>ref|XP_009103162.1| PREDICTED: uncharacterized protein LOC103829264 [Brassica rapa]
Length=341

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 64/108 (59%), Gaps = 12/108 (11%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQK----  628
            K++P W D P ++KV   KG +C+LN    +G PP +V+  + DP N  +F ++ K    
Sbjct  95   KKHP-WNDAPAKVKVKTRKG-ICHLNIDFTLGSPPQSVFQTLTDPRNMGIFHSMGKYKNN  152

Query  629  ------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
                    + KVL  +GPRQ+ E+E+   WK L ++GTI +H+++D+N
Sbjct  153  WRTRLDTRATKVLKKDGPRQITEMEKVLRWKILGYNGTIPIHLIIDEN  200



>emb|CDY25794.1| BnaA07g09880D [Brassica napus]
Length=379

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 70/121 (58%), Gaps = 16/121 (13%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +L +Q + W    K++P W D P ++KV   KG +C+LN    +G PP +V+  + DP N
Sbjct  146  ELVRQNRLWNSEHKKHP-WNDAPAKVKVKTRKG-ICHLNIDFTLGSPPQSVFQTLTDPRN  203

Query  602  KRVFKNIQK----------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQ  751
              +F ++ K            + KVL  +GPRQ+ E+E+   WK L ++GTI +H+++D+
Sbjct  204  MGIFHSMGKYKNNWRTRLDTRATKVLKKDGPRQITEMEKVLRWKILGYNGTIPIHLIIDE  263

Query  752  N  754
            N
Sbjct  264  N  264



>emb|CDY25796.1| BnaA07g09860D [Brassica napus]
Length=364

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +L +Q + W    K++P W D P ++KV   KG LC+LN    +G PP +V+ +  DP N
Sbjct  81   ELARQDRLWNSEHKKHP-WNDAPAKVKVKTKKG-LCHLNIDFTLGSPPQSVFEMFTDPRN  138

Query  602  KRVFKNIQK----------VISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQ  751
              +F ++ K            + KVL  +GPRQ+ E+E+   WK L ++GTI +H+++D+
Sbjct  139  MGIFHSMGKYKKNWRTRLDTRATKVLKKDGPRQITEVEKVLRWKILGYNGTIPIHLIIDE  198

Query  752  NR  757
            N 
Sbjct  199  NH  200



>ref|XP_006304583.1| hypothetical protein CARUB_v10011627mg [Capsella rubella]
 gb|EOA37481.1| hypothetical protein CARUB_v10011627mg [Capsella rubella]
Length=266

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 71/117 (61%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W+   +   W D PP++KV    G +C+++    +GLPP A Y+++ +P+N+
Sbjct  45   EMKEQLKLWRHAEKKEQWEDFPPKVKVETEDG-ICHVDIVFVLGLPPQAAYDVLTNPDNQ  103

Query  605  RVFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + I +       +SRKV+ D+G R+ VE E+A  WKF  WSGTI + +   +NR
Sbjct  104  PYSRIINRRHELLENVSRKVVSDDGSRKTVEAEKAVAWKFRSWSGTIPITLDFVENR  160



>ref|XP_010477665.1| PREDICTED: uncharacterized protein LOC104756732 isoform X2 [Camelina 
sativa]
Length=256

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = +2

Query  482  DHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK-------NIQKVISR  640
            +H   + VT  KG LC+++ ++ VGLPP+ VY++ A+P N   F+        + +  SR
Sbjct  53   NHGMMLLVTTKKG-LCHMHIELTVGLPPEGVYDLFANPNNFPFFRIDNETGRELLQNKSR  111

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KVL+ +GPRQVV+LE+A  + FLWW       ++ D+N+
Sbjct  112  KVLMKDGPRQVVQLEKALTYDFLWWYRAFPFTLIADENQ  150



>ref|XP_006396882.1| hypothetical protein EUTSA_v10028680mg [Eutrema salsugineum]
 gb|ESQ38335.1| hypothetical protein EUTSA_v10028680mg [Eutrema salsugineum]
Length=426

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 75/142 (53%), Gaps = 13/142 (9%)
 Frame = +2

Query  365  RRDGDVLMSSFVGKKGAFGILXVDLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNL  535
            ++ GDV   +       +  L  +L++Q + W        W D P ++KV    G LC+L
Sbjct  180  KKHGDVKSRTLYSVDPKYFDL-AELKRQARVWTNANNKQPWYDAPAKVKVKTKNG-LCHL  237

Query  536  NAKVNVGLPPDAVYNIVADPENKRVFK------NIQKV--ISRKVLLDEGPRQVVELEQA  691
            N +  +GL P   Y ++ +P N   F       + Q++   S KVL  +GPRQ+ ++ +A
Sbjct  238  NIEFTLGLFPQGAYEMLTNPRNISFFSPFDNDHSSQRLENKSTKVLKKDGPRQITKVGKA  297

Query  692  AMWKFLWWSGTISVHVLVDQNR  757
              WK LWWSGTI +H+++D+N 
Sbjct  298  LRWKLLWWSGTIPIHLIIDENH  319



>ref|XP_006306553.1| hypothetical protein CARUB_v10012640mg [Capsella rubella]
 gb|EOA39451.1| hypothetical protein CARUB_v10012640mg [Capsella rubella]
Length=264

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 7/99 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ------KVIS  637
            W D P ++KVT  K  LC++N +  +GLPP+ VY +  +P N  VFK  +      +  S
Sbjct  60   WYDAPAKVKVTT-KNGLCHMNIEFKLGLPPEGVYEMFTNPNNYPVFKKDKAGRQRLENKS  118

Query  638  RKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            R VL   GPRQ  ++E+   W FL+ S  I +H+++D+N
Sbjct  119  RNVLKKNGPRQTTKMEKDLHWNFLFLSKIIPIHLIIDEN  157



>ref|XP_006416064.1| hypothetical protein EUTSA_v10009581mg, partial [Eutrema salsugineum]
 gb|ESQ34417.1| hypothetical protein EUTSA_v10009581mg, partial [Eutrema salsugineum]
Length=203

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +2

Query  503  VTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF----KNIQKVISRKVLLDEGPRQ  670
            VT  KG LC++N ++ +G+ PD VY    +P    +F    + + ++ SRKVL ++GPRQ
Sbjct  1    VTTEKG-LCHMNIEMTMGMTPDGVYETFTNPHKLPMFLIGKRQLLEIKSRKVLKNDGPRQ  59

Query  671  VVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              +L+ A  W FLWWSG   + ++V++N+
Sbjct  60   TAKLKTAVAWDFLWWSGAFPITLIVEENK  88



>gb|KFK40097.1| hypothetical protein AALP_AA3G330000 [Arabis alpina]
Length=276

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF-----KNIQKVISR  640
            W D PP++KVT   G LC+++ +  VG+ P AV+  +        F     +++ ++ S 
Sbjct  58   WYDAPPQVKVTTKNG-LCHMHIEFTVGMTPGAVFFQLTQRNTSPFFDFDKWRHLLEIKST  116

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KVL D+GPRQ+V+ ++     FLWWSGT+ ++++V +NR
Sbjct  117  KVLKDDGPRQIVKYKKLLTCDFLWWSGTLPIYLIVYENR  155



>gb|AAC98019.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
 gb|AAY78618.1| unknown [Arabidopsis thaliana]
Length=264

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR  640
            K++P W D P ++KVT  K  LC+LN +  +GLPP+AVY +  +P N   FK  +    R
Sbjct  56   KKHP-WYDAPAKVKVTT-KKCLCHLNIEFKLGLPPEAVYEMFTNPNNFPFFKEDKAGRQR  113

Query  641  ------KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
                  KVL  +GPRQ  E+E+A  W FL  S  I +H+++ +N
Sbjct  114  LENKSTKVLKKDGPRQTTEVEKALSWNFLGCSVDIPIHLIIHEN  157



>ref|XP_006306474.1| hypothetical protein CARUB_v10012439mg, partial [Capsella rubella]
 gb|EOA39372.1| hypothetical protein CARUB_v10012439mg, partial [Capsella rubella]
Length=244

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +++KQ+Q W    K++P W + PP++KVT  KG +C+++ ++ +G  P++VY + A+P N
Sbjct  27   EVDKQVQLWIDEDKKHP-WVNPPPKVKVTTKKG-ICHMHTELTIGRIPESVYLLFANPLN  84

Query  602  KRVFKNI-----------QKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
             + F+              +   RK+L  +GPR++ E+E+   W FLW+S T+ ++++V+
Sbjct  85   NQYFQEFDGKNFWFSFYTNESKPRKLLRKDGPRRIAEVEKIVSWNFLWFSRTLPINLIVE  144

Query  749  QNR  757
             N+
Sbjct  145  DNQ  147



>ref|XP_010460143.1| PREDICTED: uncharacterized protein LOC104741068 [Camelina sativa]
Length=253

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++E+Q+Q W   ++  TW D PP++KVT  KG LC++  ++ +G PPD V+ I+      
Sbjct  9    EVERQVQLWVDAEKKHTWHDAPPKVKVTTKKG-LCHIKIELTLGFPPDKVFGIIT---AG  64

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              F       S+KVL ++GPRQ+V++ +   W+FL  S  I + ++V +NR
Sbjct  65   SFFSRPTSGKSKKVLKEDGPRQIVKVVKTVDWEFLGSSFAIPISLIVHENR  115



>ref|XP_010498869.1| PREDICTED: uncharacterized protein LOC104776482 isoform X1 [Camelina 
sativa]
Length=297

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 64/106 (60%), Gaps = 5/106 (5%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++E+Q+Q W   ++  TW D PP++KVT  KG LC++  ++ +G PPD V+ I+ DP N 
Sbjct  54   EVERQVQLWVDAEKKHTWHDAPPKVKVTTKKG-LCHIKIELRLGFPPDKVFRIITDPSNG  112

Query  605  RVFKNIQKV-ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHV  739
              F        S+KVL ++GPRQ+ ++ +   WKFL  S  I + V
Sbjct  113  PFFLYPPLTGKSKKVLREDGPRQIAKVVKTVEWKFLGSSFAIPISV  158



>ref|XP_010460137.1| PREDICTED: uncharacterized protein LOC104741062 isoform X1 [Camelina 
sativa]
Length=325

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W+   +   W D P ++KV    G L +++    +GLPP A Y+++ +P+N+
Sbjct  106  EMKEQLKLWRHAEKKEQWEDLPAKVKVETEDG-LSHVDIVFILGLPPQAAYDVLTNPDNQ  164

Query  605  RVFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + I +       +SRKV+ D+G RQ VE E+A  WKFL WSGTI + +   +NR
Sbjct  165  AYSRIINQRHELLENVSRKVVKDDGARQTVESEKAVAWKFLSWSGTIPITLDFVENR  221



>ref|XP_010460138.1| PREDICTED: uncharacterized protein LOC104741062 isoform X2 [Camelina 
sativa]
Length=264

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W+   +   W D P ++KV    G L +++    +GLPP A Y+++ +P+N+
Sbjct  45   EMKEQLKLWRHAEKKEQWEDLPAKVKVETEDG-LSHVDIVFILGLPPQAAYDVLTNPDNQ  103

Query  605  RVFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + I +       +SRKV+ D+G RQ VE E+A  WKFL WSGTI + +   +NR
Sbjct  104  AYSRIINQRHELLENVSRKVVKDDGARQTVESEKAVAWKFLSWSGTIPITLDFVENR  160



>gb|KFK44439.1| hypothetical protein AALP_AA1G256700 [Arabis alpina]
Length=242

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQ--------KV  631
            W D PP +KV   KG +C+LN +  +G PP  VY ++ +P N   F            + 
Sbjct  100  WHDAPPMVKVKTEKG-ICHLNIEYTLGWPPQGVYEMLTNPRNVPFFHLFDGEDFPQRLEN  158

Query  632  ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             S KVL  +GPRQ+ E+++   WK   WSG + +H+++D+N 
Sbjct  159  KSTKVLKKDGPRQITEVDKFLRWKLFSWSGGVPIHLIIDENH  200



>emb|CDY25791.1| BnaA07g09910D [Brassica napus]
Length=269

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 70/112 (63%), Gaps = 9/112 (8%)
 Frame = +2

Query  440  EKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            +KQ++ W    +++P W D PP++KVT  +G +C++N +  +G+ P A +  +  P +  
Sbjct  52   DKQIKLWNVAERKHP-WYDPPPKVKVTTKRG-ICHMNIEFTLGVTPLAAFENLRKPMSLS  109

Query  608  VFKNIQKVI---SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            +  + ++++   SRKVL  +GPR+++E E    + FLWWSG   + ++VD+N
Sbjct  110  IDMSARQLLKNKSRKVLKKDGPREILETENTVAFDFLWWSGAFPIKLIVDEN  161



>ref|XP_009103163.1| PREDICTED: uncharacterized protein LOC103829265 [Brassica rapa]
Length=269

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 70/112 (63%), Gaps = 9/112 (8%)
 Frame = +2

Query  440  EKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            +KQ++ W    +++P W D PP++KVT  +G +C++N +  +G+ P A +  +  P +  
Sbjct  52   DKQIKLWNVAERKHP-WYDPPPKVKVTTKRG-ICHMNIEFTLGVTPLAAFENLRKPMSLS  109

Query  608  VFKNIQKVI---SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            +  + ++++   SRKVL  +GPR+++E E    + FLWWSG   + ++VD+N
Sbjct  110  IDMSARQLLKNKSRKVLKKDGPREILETENTVAFDFLWWSGAFPIKLIVDEN  161



>ref|XP_010498902.1| PREDICTED: uncharacterized protein LOC104776513 isoform X2 [Camelina 
sativa]
Length=292

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 6/111 (5%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++E+Q Q W   ++  TW D PP++KV   KG LC +N +  +G PPD V+ I+      
Sbjct  54   EVERQAQLWIDAEKKHTWHDAPPKVKVITKKG-LCRMNIEFTLGFPPDKVFGIIT--AGS  110

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
                      S+KVL ++GPRQ+ ++ +   WKFL  S  I + V+VD+NR
Sbjct  111  FFLDPPLTGKSKKVLREDGPRQIAKVVKTVEWKFLGSSFAIPISVIVDENR  161



>ref|NP_173776.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30413.1| uncharacterized protein AT1G23640 [Arabidopsis thaliana]
Length=424

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 7/99 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISR-----  640
            W D P ++KVT  K  LC+LN +  +GLPP+AVY +  +P N   FK  +    R     
Sbjct  220  WYDAPAKVKVTT-KKCLCHLNIEFKLGLPPEAVYEMFTNPNNFPFFKEDKAGRQRLENKS  278

Query  641  -KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
             KVL  +GPRQ  E+E+A  W FL  S  I +H+++ +N
Sbjct  279  TKVLKKDGPRQTTEVEKALSWNFLGCSVDIPIHLIIHEN  317


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  620  IQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ++   SRKVL  +GPRQ+V L++A  W FLWWSG   ++++VD N+
Sbjct  75   VKATKSRKVLKKDGPRQIVRLKKAVAWDFLWWSGEFPINLIVDVNK  120



>ref|XP_002893297.1| hypothetical protein ARALYDRAFT_889905 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69556.1| hypothetical protein ARALYDRAFT_889905 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 69/112 (62%), Gaps = 14/112 (13%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            +++KQ Q W    K+ P W D PP++K+T  KG LC++N ++ +G  PD V+ +  +P +
Sbjct  50   EMKKQGQLWIDAEKKQP-WYDAPPKVKLTTKKG-LCHMNIELTLGWYPDGVFELFTNPND  107

Query  602  KRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              +F ++ K   R++L       +V++EQ   W FLWWSG I + ++V++N+
Sbjct  108  GPLFFDMNKH-GRQLL-------IVKVEQPVAWDFLWWSGAIPIELIVEENQ  151



>gb|AAC98013.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=315

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 20/121 (17%)
 Frame = +2

Query  431  VDLEKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN---  601
            +D EK M PW       D PP++KVT   G LC++N ++ +G  PD V+    +P N   
Sbjct  63   IDAEK-MHPW------NDAPPKVKVTTKNG-LCHMNIELTLGFSPDKVFGFFTNPSNGPF  114

Query  602  ---------KRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
                       ++ +  +  SRKVL+++GPRQ+ ++++   WKFL  S  + + ++VD+N
Sbjct  115  FLSPPLFSYHSLYYSDVESKSRKVLMEDGPRQIAKVKKTVDWKFLGSSFAVPISLIVDEN  174

Query  755  R  757
            R
Sbjct  175  R  175



>ref|XP_002893296.1| hypothetical protein ARALYDRAFT_889904 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69555.1| hypothetical protein ARALYDRAFT_889904 [Arabidopsis lyrata subsp. 
lyrata]
Length=188

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 65/114 (57%), Gaps = 10/114 (9%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            D+++Q + W   K+   W   P +++V   K  LC++N +  +G+ P AVY ++ +P N 
Sbjct  76   DMKRQSELWHGEKKKHPWYPAPAKVEVKT-KNGLCHMNIEFTIGVIPPAVYEMLTNPRNI  134

Query  605  RVFKNIQKVISR------KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVD  748
              F   ++   R      KVL  +GPRQ+ ++ +A  WKF+ WSG I +H+++D
Sbjct  135  SFFIKDERWRQRLENKSTKVLKKDGPRQITDVRKALRWKFIMWSGAIPIHLIID  188



>gb|KFK44440.1| hypothetical protein AALP_AA1G256800 [Arabis alpina]
Length=317

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = +2

Query  431  VDLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
             +LE Q + W   K+   W D P ++KV   KG +C+LN +  +G PP  V  ++ +P N
Sbjct  82   AELETQTKLWAFPKKKHPWHDAPAKVKVKTEKG-ICHLNIEYTLGWPPLGVSEMLTNPRN  140

Query  602  KRVFKNIQ--------KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               F + +        +  S KVL  +GPRQ+ E+ +   WK   W G+I +H+++D+N 
Sbjct  141  IYFFHSFEGKDFRQRLENKSTKVLKKDGPRQITEVHKFLRWKLFSWFGSIPIHIIIDENH  200



>ref|XP_010477651.1| PREDICTED: uncharacterized protein LOC104756721 [Camelina sativa]
Length=296

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 12/114 (11%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPE--  598
            ++E+Q Q W   ++   W D PP++KVT  KG LC++   + VG PPD V+ I+      
Sbjct  54   EVERQAQLWIDAEKKHIWHDAPPKVKVTTKKG-LCHMKIDLTVGFPPDKVFGIITAGSFF  112

Query  599  -NKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
             N  +  N     SRKVL ++GPRQ+ ++ +   W+FL  S  I + ++VD+NR
Sbjct  113  LNPPLTSN-----SRKVLREDGPRQIAKVVKTVDWEFLGSSFDIPISLIVDENR  161



>ref|XP_002893291.1| hypothetical protein ARALYDRAFT_313224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69550.1| hypothetical protein ARALYDRAFT_313224 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 67/110 (61%), Gaps = 6/110 (5%)
 Frame = +2

Query  440  EKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            E+Q Q W    K++P W   PP++KVT  KG +C+++ ++ +GL PD V+ +  +P N  
Sbjct  52   ERQDQLWTAAEKKHP-WKVAPPKVKVTTKKG-ICHIHIELTLGLHPDGVFELFTNPHNGP  109

Query  608  VFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
              + + K  SRKVL ++GP Q+ ++E+   W F   S ++ + + VD+NR
Sbjct  110  NTEPLLKSKSRKVLKEDGPSQIAKVEKVLAWNFSGRSFSVPISLTVDENR  159



>emb|CDY54286.1| BnaC07g48270D [Brassica napus]
Length=269

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 69/112 (62%), Gaps = 9/112 (8%)
 Frame = +2

Query  440  EKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            +KQ++ W    +++P W D PP++KVT  +G +C++N +  +G+ P A +  +  P +  
Sbjct  52   DKQIKLWNVAERKHP-WYDPPPKVKVTTKRG-ICHMNIEFTLGVTPLAAFENLRKPMSLS  109

Query  608  VFKNIQKVI---SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            +  + ++++   SRK+L  +GPR++VE E    + FLWWS    + ++VD+N
Sbjct  110  IDMSARQLLKNKSRKLLKKDGPREIVETENTVAFDFLWWSRAFPIKLIVDEN  161



>ref|XP_005845419.1| hypothetical protein CHLNCDRAFT_137004 [Chlorella variabilis]
 gb|EFN53317.1| hypothetical protein CHLNCDRAFT_137004 [Chlorella variabilis]
Length=304

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +2

Query  473  TWTDHPPEIKVTVPK---GSLCNLNAKVNVGLPPDAVYNIVADPEN-KRVFKNIQKVISR  640
            T+++   ++ V V K   G LC L+    V LPPD ++ ++  P++ KR+FK+++ V  R
Sbjct  22   TFSESSKDMHVRVEKPAAGYLCTLSMFARVPLPPDQLFELLVSPDDCKRIFKSLKNVHHR  81

Query  641  KVLLDEG-PRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +VL D+G   + VE++Q   W+FL + G+ +V ++V+Q R
Sbjct  82   RVLADDGHGNRTVEVDQTGSWRFLMFRGSFTVRMIVEQRR  121



>gb|KFK44436.1| hypothetical protein AALP_AA1G256300 [Arabis alpina]
Length=220

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = +2

Query  437  LEKQMQPWKE---NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            +++Q+  W+E      W D P ++KV   KG +C+++ +  +GLPP A Y+++ +P+N+ 
Sbjct  1    MKEQLTLWREAEKKKRWYDPPAKVKVRTEKG-ICHMHMEFTLGLPPKAAYDVLTNPDNQS  59

Query  608  VF-----KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
                   + +   ISRK++ ++G + VVE E+   W    WS  I + +L+++N
Sbjct  60   YSSIVNDRELLDNISRKIVTNDGTKMVVEAEKDVFWNIRSWSRPIPITLLIEEN  113



>ref|XP_006416066.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
 gb|ESQ34419.1| hypothetical protein EUTSA_v10008137mg [Eutrema salsugineum]
Length=336

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 69/132 (52%), Gaps = 35/132 (27%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF---------  613
            K++P W + PP++ VT  KG LC++N ++ VGL PD VY +  +PE    F         
Sbjct  87   KKHP-WYNPPPKVTVTTKKG-LCHMNVELIVGLTPDGVYELFTNPETGAFFDKDKWRGLM  144

Query  614  ---------KNIQKVI---------------SRKVLLDEGPRQVVELEQAAMWKFLWWSG  721
                      N+  +I               S KVL+++GPRQV++++++  W  LW+S 
Sbjct  145  VYFLIIIDTSNVVSIITILGTVLFFLTKTNKSIKVLMEDGPRQVMKVKKSVAWDLLWFSI  204

Query  722  TISVHVLVDQNR  757
             I + ++VD+NR
Sbjct  205  PIPIILIVDENR  216



>ref|XP_010477658.1| PREDICTED: uncharacterized protein LOC104756727 isoform X2 [Camelina 
sativa]
Length=255

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +2

Query  374  GDVLMSSFVGKKGAFGILXVDLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAK  544
            GDV   S       +  L  ++  Q + W   K+   W   P + KV    G +C++N +
Sbjct  8    GDVRSKSLYAVDTKYFDLK-EMRTQSKLWHAEKKKHPWYVPPAKFKVKTKNG-ICHMNIE  65

Query  545  VNVGLPPDAVYNIVADPENKRVFKNIQKVI-----------SRKVLLDEGPRQVVELEQA  691
            + VGL P   Y ++ +P N   F     V            S KVL  +GPRQ+ ++ + 
Sbjct  66   LTVGLIPPGAYEMLTNPRNITFFSADDVVDDDRRRQRLENKSTKVLKKDGPRQITDVSKV  125

Query  692  AMWKFLWWSGTISVHVLVDQN  754
              WKFL +SGTI +H+++D+N
Sbjct  126  LRWKFLLFSGTIPIHLIIDEN  146



>ref|XP_006416076.1| hypothetical protein EUTSA_v10008486mg [Eutrema salsugineum]
 gb|ESQ34429.1| hypothetical protein EUTSA_v10008486mg [Eutrema salsugineum]
Length=265

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 69/116 (59%), Gaps = 9/116 (8%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            D E+Q++ W+   +   W D PP++KVT  +G +C ++ ++ +GLPP A YN++ +P+N+
Sbjct  45   DTEEQLKLWRGAEKKAPWHDPPPKVKVTTLEG-ICFIDMELILGLPPQAAYNVLTNPDNQ  103

Query  605  RVFK--NIQKVI---SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               +  N +++I   SRKV+ ++     VE E+   W  LWWS  I +  +  +N+
Sbjct  104  PYSRIINGRELIHNKSRKVVTNDESGYFVEKEKDVAWNVLWWSRAIPITFVFAENQ  159



>ref|NP_564196.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30397.1| uncharacterized protein AT1G23510 [Arabidopsis thaliana]
Length=192

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 12/112 (11%)
 Frame = +2

Query  434  DLEKQMQPWKENP---TWTDHPPEIKVTVPKG---SLCNLNAKVNVGLPPDAVYNIVADP  595
            ++++Q++ W++      W D PP +KV         +  +  +  +GLPP A YN++ +P
Sbjct  46   EMKQQLKLWRDTEKKEQWNDAPPNVKVERRNDLEWGMSTIEMQFTLGLPPQAAYNVLTNP  105

Query  596  ENKRVFKNIQ-----KVISRKVLL-DEGPRQVVELEQAAMWKFLWWSGTISV  733
            +N+  F+ I+     + ISRKV+  D G  Q+V+ ++A  W FLW SGTI +
Sbjct  106  DNQPYFRIIKGRQLLENISRKVVSPDTGKGQLVDTKKAVAWNFLWLSGTIPI  157



>ref|XP_010477644.1| PREDICTED: uncharacterized protein LOC104756716 [Camelina sativa]
Length=266

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 68/117 (58%), Gaps = 10/117 (9%)
 Frame = +2

Query  434  DLEKQMQPWKENP---TWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++++Q++ W++      W D P ++KV    G L +++    +GLPP A Y+++ +P+N+
Sbjct  45   EMKEQLKLWRDAEKINQWEDLPAKVKVETEDG-LSHVDIVFILGLPPQAAYDVLTNPDNQ  103

Query  605  RVFKNIQKV------ISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + I +       +SRKV+ ++G R  VE E+A  WKF  WSGTI + +   +NR
Sbjct  104  AYSRIINQRHELLENVSRKVVKEDGARLTVESEKAVAWKFRSWSGTIPITLDFVENR  160



>ref|XP_011400565.1| hypothetical protein F751_0254 [Auxenochlorella protothecoides]
 gb|KFM27582.1| hypothetical protein F751_0254 [Auxenochlorella protothecoides]
Length=205

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +2

Query  497  IKVTVPKGSLCNLNAKVNVGLPPDAVYN-IVADPENKRVFKNIQKVISRKVLLDEGPRQV  673
            I+V+   G LC + A+ ++ LPPD +++ IV  P+N  +F+N+     RK+L      +V
Sbjct  20   IRVSQKPGYLCRIEAECSLPLPPDTLFHQIVTHPDNATIFRNMDSCTFRKILQRSDAVRV  79

Query  674  VELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +E+E AA W+ L + GT    + V +NR
Sbjct  80   LEVEHAANWRILLFRGTFKTRLRVHENR  107



>ref|NP_973898.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30396.1| uncharacterized protein AT1G23510 [Arabidopsis thaliana]
Length=146

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (57%), Gaps = 12/111 (11%)
 Frame = +2

Query  437  LEKQMQPWKENP---TWTDHPPEIKVTVPKG---SLCNLNAKVNVGLPPDAVYNIVADPE  598
            +++Q++ W++      W D PP +KV         +  +  +  +GLPP A YN++ +P+
Sbjct  1    MKQQLKLWRDTEKKEQWNDAPPNVKVERRNDLEWGMSTIEMQFTLGLPPQAAYNVLTNPD  60

Query  599  NKRVFKNIQ-----KVISRKVLL-DEGPRQVVELEQAAMWKFLWWSGTISV  733
            N+  F+ I+     + ISRKV+  D G  Q+V+ ++A  W FLW SGTI +
Sbjct  61   NQPYFRIIKGRQLLENISRKVVSPDTGKGQLVDTKKAVAWNFLWLSGTIPI  111



>emb|CDY51642.1| BnaC05g50890D [Brassica napus]
Length=272

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 71/120 (59%), Gaps = 12/120 (10%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            + ++Q++ W    K+ P   D+PP++KV+       +L    ++GLPP+ V++IV   +N
Sbjct  45   ETKRQLKLWRAEEKKFPWQRDYPPKVKVSKTSIGETHLEMAFSIGLPPETVFDIVTSHDN  104

Query  602  K--RVFKNIQK-----VISRKVLLDEG-PRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +    FK +++     V S KVL D G   +VV ++++A WKFLWW G + + ++ ++NR
Sbjct  105  QTYSYFKQMKRRKILDVKSSKVLRDNGRDEKVVVVKKSAPWKFLWWDGKMPIELIFNENR  164



>gb|AAC98007.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=251

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 12/112 (11%)
 Frame = +2

Query  434  DLEKQMQPWKENP---TWTDHPPEIKVTVPKG---SLCNLNAKVNVGLPPDAVYNIVADP  595
            ++++Q++ W++      W D PP +KV         +  +  +  +GLPP A YN++ +P
Sbjct  46   EMKQQLKLWRDTEKKEQWNDAPPNVKVERRNDLEWGMSTIEMQFTLGLPPQAAYNVLTNP  105

Query  596  ENKRVFKNIQ-----KVISRKVLL-DEGPRQVVELEQAAMWKFLWWSGTISV  733
            +N+  F+ I+     + ISRKV+  D G  Q+V+ ++A  W FLW SGTI +
Sbjct  106  DNQPYFRIIKGRQLLENISRKVVSPDTGKGQLVDTKKAVAWNFLWLSGTIPI  157



>gb|AAF79594.1|AC007945_14 F28C11.14 [Arabidopsis thaliana]
Length=254

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 12/112 (11%)
 Frame = +2

Query  434  DLEKQMQPWKENP---TWTDHPPEIKVTVPKG---SLCNLNAKVNVGLPPDAVYNIVADP  595
            ++++Q++ W++      W D PP +KV         +  +  +  +GLPP A YN++ +P
Sbjct  46   EMKQQLKLWRDTEKKEQWNDAPPNVKVERRNDLEWGMSTIEMQFTLGLPPQAAYNVLTNP  105

Query  596  ENKRVFKNIQ-----KVISRKVLL-DEGPRQVVELEQAAMWKFLWWSGTISV  733
            +N+  F+ I+     + ISRKV+  D G  Q+V+ ++A  W FLW SGTI +
Sbjct  106  DNQPYFRIIKGRQLLENISRKVVSPDTGKGQLVDTKKAVAWNFLWLSGTIPI  157



>ref|XP_002893286.1| hypothetical protein ARALYDRAFT_472613 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69545.1| hypothetical protein ARALYDRAFT_472613 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (56%), Gaps = 12/120 (10%)
 Frame = +2

Query  434  DLEKQMQPWK---ENPTWTDHPPEIKVTVPKG---SLCNLNAKVNVGLPPDAVYNIVADP  595
            +++ Q++ W+   +   W D PP++KV         +  +  +  +GLPP A Y+++ +P
Sbjct  47   EMKHQLKLWRDAEQKEQWNDDPPKVKVERRNDLEWGMSTIEMQFTLGLPPQAAYDVLTNP  106

Query  596  ENK---RVFKNIQKV--ISRKVLL-DEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +N+   R+ K  Q +  ISRKV+  D G  Q+V+ E+A  W FLW SGTI +     +NR
Sbjct  107  DNQPYSRIIKGRQLLENISRKVVSPDTGKGQLVDTEKAVAWNFLWLSGTIPIIANFIENR  166



>ref|XP_010477657.1| PREDICTED: uncharacterized protein LOC104756727 isoform X1 [Camelina 
sativa]
Length=304

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +2

Query  374  GDVLMSSFVGKKGAFGILXVDLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAK  544
            GDV   S       +  L  ++  Q + W   K+   W   P + KV    G +C++N +
Sbjct  57   GDVRSKSLYAVDTKYFDLK-EMRTQSKLWHAEKKKHPWYVPPAKFKVKTKNG-ICHMNIE  114

Query  545  VNVGLPPDAVYNIVADPENKRVFKNIQKVI-----------SRKVLLDEGPRQVVELEQA  691
            + VGL P   Y ++ +P N   F     V            S KVL  +GPRQ+ ++ + 
Sbjct  115  LTVGLIPPGAYEMLTNPRNITFFSADDVVDDDRRRQRLENKSTKVLKKDGPRQITDVSKV  174

Query  692  AMWKFLWWSGTISVHVLVDQN  754
              WKFL +SGTI +H+++D+N
Sbjct  175  LRWKFLLFSGTIPIHLIIDEN  195



>ref|XP_009115510.1| PREDICTED: uncharacterized protein LOC103840745 [Brassica rapa]
 ref|XP_009115511.1| PREDICTED: uncharacterized protein LOC103840745 [Brassica rapa]
 emb|CDY44159.1| BnaA09g30930D [Brassica napus]
Length=272

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 71/120 (59%), Gaps = 12/120 (10%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
            + ++Q++ W    K+ P   D+PP++KV+       +L    ++GLPP+ V++IV   +N
Sbjct  45   ETKRQLKMWRAEEKKFPWQRDYPPKVKVSKTSIGETHLEMAFSIGLPPETVFDIVTSHDN  104

Query  602  K--RVFKNIQK-----VISRKVLLDEG-PRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            +    FK +++     V S KVL D G   +VV ++++A WKFLWW G + + ++ ++NR
Sbjct  105  QTYSYFKQMKRRKILDVKSSKVLRDNGRDEKVVVVKKSAPWKFLWWDGKMPIELVFNENR  164



>ref|XP_006306462.1| hypothetical protein CARUB_v10012413mg [Capsella rubella]
 gb|EOA39360.1| hypothetical protein CARUB_v10012413mg [Capsella rubella]
Length=299

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (52%), Gaps = 15/112 (13%)
 Frame = +2

Query  440  EKQMQPWKENPTWTDHPPEIKVTV-PKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFK  616
            EK+  PW        H P  K  V  K  +C++N +  VGL P   Y ++ +P N   F 
Sbjct  87   EKKKHPW--------HIPPAKFKVETKNGICHMNIEFKVGLIPPGAYEMLTNPRNITFFS  138

Query  617  NIQKVISR------KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
              + +  R      KVL  +GP Q+ ++ ++  WKFL +SGT  +H+++D+N
Sbjct  139  ADENLRQRLENKATKVLKKDGPMQITDVRKSLRWKFLLFSGTTPIHLIIDEN  190



>ref|XP_010510745.1| PREDICTED: uncharacterized protein LOC104786963 [Camelina sativa]
Length=314

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 62/118 (53%), Gaps = 11/118 (9%)
 Frame = +2

Query  431  VDLEKQMQPWKENPT---WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN  601
             +L++Q+  W  N     W D P  +KV + KG +C+L  +  +G PP  VY ++ +P N
Sbjct  82   AELKRQVTLWIPNNNKHPWYDAPATVKVKIKKG-VCHLKIEFTLGWPPHGVYEMLTNPRN  140

Query  602  KRVFKNIQKVI-------SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
               F    +         S KVL  +GPRQ+ ++++   WK L  +  I +H+++D+N
Sbjct  141  MNFFSLFDREFRQRLDNESTKVLKKDGPRQITDVKKTLRWKVLGCTIAIPIHLVIDEN  198



>emb|CDX91720.1| BnaC08g06390D [Brassica napus]
Length=318

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 65/100 (65%), Gaps = 7/100 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPE-----NKRVFKNIQKVISR  640
            W D PP+I+VT  KG L ++N ++ VG  PD VY+++ +P+     N+  ++++ K  SR
Sbjct  93   WYDPPPKIRVTNKKG-LYHMNIELTVGTAPDTVYDLMINPKGGPFFNREKWRDLMKNTSR  151

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSG-TISVHVLVDQNR  757
            KVL + GP++V+ +E+A  +  L  +  +I +H+ +++NR
Sbjct  152  KVLKENGPKRVIMVEKAVAYNVLSLTTISIPLHLTMEENR  191



>ref|XP_002879144.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55403.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=292

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVI-------  634
            W D P  +KV   KG LCNLN +  +G PP  V  ++ +P N   F+   +         
Sbjct  83   WYDAPATVKVKRKKG-LCNLNIEFTLGWPPQLVSEMLTNPRNLNFFRLFDREFRQRLDNK  141

Query  635  SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            S KVL  +GPRQ+ E+++   +K L  S  I +H+++D+N
Sbjct  142  STKVLKKDGPRQITEVKKTFRYKLLGLSIAIPIHLIIDEN  181



>emb|CDY20855.1| BnaC05g26370D [Brassica napus]
Length=277

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +2

Query  434  DLEKQMQPWKENPT---WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADP---  595
            + +KQ   W E      W +  P+IKVT   G   ++N ++ VGLPP  +YN + DP   
Sbjct  42   EAQKQADLWHEAEKKHPWHNASPKIKVTHENG-FYHMNIELTVGLPPYFLYNFLIDPGSG  100

Query  596  --ENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + R  +N+ +  SRKVL + GPRQ++ +E++           IS++++VD+NR
Sbjct  101  AFRDLRKRRNLMENKSRKVLFENGPRQMMRMEKSVACNVFGVYIPISMNLIVDENR  156



>ref|XP_010498901.1| PREDICTED: uncharacterized protein LOC104776513 isoform X1 [Camelina 
sativa]
Length=294

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 6/105 (6%)
 Frame = +2

Query  434  DLEKQMQPW---KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            ++E+Q Q W   ++  TW D PP++KV   KG LC +N +  +G PPD V+ I+      
Sbjct  54   EVERQAQLWIDAEKKHTWHDAPPKVKVITKKG-LCRMNIEFTLGFPPDKVFGIIT--AGS  110

Query  605  RVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHV  739
                      S+KVL ++GPRQ+ ++ +   WKFL  S  I + V
Sbjct  111  FFLDPPLTGKSKKVLREDGPRQIAKVVKTVEWKFLGSSFAIPISV  155



>emb|CDY41441.1| BnaA08g20430D [Brassica napus]
Length=622

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 62/100 (62%), Gaps = 7/100 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF-----KNIQKVISR  640
            W + PP+IKVT  KG L ++N ++ VG  P+ VY ++ DP+    F     ++I K  SR
Sbjct  75   WRNPPPKIKVTNKKG-LYHMNIELTVGTTPNVVYYVLTDPKGGPFFDYKKWRDIMKNTSR  133

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSG-TISVHVLVDQNR  757
            KVL + GP++V+ +E+A  +  L  +  +I +H+ +++NR
Sbjct  134  KVLKENGPKRVIMVEKALAYNILSLTTISIPIHLTMEENR  173


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 74/118 (63%), Gaps = 12/118 (10%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPE-  598
            +L +Q + W    K++P W   PP+I+VT  KG L ++N ++ VG  PD VY+++ +P+ 
Sbjct  380  ELMRQRELWYEAEKKHP-WYVPPPKIRVTNKKG-LYHMNIELTVGTAPDTVYDLMINPKG  437

Query  599  ----NKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSG-TISVHVLVDQNR  757
                N+  ++++ K  SRKVL + GP++V+ +E+A  +  L  +  +I +H+ +++NR
Sbjct  438  GPFFNREKWRDLMKNTSRKVLKENGPKRVIMVEKAVAYNVLSLTTISIPLHLTMEENR  495



>emb|CDX91721.1| BnaC08g06400D [Brassica napus]
Length=491

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 66/105 (63%), Gaps = 8/105 (8%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF-----KNIQ  625
            K++P W + PP+IKVT  KG L ++N ++ VG  P+ VY ++ DP+    F     ++I 
Sbjct  71   KKHP-WHNPPPKIKVTNKKG-LYHMNIELTVGTTPNIVYYVLTDPKGGPFFDYKKWRDIM  128

Query  626  KVISRKVLLDEGPRQVVELEQAAMWKFLWWSG-TISVHVLVDQNR  757
            K  SRKVL + GP++V+ +E+A  +  L  +  +I +H+ +++NR
Sbjct  129  KNTSRKVLKENGPKRVIMVEKALAYYILSLTTISIPIHLTMEENR  173



>ref|XP_009110091.1| PREDICTED: uncharacterized protein LOC103835654 [Brassica rapa]
 ref|XP_009110092.1| PREDICTED: uncharacterized protein LOC103835654 [Brassica rapa]
Length=303

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 62/100 (62%), Gaps = 7/100 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF-----KNIQKVISR  640
            W + PP+IKVT  KG L ++N ++ VG  P+ VY ++ DP+    F     ++I K  SR
Sbjct  75   WRNPPPKIKVTNKKG-LYHMNIELTVGTTPNVVYYVLTDPKGGPFFDYKKWRDIMKNTSR  133

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSG-TISVHVLVDQNR  757
            KVL + GP++V+ +E+A  +  L  +  +I +H+ +++NR
Sbjct  134  KVLKENGPKRVIMVEKALAYNILSLTTISIPIHLNMEENR  173



>ref|XP_005849858.1| hypothetical protein CHLNCDRAFT_57275 [Chlorella variabilis]
 gb|EFN57756.1| hypothetical protein CHLNCDRAFT_57275 [Chlorella variabilis]
Length=277

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +2

Query  497  IKVTVPKGSLCNLNAKVNVGLPPDAVY-NIVADPENKRVFKNIQKVISRKVLLDEGP-RQ  670
            IKVT   G LC++ A     +P   +Y  ++  PEN ++F+++ +   R+VL D+G  R+
Sbjct  38   IKVTQSPGFLCHIEASAAFRMPAHTLYRQVITHPENSKIFRHMDRCSFRRVLHDDGHGRR  97

Query  671  VVELEQAAMWKFLWWSGTISVHVLVDQN  754
             V++   A W+FLW  GT +  + V+++
Sbjct  98   TVKVAHEASWRFLWLKGTFTTKLDVEED  125



>ref|XP_006296266.1| hypothetical protein CARUB_v10025431mg [Capsella rubella]
 gb|EOA29164.1| hypothetical protein CARUB_v10025431mg [Capsella rubella]
Length=312

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPEN-------KRVFKNIQKVI  634
            W D P  +KV   KG +C+L  +  +G PP  VY ++ +P N        R F+      
Sbjct  103  WYDAPATVKVKTKKG-VCHLKIEFTLGWPPHGVYEMLTNPRNLNFFDLFDREFRQRLDNE  161

Query  635  SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            S KVL  +GPRQV ++++   WK L  +  I +H+++D+N
Sbjct  162  STKVLKKDGPRQVTDVKKTLRWKVLGCTIAIPIHLIIDEN  201



>gb|KFK44435.1| hypothetical protein AALP_AA1G256300 [Arabis alpina]
Length=218

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 64/114 (56%), Gaps = 11/114 (10%)
 Frame = +2

Query  437  LEKQMQPWKE---NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKR  607
            +++Q+  W+E      W D  P  KV   KG +C+++ +  +GLPP A Y+++ +P+N+ 
Sbjct  1    MKEQLTLWREAEKKKRWYD--PPAKVRTEKG-ICHMHMEFTLGLPPKAAYDVLTNPDNQS  57

Query  608  VF-----KNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
                   + +   ISRK++ ++G + VVE E+   W    WS  I + +L+++N
Sbjct  58   YSSIVNDRELLDNISRKIVTNDGTKMVVEAEKDVFWNIRSWSRPIPITLLIEEN  111



>ref|XP_009110093.1| PREDICTED: uncharacterized protein LOC103835656 [Brassica rapa]
 emb|CDY41440.1| BnaA08g20420D [Brassica napus]
Length=281

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 64/98 (65%), Gaps = 5/98 (5%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPE---NKRVFKNIQKVISRKV  646
            W + PP+IKVT  KG L ++N ++ VG  P+ VY ++ +     +++ ++++ K  SRKV
Sbjct  74   WHNPPPKIKVTNKKG-LYHMNIELTVGTTPNIVYYVLTESNPFFDRKKWRHLMKNTSRKV  132

Query  647  LLDEGPRQVVELEQAAMWKFLWWSG-TISVHVLVDQNR  757
            L + GPR++V +E+A  + FL  +  +I +H+ +++NR
Sbjct  133  LKENGPRRIVMVEKAVAYDFLSLTTISIPIHLTMEENR  170



>ref|NP_180335.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC08024.1| uncharacterized protein AT2G27670 [Arabidopsis thaliana]
Length=293

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVI-------  634
            W D P  +KV   KG LCNLN +  +G PP  V  ++ +P N   F+   +         
Sbjct  84   WYDAPATVKVKTKKG-LCNLNIEFTLGWPPQLVSEMLTNPRNINFFRLFDRDFRQRLDNK  142

Query  635  SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            S KVL  +GPRQ+  +++   +K L  S  I +H+++D+N
Sbjct  143  STKVLKKDGPRQITRVKKTLRYKLLGRSIAIPIHLIIDEN  182



>emb|CDY16800.1| BnaA09g05820D [Brassica napus]
Length=283

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADP---  595
            + +KQ   W E      W +  P+IKVT   G   ++N ++ VGLPP  +YN + DP   
Sbjct  48   EAQKQADLWHEAEKKHPWHNASPKIKVTHENG-FYHMNIELTVGLPPYFLYNFLIDPGSG  106

Query  596  --ENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + R  +N+ +  SRK+L + GPRQ++ +E++           IS++++VD+NR
Sbjct  107  AFRDLRKRRNLMENKSRKILFENGPRQMMRMEKSVACNVFGVYIPISMNLIVDENR  162



>ref|XP_009112003.1| PREDICTED: uncharacterized protein LOC103837396 [Brassica rapa]
Length=283

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADP---  595
            + +KQ   W E      W +  P+IKVT   G   ++N ++ VGLPP  +YN + DP   
Sbjct  48   EAQKQADLWHEAEKKHPWHNASPKIKVTHENG-FYHMNIELTVGLPPYFLYNFLIDPGSG  106

Query  596  --ENKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
               + R  +N+ +  SRK+L + GPRQ++ +E++           IS++++VD+NR
Sbjct  107  TFRDLRKRRNLMENKSRKILFENGPRQMMRMEKSVACNVFGVYIPISMNLIVDENR  162



>gb|KDO35994.1| hypothetical protein CISIN_1g044713mg, partial [Citrus sinensis]
Length=100

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 57/98 (58%), Gaps = 7/98 (7%)
 Frame = +2

Query  230  DKQNNEIPVDESSERARLSSSVMHPFLSDF----QSKIEKALKSNFKRMRRDGDV--LMS  391
            +K+  +  +D  + + + +  V  P +S F      KI+  LK+  K + +D +    MS
Sbjct  3    EKEETKNTIDVHNNKIKSTPKVFDPAISSFFVQLPHKIQNYLKAPLKGLTKDNETSSTMS  62

Query  392  SFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIK  502
            S +G+ KG+   L VD+E+Q++ W+ENPTWTD PP IK
Sbjct  63   SDLGEGKGSTTALEVDMERQLEHWRENPTWTDQPPIIK  100



>ref|XP_006303770.1| hypothetical protein CARUB_v10011997mg [Capsella rubella]
 gb|EOA36668.1| hypothetical protein CARUB_v10011997mg [Capsella rubella]
Length=272

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 69/113 (61%), Gaps = 14/113 (12%)
 Frame = +2

Query  434  DLEKQMQPWKENP---TWTDHPPEIKVT----VPKGSLCNLNAKVNVGLPPDAVYNIVAD  592
            ++++Q+  W+E+     W D PP++KV     + KG +  ++ +  +GLPP A Y+++ +
Sbjct  47   EMKEQLTLWRESEKKKQWYDPPPKVKVERRNDLVKG-MTTIDMEFTLGLPPQAAYDVLTN  105

Query  593  PENKRVFKNIQ-----KVISRKVLL-DEGPRQVVELEQAAMWKFLWWSGTISV  733
            P+N++  + I+     + ISRKV+  D G  ++V+ ++A  W FL+WSG I +
Sbjct  106  PDNQQYSRIIKGHYLLENISRKVVSPDTGKGKMVQTKKAIGWNFLYWSGAIPI  158



>gb|KDO36897.1| hypothetical protein CISIN_1g034097mg [Citrus sinensis]
 gb|KDO36898.1| hypothetical protein CISIN_1g034097mg [Citrus sinensis]
 gb|KDO36899.1| hypothetical protein CISIN_1g034097mg [Citrus sinensis]
 gb|KDO36900.1| hypothetical protein CISIN_1g034097mg [Citrus sinensis]
Length=104

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 7/99 (7%)
 Frame = +2

Query  230  DKQNNEIPVDESSERARLSSSVMHPFLSDF----QSKIEKALKSNFKRMRRDGD--VLMS  391
            +K+  +  +D  + + + +  V  P +S F      K++  LK+  K + +D +    MS
Sbjct  3    EKEETKNSIDVHNNKIKSTPKVFDPAISSFFVQLPHKVQNYLKAPLKGLTKDNERSSTMS  62

Query  392  SFVGK-KGAFGILXVDLEKQMQPWKENPTWTDHPPEIKV  505
            S  G+ KG+   L VD+E+Q+Q W+ENPTWTD PP IKV
Sbjct  63   SDPGEGKGSPTALEVDMERQLQHWRENPTWTDQPPVIKV  101



>ref|XP_009110095.1| PREDICTED: uncharacterized protein LOC103835660 [Brassica rapa]
Length=301

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 74/118 (63%), Gaps = 12/118 (10%)
 Frame = +2

Query  434  DLEKQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPE-  598
            +L +Q + W    K++P W   PP+I+VT  KG L ++N ++ VG  PD VY+++ +P+ 
Sbjct  59   ELMRQRELWYEAEKKHP-WYVPPPKIRVTNKKG-LYHMNIELTVGTAPDTVYDLMINPKG  116

Query  599  ----NKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSG-TISVHVLVDQNR  757
                N+  ++++ K  SRKV+ + GP++V+ +E+A  +  L  +  +I +H+ +++NR
Sbjct  117  GPFFNREKWRDLMKNTSRKVVKENGPKRVIMVEKAVAYNVLSLTTISIPLHLTMEENR  174



>emb|CDY59740.1| BnaCnng35460D [Brassica napus]
Length=288

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = +2

Query  461  KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPE-----NKRVFKNIQ  625
            +E   W + PP++KVT  KG + ++N ++ +G PP+ +Y  +  P      +++ ++++ 
Sbjct  70   EEKHPWQNPPPKVKVTTKKG-VYHMNLEITLGAPPELIYLWLIHPHGSSFLDEKKWRDLM  128

Query  626  KVISRKVLLDEGPRQVVELEQAAMWKFLWWSGT-ISVHVLVDQNR  757
               S+KVL+++GPR+V ++E++ ++ F   +   I +H++V++NR
Sbjct  129  ITKSKKVLMEDGPREVFKVERSVVYDFFSLTSVRIPLHLIVEENR  173



>emb|CDX87227.1| BnaC09g05420D [Brassica napus]
Length=283

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADP-----ENKRVFKNIQKVISR  640
            W +  P+IKVT   G   ++N ++ VGL P+ +Y+I+ DP      + R  +N+ +  SR
Sbjct  65   WHNASPKIKVTHENG-FYHMNIELTVGLAPELLYSILIDPGSGTFRDLRKRRNLMENKSR  123

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KVL + GPRQ+  +E++           IS++++VD+NR
Sbjct  124  KVLFENGPRQMTRVEKSVACNVFGVYIPISMNLIVDENR  162



>emb|CDY41435.1| BnaA08g20370D [Brassica napus]
Length=303

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF--KN---IQKVISR  640
            W + PP++KVT  KG + ++N +V +G  P+  +  + DP +   F  KN   + K I R
Sbjct  75   WHNPPPKVKVTTKKG-VYHMNLEVTIGAAPNMTFFWLTDPGSSSFFDMKNWRVLMKNIKR  133

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGT-ISVHVLVDQN  754
            KVL ++GPR+V+++E+A +  F   +   I +H++V++N
Sbjct  134  KVLTEDGPRRVIKVEKAVVHDFFSLTTIPIPLHLIVEEN  172



>ref|XP_002893299.1| hypothetical protein ARALYDRAFT_313226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69558.1| hypothetical protein ARALYDRAFT_313226 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  620  IQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ++   SRKVL  +GPRQ+V L++A  W FLWWSG   +H++VD N+
Sbjct  75   VKATKSRKVLKKDGPRQIVRLKKAVAWDFLWWSGDFPIHLIVDVNK  120



>ref|XP_010480623.1| PREDICTED: uncharacterized protein LOC104759388 [Camelina sativa]
Length=175

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  542  KVNVGLPPDAVYNIVADPENKRVFK-----NIQKVISRKVLLDEGPRQVVELEQAAMWKF  706
            K+ VG  P++VY + A+P N + FK     N  +   RK+L  +GPR++ E+E+   W F
Sbjct  2    KLTVGRIPESVYLVFANPLNNQYFKEFDGKNFLESKPRKLLRKDGPRRIAEVEKIVSWNF  61

Query  707  LWWSGTISVHVLVDQNR  757
            LW S ++ + ++V+ N+
Sbjct  62   LWLSRSLPIKLIVEDNQ  78



>emb|CDY57833.1| BnaCnng32530D [Brassica napus]
Length=303

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF--KN---IQKVISR  640
            W + PP++KVT  KG + ++N +V +G  P+  +  + DP     F  KN   + + I R
Sbjct  75   WHNPPPKVKVTTKKG-VYHMNLEVTIGAAPEMTFLWLTDPGGSSFFDEKNWRVLMENIKR  133

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGT-ISVHVLVDQN  754
            KVL ++GPR+V+++E+A +  F   +   I +H++V++N
Sbjct  134  KVLTEDGPRRVIKVEKAVVHDFFSLTTIPIPLHLIVEEN  172



>ref|XP_009116772.1| PREDICTED: uncharacterized protein LOC103841936 isoform X1 [Brassica 
rapa]
 ref|XP_009116773.1| PREDICTED: uncharacterized protein LOC103841936 isoform X1 [Brassica 
rapa]
Length=267

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 65/119 (55%), Gaps = 12/119 (10%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKG--SLCNLNAKVNVGLPPDAVYNIVADPE  598
            ++++Q++ W++      + +  P +KV       S  ++  +  +GLPP A Y+++ + +
Sbjct  40   EMKEQLKLWRDANKKEQYHEPSPTVKVHTDHNIDSFSSIEMEFTLGLPPQAAYDVLTNQD  99

Query  599  NKRVFKNIQ-----KVISRKVLLDEG--PRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            NK   + I      K ISRKV  + G   R ++E+++   W FL++SGTI + + V +N
Sbjct  100  NKTYSREINGRPLLKAISRKVTSERGIGNRPILEVDKELSWNFLFFSGTIPIRLYVLEN  158



>ref|XP_009110094.1| PREDICTED: uncharacterized protein LOC103835657 [Brassica rapa]
Length=282

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 68/113 (60%), Gaps = 17/113 (15%)
 Frame = +2

Query  440  EKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADP-------E  598
            E++  PW +NP     PP++KVT  KG + ++N ++ +G  P+  Y  + D        E
Sbjct  70   EEKKHPW-QNP-----PPKVKVTTKKG-VYHMNLEMTIGAAPELTYLWLIDSWGSHFYDE  122

Query  599  NKRVFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGT-ISVHVLVDQN  754
             KR  +++ K IS KVL ++GPR+V+++E+A ++ F   +   I +H++V++N
Sbjct  123  KKR--RDLMKNISIKVLTEDGPRRVIKVEKAVVYDFFSLTSIPIPLHLIVEEN  173



>gb|AAC98020.1| Similar to OBP32pep protein gb|U37698 from Arabidopsis thaliana 
[Arabidopsis thaliana]
Length=225

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  620  IQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            ++   SRKVL  +GPRQ+V L++A  W FLWWSG   ++++VD N+
Sbjct  75   VKATKSRKVLKKDGPRQIVRLKKAVAWDFLWWSGEFPINLIVDVNK  120



>ref|NP_001185073.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30421.1| uncharacterized protein AT1G23690 [Arabidopsis thaliana]
Length=225

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +2

Query  407  KGAFGILXVDLEKQMQPWK---ENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVY  577
            K AF     + +KQ + W+   +   W D PP++KVT  KG LC+++ ++ VGLPP+ VY
Sbjct  42   KRAFYYDKAEAKKQGKLWRAAEKKKPWYDAPPKVKVTTKKG-LCHMHIELTVGLPPEGVY  100

Query  578  NIVADPENKRVFKNIQKVISRKVL  649
            ++ A+P +   F+ I     R++L
Sbjct  101  DLFANPNDFPFFR-IDNETGRELL  123



>emb|CDY72266.1| BnaCnng76800D, partial [Brassica napus]
Length=238

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 64/119 (54%), Gaps = 12/119 (10%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKG--SLCNLNAKVNVGLPPDAVYNIVADPE  598
            + ++Q++ W++      + +  P +KV       S  ++  +  +GLPP A Y+++ + +
Sbjct  10   ETKEQLKLWRDANKKEQYHEPSPTVKVHTDHNIDSFSSIKMEFTLGLPPQAAYDVLTNQD  69

Query  599  NKRVFKNIQ-----KVISRKVLLDEG--PRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            NK   + I      K ISRKV  + G   R ++E+++   W FL++SGTI + + V +N
Sbjct  70   NKTYSREINGRPLLKAISRKVTSERGIGNRPILEVDKELSWNFLFFSGTIPIRLNVLEN  128



>emb|CDY52335.1| BnaA09g38840D [Brassica napus]
Length=267

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 65/119 (55%), Gaps = 12/119 (10%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKG--SLCNLNAKVNVGLPPDAVYNIVADPE  598
            ++++Q++ W++      + +  P +KV       S  ++  +  +GLPP A Y+++ + +
Sbjct  40   EMKEQLKLWRDANKKEQYHEPSPTVKVHTDHNIDSFSSIEMEFTLGLPPQAAYDVLTNQD  99

Query  599  NKRVFKNIQ-----KVISRKVLLDEG--PRQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
            +K   + I      K ISRKV  + G   R ++E+++   W FL++SGTI + + V +N
Sbjct  100  SKTYSREINGRPLLKAISRKVTSERGIGNRPILEVDKELSWNFLFFSGTIPIRLYVLEN  158



>ref|XP_002958776.1| hypothetical protein VOLCADRAFT_108304 [Volvox carteri f. nagariensis]
 gb|EFJ40166.1| hypothetical protein VOLCADRAFT_108304 [Volvox carteri f. nagariensis]
Length=326

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQKVISRKVLLD  655
            W +    I V+   G+L NL  +  +   P  +Y I+ DP    +F++I++   R+VL D
Sbjct  19   WNEKGQTITVSEGNGALYNLTLRAKIDSKPTDIYRILIDPNTVSIFRSIKECTYRRVLED  78

Query  656  EGP-RQVVELEQAAMWKFLWWSGTISVHVLV  745
            +G  R+ +E+   A+ +FL+ S T   H+ V
Sbjct  79   DGKGRRKLEVGHRALTRFLFISVTFETHLHV  109



>gb|KFK39653.1| hypothetical protein AALP_AA3G272000 [Arabis alpina]
Length=146

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  641  KVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            KVL ++GPRQ+  +++   W FLWWSGT+ ++++VD+NR
Sbjct  86   KVLKNDGPRQIAMVKKLLAWDFLWWSGTLPIYLIVDENR  124



>ref|XP_006416078.1| hypothetical protein EUTSA_v10010008mg [Eutrema salsugineum]
 gb|ESQ34431.1| hypothetical protein EUTSA_v10010008mg [Eutrema salsugineum]
Length=252

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 57/93 (61%), Gaps = 9/93 (10%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            + ++Q++ W++      W D PP++KV   +G +C +  ++ +GLPP   Y+I+A P N+
Sbjct  42   ETKEQLRLWRDAEKRAPWHDAPPKVKVATQEG-ICVMEMEMVLGLPPQVAYDILASPNNQ  100

Query  605  ---RVFKN--IQKVISRKVLLDEGPRQVVELEQ  688
               R FKN  + K IS+ V+ ++ P  +VE+E+
Sbjct  101  PYTRNFKNRGLLKNISKNVVSEDEPGPIVEVEK  133



>ref|XP_009110750.1| PREDICTED: uncharacterized protein LOC103836254 [Brassica rapa]
Length=314

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 61/110 (55%), Gaps = 18/110 (16%)
 Frame = +2

Query  476  WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVF--KN----------  619
            W + PP++KVT  KG + ++N +V +G  P+  +  + DP +   F  KN          
Sbjct  75   WHNPPPKVKVTTKKG-VYHMNLEVTIGAAPNMTFFWLTDPGSSSFFDMKNWRVLMVFFSH  133

Query  620  ----IQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGT-ISVHVLVDQN  754
                I+K I RKVL ++G R+V+++E+A +  F   +   I +H++V++N
Sbjct  134  HIIVIKKNIKRKVLTEDGTRRVIKVEKAVVHDFFSLTTIPIPLHLIVEEN  183



>ref|XP_002893301.1| hypothetical protein ARALYDRAFT_889909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69560.1| hypothetical protein ARALYDRAFT_889909 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score = 41.6 bits (96),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +2

Query  434  DLEKQMQPWKENPT---WTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENK  604
            +++KQ+Q W E      W D PP++KVT  KG L +++ ++  G  P++VY + A+P N 
Sbjct  46   EVDKQVQLWIEEDKKYPWKDAPPKVKVTRKKG-LYHMHIELTKGRVPESVYLLFANPLNN  104

Query  605  RVFKNI  622
            + F++ 
Sbjct  105  QYFQDF  110


 Score = 32.0 bits (71),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (55%), Gaps = 2/44 (5%)
 Frame = +1

Query  628  SNIKEGIA**RPEAGCGTGTSCHVEIPLVVWN--NISACLSGPE  753
              IK+  A    EA CG   SC +EIPLV+W+  N S C   P+
Sbjct  128  KQIKKTFAEGWTEADCGGRESCILEIPLVLWSSPNKSNCRRQPK  171



>emb|CDY70554.1| BnaCnng68830D [Brassica napus]
Length=270

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 62/118 (53%), Gaps = 14/118 (12%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKGS-LCNLNAKVNVGLPPDAVYNIVADPEN  601
            + ++Q++ W++      + + PP +KV     S L ++  +  +GLPP   Y+++ +P+N
Sbjct  41   ETKEQLKLWRDANKKEQYHEPPPTVKVRTHHSSGLSDMKMEFTLGLPPQVAYDVLTNPDN  100

Query  602  KRVFKNIQ-----KVISRKVLLD-----EGPRQVVELEQAAMWKFLWWSGTISVHVLV  745
                + I+     K +SRKV+ +     +G    VE+E    W FL+ SGTI + + V
Sbjct  101  ITYSREIKGRPLLKAVSRKVIPEKDEDYQGSMVDVEVENELSWNFLFLSGTIPIRLNV  158



>gb|KIY98108.1| hypothetical protein MNEG_9855 [Monoraphidium neglectum]
Length=283

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 6/103 (6%)
 Frame = +2

Query  464  ENPT---WTDHPPEIKVTVPKGS--LCNLNAKVNVGLPPDAVYNIVADPENKRVFKNIQK  628
            E PT   W++   ++ V    GS  L +L  +  V   PD VY ++ +P++  +F+ I+ 
Sbjct  12   EVPTVEDWSEKDCKVVVRTTPGSNLLADLVLRAKVDASPDEVYAVLTNPDSHLIFRGIKA  71

Query  629  VISRKVLLDEGP-RQVVELEQAAMWKFLWWSGTISVHVLVDQN  754
             + R+ L D G  R+ + +   A  +FLW   T S  +LV+++
Sbjct  72   TLERRTLEDSGKGRRKLFVHHQAATRFLWLQVTFSTQLLVEED  114



>ref|NP_001077589.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAZ52693.1| expressed protein [Arabidopsis thaliana]
 gb|AEE30411.1| uncharacterized protein AT1G23600 [Arabidopsis thaliana]
Length=224

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  635  SRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLVDQNR  757
            SRK+L  +GPRQ V++++A  W FLW+SG++ ++++V++N+
Sbjct  75   SRKILKKDGPRQTVKVKKAVAWDFLWFSGSLPINLIVNENK  115



>gb|AAZ52692.1| expressed protein [Arabidopsis thaliana]
Length=142

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +2

Query  443  KQMQPW----KENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRV  610
            KQ+  W    K++P W D PP++KVT+ KG LC++N ++ +G+PPD  Y +  +P N   
Sbjct  49   KQLNLWSDAEKKHP-WYDPPPKVKVTMKKG-LCHMNIELTLGVPPDGAYELFINPTNIPF  106

Query  611  F  613
            F
Sbjct  107  F  107



>ref|XP_009115516.1| PREDICTED: uncharacterized protein LOC103840750 isoform X1 [Brassica 
rapa]
 ref|XP_009115517.1| PREDICTED: uncharacterized protein LOC103840750 isoform X1 [Brassica 
rapa]
Length=296

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 62/118 (53%), Gaps = 14/118 (12%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPK--GSLCNLNAKVNVGLPPDAVYNIVADPE  598
            D  +Q++ W++      + + PP +KV +      L  +  +  +GLPP   Y+++ + +
Sbjct  39   DEMEQLKLWRDANKKKQYQEPPPTVKVRIDHKFDGLSRMEMEFILGLPPQTAYDVLTNQD  98

Query  599  NKR---------VFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLV  745
            N+          + K + +V++ +    EG R +V++E+   WKFL+ SGT+ + ++V
Sbjct  99   NESYSREKNDRPLLKAVSRVVTSEKDEGEGHRPIVKVEKELSWKFLFLSGTLPIRLIV  156



>emb|CDY04704.1| BnaC05g18850D [Brassica napus]
Length=297

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 62/118 (53%), Gaps = 14/118 (12%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPK--GSLCNLNAKVNVGLPPDAVYNIVADPE  598
            D  +Q++ W++      + + PP +KV +      L  +  +  +GLPP   Y+++ + +
Sbjct  39   DEMEQLKLWRDANKKEQYQEPPPTVKVRIDHKLDGLSRMEMEFILGLPPQTAYDVLTNQD  98

Query  599  NKR---------VFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLV  745
            N+          + K + ++++ +    EG R +V++E+   WKFL+ SGT+ + ++V
Sbjct  99   NESYSREKNDRPLLKAVSRIVTSEKDEGEGHRPIVKVEKELSWKFLFLSGTLPIRLIV  156



>ref|XP_009115518.1| PREDICTED: uncharacterized protein LOC103840750 isoform X2 [Brassica 
rapa]
 emb|CDY44154.1| BnaA09g30980D [Brassica napus]
Length=275

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 62/118 (53%), Gaps = 14/118 (12%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPK--GSLCNLNAKVNVGLPPDAVYNIVADPE  598
            D  +Q++ W++      + + PP +KV +      L  +  +  +GLPP   Y+++ + +
Sbjct  39   DEMEQLKLWRDANKKKQYQEPPPTVKVRIDHKFDGLSRMEMEFILGLPPQTAYDVLTNQD  98

Query  599  NKR---------VFKNIQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGTISVHVLV  745
            N+          + K + +V++ +    EG R +V++E+   WKFL+ SGT+ + ++V
Sbjct  99   NESYSREKNDRPLLKAVSRVVTSEKDEGEGHRPIVKVEKELSWKFLFLSGTLPIRLIV  156



>ref|XP_009115048.1| PREDICTED: uncharacterized protein LOC103840304 [Brassica rapa]
 emb|CDY02327.1| BnaA09g25750D [Brassica napus]
Length=270

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 64/121 (53%), Gaps = 16/121 (13%)
 Frame = +2

Query  434  DLEKQMQPWKE---NPTWTDHPPEIKVTVPKGS-LCNLNAKVNVGLPPDAVYNIVADPEN  601
            + ++Q++ W++      + + PP +KV     S L ++  +  +GLPP   Y+++ + +N
Sbjct  41   ETKEQLKLWRDANKKEQYHEPPPTVKVRTDHSSGLSDMKMEFTLGLPPQVAYDVLTNQDN  100

Query  602  KRVFKNIQ-----KVISRKVLLD-----EGPRQVVELEQAAMWKFLWWSGTISV--HVLV  745
                + I+     K +SRKV+ +     +G    V++E+   W FL+ SGTI +  HVL 
Sbjct  101  ITYSREIKGRPLLKAVSRKVIPEKDEDYQGSMLDVKVEKELSWNFLFLSGTIPIRLHVLE  160

Query  746  D  748
            D
Sbjct  161  D  161



>emb|CDY57836.1| BnaCnng32560D [Brassica napus]
Length=377

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 62/106 (58%), Gaps = 9/106 (8%)
 Frame = +2

Query  440  EKQMQPWKENPTWTDHPPEIKVTVPKGSLCNLNAKVNVGLPPDAVYNIVADPENKRVFKN  619
            E++  PWK NP     PP++KVT  KG + ++N ++ +G  P+  Y  + D      F +
Sbjct  171  EEKKHPWK-NP-----PPKVKVTTKKG-VYHMNLEMTIGAAPELTYLWLIDSWGSH-FYD  222

Query  620  IQKVISRKVLLDEGPRQVVELEQAAMWKFLWWSGT-ISVHVLVDQN  754
             +K     VL ++GPR+V+++E+A ++ F   +   I +H++V++N
Sbjct  223  EKKRRDLMVLTEDGPRRVIKVEKAVVYDFFSLTSIPIPLHLIVEEN  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470