BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041K15

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98178.1|  unnamed protein product                                394   5e-132   Coffea canephora [robusta coffee]
ref|XP_002273367.1|  PREDICTED: glycerol kinase                         394   9e-132   Vitis vinifera
emb|CAN76048.1|  hypothetical protein VITISV_037711                     390   2e-130   Vitis vinifera
ref|XP_007023296.1|  Actin-like ATPase superfamily protein isoform 3    387   5e-130   
ref|XP_007023295.1|  Actin-like ATPase superfamily protein isoform 2    387   7e-130   
ref|XP_007023294.1|  Actin-like ATPase superfamily protein isoform 1    388   2e-129   
ref|XP_008461141.1|  PREDICTED: glycerol kinase                         387   6e-129   Cucumis melo [Oriental melon]
ref|XP_006492058.1|  PREDICTED: glycerol kinase-like                    386   1e-128   Citrus sinensis [apfelsine]
ref|XP_006427440.1|  hypothetical protein CICLE_v10025360mg             385   3e-128   Citrus clementina [clementine]
ref|XP_004235901.1|  PREDICTED: glycerol kinase                         385   3e-128   Solanum lycopersicum
ref|XP_009758692.1|  PREDICTED: glycerol kinase                         385   4e-128   Nicotiana sylvestris
ref|XP_009593517.1|  PREDICTED: glycerol kinase                         384   4e-128   Nicotiana tomentosiformis
ref|XP_002517681.1|  glycerol kinase, putative                          384   9e-128   Ricinus communis
ref|XP_007215813.1|  hypothetical protein PRUPE_ppa004097mg             384   9e-128   
ref|XP_008228677.1|  PREDICTED: glycerol kinase                         384   1e-127   Prunus mume [ume]
ref|XP_006341400.1|  PREDICTED: glycerol kinase-like                    383   2e-127   Solanum tuberosum [potatoes]
gb|EYU21675.1|  hypothetical protein MIMGU_mgv1a019703mg                382   2e-127   Erythranthe guttata [common monkey flower]
ref|XP_004135863.1|  PREDICTED: glycerol kinase-like                    382   6e-127   Cucumis sativus [cucumbers]
gb|KDP37048.1|  hypothetical protein JCGZ_06104                         381   8e-127   Jatropha curcas
ref|XP_010250262.1|  PREDICTED: glycerol kinase-like                    381   1e-126   Nelumbo nucifera [Indian lotus]
ref|XP_010033977.1|  PREDICTED: glycerol kinase-like                    380   3e-126   
ref|XP_010097187.1|  Glycerol kinase                                    379   5e-126   Morus notabilis
ref|XP_011073388.1|  PREDICTED: glycerol kinase-like                    379   6e-126   Sesamum indicum [beniseed]
ref|XP_010063499.1|  PREDICTED: glycerol kinase                         379   7e-126   Eucalyptus grandis [rose gum]
ref|XP_006385291.1|  glycerol kinase family protein                     376   6e-125   
ref|XP_010429953.1|  PREDICTED: glycerol kinase                         376   1e-124   Camelina sativa [gold-of-pleasure]
ref|NP_001031307.1|  glycerol kinase                                    374   1e-124   Arabidopsis thaliana [mouse-ear cress]
gb|ABK32113.1|  At1g80460                                               375   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178161.1|  glycerol kinase                                       375   3e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39977.1|  BnaC06g40550D                                          374   3e-124   Brassica napus [oilseed rape]
ref|XP_011044862.1|  PREDICTED: glycerol kinase                         374   5e-124   Populus euphratica
ref|XP_009334628.1|  PREDICTED: glycerol kinase-like                    374   5e-124   Pyrus x bretschneideri [bai li]
ref|XP_004506960.1|  PREDICTED: glycerol kinase-like                    374   6e-124   Cicer arietinum [garbanzo]
ref|XP_009106746.1|  PREDICTED: glycerol kinase-like                    374   6e-124   Brassica rapa
emb|CDX87311.1|  BnaA07g35620D                                          374   6e-124   
emb|CDX79385.1|  BnaC06g19180D                                          374   8e-124   
ref|XP_009336317.1|  PREDICTED: glycerol kinase-like                    374   8e-124   Pyrus x bretschneideri [bai li]
ref|XP_008372701.1|  PREDICTED: glycerol kinase                         374   9e-124   Malus domestica [apple tree]
ref|XP_006302136.1|  hypothetical protein CARUB_v10020141mg             370   1e-123   
ref|XP_003604353.1|  Glycerol kinase                                    373   1e-123   Medicago truncatula
gb|KEH28675.1|  glycerol kinase-like protein                            372   1e-123   Medicago truncatula
ref|XP_011081977.1|  PREDICTED: glycerol kinase                         373   2e-123   Sesamum indicum [beniseed]
emb|CDX67948.1|  BnaA07g19880D                                          372   2e-123   
ref|XP_010472924.1|  PREDICTED: glycerol kinase-like isoform X1         372   3e-123   Camelina sativa [gold-of-pleasure]
ref|XP_006389796.1|  hypothetical protein EUTSA_v10018399mg             370   4e-123   
ref|XP_002887828.1|  At1g80460                                          372   4e-123   
ref|XP_010417705.1|  PREDICTED: glycerol kinase-like                    372   4e-123   Camelina sativa [gold-of-pleasure]
ref|XP_009104463.1|  PREDICTED: glycerol kinase                         371   6e-123   
gb|KFK42437.1|  hypothetical protein AALP_AA2G256400                    371   6e-123   Arabis alpina [alpine rockcress]
emb|CDY37598.1|  BnaA02g19720D                                          371   7e-123   Brassica napus [oilseed rape]
ref|XP_004303284.1|  PREDICTED: glycerol kinase-like                    371   1e-122   Fragaria vesca subsp. vesca
ref|XP_010907017.1|  PREDICTED: glycerol kinase                         370   1e-122   Elaeis guineensis
ref|XP_006389795.1|  hypothetical protein EUTSA_v10018399mg             370   2e-122   Eutrema salsugineum [saltwater cress]
ref|XP_006302137.1|  hypothetical protein CARUB_v10020141mg             370   2e-122   Capsella rubella
gb|KHG30375.1|  Glycerol kinase                                         371   2e-122   Gossypium arboreum [tree cotton]
ref|XP_010537930.1|  PREDICTED: glycerol kinase                         368   1e-121   Tarenaya hassleriana [spider flower]
gb|AIT39761.1|  glycerol kinase                                         367   1e-121   Chrysanthemum boreale
gb|KHN01314.1|  Putative glycerol kinase                                367   2e-121   Glycine soja [wild soybean]
gb|EPS68115.1|  hypothetical protein M569_06657                         366   4e-121   Genlisea aurea
ref|XP_006652916.1|  PREDICTED: glycerol kinase-like                    367   5e-121   Oryza brachyantha
gb|KJB66375.1|  hypothetical protein B456_010G138000                    366   6e-121   Gossypium raimondii
ref|XP_007135771.1|  hypothetical protein PHAVU_010G157400g             366   6e-121   Phaseolus vulgaris [French bean]
ref|NP_001237303.1|  glycerol kinase                                    365   1e-120   
gb|AAR88660.1|  glycerol kinase                                         365   2e-120   Pandanus amaryllifolius [pandan rampeh]
ref|XP_010691126.1|  PREDICTED: glycerol kinase                         364   3e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010244913.1|  PREDICTED: glycerol kinase-like                    362   4e-119   Nelumbo nucifera [Indian lotus]
ref|XP_003580683.1|  PREDICTED: glycerol kinase                         362   4e-119   Brachypodium distachyon [annual false brome]
ref|XP_004977029.1|  PREDICTED: glycerol kinase-like                    361   6e-119   Setaria italica
ref|XP_010913342.1|  PREDICTED: glycerol kinase-like                    360   3e-118   Elaeis guineensis
ref|XP_009407371.1|  PREDICTED: glycerol kinase                         359   6e-118   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGH08245.1|  glycerol kinase                                         359   6e-118   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008795833.1|  PREDICTED: glycerol kinase-like                    359   7e-118   Phoenix dactylifera
ref|NP_001132106.2|  uncharacterized protein LOC100193522               355   1e-116   Zea mays [maize]
ref|XP_008779160.1|  PREDICTED: glycerol kinase-like isoform X2         355   2e-116   Phoenix dactylifera
ref|XP_002448637.1|  hypothetical protein SORBIDRAFT_06g030600          352   2e-115   Sorghum bicolor [broomcorn]
gb|AAR18687.1|  glycerol kinase-like protein                            345   1e-112   Oryza sativa Japonica Group [Japonica rice]
gb|EMT01355.1|  Putative glycerol kinase                                345   3e-112   
emb|CAJ86056.1|  H0821G03.7                                             343   6e-112   Oryza sativa [red rice]
ref|NP_001054071.1|  Os04g0647800                                       342   2e-111   
gb|ABK24550.1|  unknown                                                 336   6e-109   Picea sitchensis
ref|XP_002984877.1|  hypothetical protein SELMODRAFT_121015             327   1e-105   Selaginella moellendorffii
gb|ABK25673.1|  unknown                                                 327   2e-105   Picea sitchensis
ref|XP_002985935.1|  hypothetical protein SELMODRAFT_123030             326   3e-105   Selaginella moellendorffii
gb|EMS68114.1|  Glycerol kinase                                         320   1e-103   Triticum urartu
gb|KDO47427.1|  hypothetical protein CISIN_1g0098681mg                  307   2e-98    Citrus sinensis [apfelsine]
ref|XP_001763943.1|  predicted protein                                  290   3e-91    
dbj|BAH56977.1|  AT1G80460                                              283   8e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779159.1|  PREDICTED: glycerol kinase-like isoform X1         283   4e-89    Phoenix dactylifera
ref|XP_006852853.1|  hypothetical protein AMTR_s00033p00197360          280   5e-88    
gb|KIX03908.1|  glycerol kinase                                         258   6e-79    Rhinocladiella mackenziei CBS 650.93
ref|XP_007734806.1|  glycerol kinase                                    255   7e-78    Capronia epimyces CBS 606.96
gb|KIW59223.1|  glycerol kinase                                         254   1e-77    Exophiala xenobiotica
ref|XP_007721505.1|  glycerol kinase                                    253   6e-77    Capronia coronata CBS 617.96
gb|KIW74117.1|  glycerol kinase                                         252   1e-76    Fonsecaea pedrosoi CBS 271.37
gb|KIW53862.1|  glycerol kinase                                         251   3e-76    Exophiala xenobiotica
ref|XP_003072057.1|  glycerol kinase, putative                          250   4e-76    Coccidioides posadasii C735 delta SOWgp
ref|XP_002623248.1|  glycerol kinase                                    250   4e-76    Blastomyces gilchristii SLH14081
gb|KIW41707.1|  glycerol kinase                                         250   4e-76    Exophiala oligosperma
gb|KIX96461.1|  hypothetical protein Z520_07727                         250   5e-76    Fonsecaea multimorphosa CBS 102226
ref|XP_007746125.1|  glycerol kinase                                    250   5e-76    Cladophialophora psammophila CBS 110553
gb|KIW12125.1|  glycerol kinase                                         250   5e-76    Exophiala spinifera
gb|ERS98066.1|  glycerol kinase                                         253   6e-76    Sporothrix schenckii ATCC 58251
gb|KIW39098.1|  glycerol kinase                                         250   7e-76    Exophiala oligosperma
gb|KIW93314.1|  glycerol kinase                                         249   8e-76    Cladophialophora bantiana CBS 173.52
gb|KIH87229.1|  glycerol kinase                                         252   1e-75    Sporothrix brasiliensis 5110
gb|KIW25190.1|  glycerol kinase                                         249   1e-75    Cladophialophora immunda
ref|XP_009154657.1|  glycerol kinase                                    249   1e-75    Exophiala dermatitidis NIH/UT8656
gb|KDO39538.1|  hypothetical protein CISIN_1g0368921mg                  244   1e-75    Citrus sinensis [apfelsine]
gb|EEQ90810.1|  glycerol kinase                                         249   2e-75    Blastomyces dermatitidis ER-3
gb|EAS27500.3|  glycerol kinase                                         249   2e-75    Coccidioides immitis RS
ref|XP_008082000.1|  Actin-like ATPase                                  249   2e-75    Glarea lozoyensis ATCC 20868
gb|KIW13824.1|  glycerol kinase                                         248   2e-75    Exophiala spinifera
gb|KEF63543.1|  glycerol kinase                                         248   2e-75    Exophiala aquamarina CBS 119918
ref|XP_007762002.1|  glycerol kinase                                    248   2e-75    Cladophialophora yegresii CBS 114405
ref|XP_007875438.1|  hypothetical protein PNEG_03356                    248   3e-75    Pneumocystis murina B123
gb|AGM32757.1|  putative glycerol kinase 3-like protein                 239   3e-75    Coptotermes formosanus
ref|XP_002544072.1|  glycerol kinase                                    248   4e-75    Uncinocarpus reesii 1704
gb|KIV83409.1|  glycerol kinase                                         247   9e-75    Exophiala sideris
ref|XP_008730990.1|  glycerol kinase                                    247   9e-75    Cladophialophora carrionii CBS 160.54
gb|EER38708.1|  glycerol kinase                                         247   9e-75    Histoplasma capsulatum H143
ref|XP_009161485.1|  glycerol kinase                                    247   1e-74    Exophiala dermatitidis NIH/UT8656
gb|EEH03542.1|  glycerol kinase                                         247   1e-74    Histoplasma capsulatum G186AR
emb|CCJ30886.1|  unnamed protein product                                246   1e-74    Pneumocystis jirovecii
gb|EGC47863.1|  glycerol kinase                                         246   1e-74    Histoplasma capsulatum H88
ref|XP_002792127.1|  glycerol kinase                                    246   2e-74    Paracoccidioides lutzii Pb01
gb|KIX09632.1|  glycerol kinase                                         246   2e-74    Rhinocladiella mackenziei CBS 650.93
ref|XP_005702903.1|  glycerol kinase                                    245   3e-74    Galdieria sulphuraria
ref|XP_007722970.1|  glycerol kinase                                    246   3e-74    Capronia coronata CBS 617.96
gb|KFH62786.1|  glycerol kinase                                         246   3e-74    Mortierella verticillata NRRL 6337
gb|KIW30265.1|  glycerol kinase                                         246   4e-74    Cladophialophora immunda
ref|XP_004336510.1|  glycerol kinase                                    246   6e-74    Acanthamoeba castellanii str. Neff
ref|XP_008715149.1|  glycerol kinase                                    245   6e-74    Cyphellophora europaea CBS 101466
gb|ESA10637.1|  hypothetical protein GLOINDRAFT_3264                    244   7e-74    
ref|XP_003053171.1|  hypothetical protein NECHADRAFT_67500              246   7e-74    [Nectria] haematococca mpVI 77-13-4
gb|KIV86319.1|  glycerol kinase                                         245   8e-74    Exophiala sideris
emb|CCX34888.1|  Similar to Glycerol kinase; acc. no. A9WJ21            247   8e-74    Pyronema omphalodes CBS 100304
gb|EHL03740.1|  putative Glycerol kinase                                245   1e-73    Glarea lozoyensis 74030
dbj|GAN02093.1|  conserved hypothetical protein                         244   1e-73    Mucor ambiguus
ref|XP_009257820.1|  hypothetical protein FPSE_06427                    246   1e-73    Fusarium pseudograminearum CS3096
ref|XP_008083904.1|  Actin-like ATPase                                  245   2e-73    Glarea lozoyensis ATCC 20868
gb|KIN04900.1|  hypothetical protein OIDMADRAFT_157379                  245   2e-73    Oidiodendron maius Zn
gb|EZF30633.1|  glycerol kinase                                         238   2e-73    Trichophyton interdigitale H6
gb|KIW80416.1|  glycerol kinase                                         244   2e-73    Fonsecaea pedrosoi CBS 271.37
ref|XP_006679867.1|  hypothetical protein BATDEDRAFT_25739              236   3e-73    Batrachochytrium dendrobatidis JAM81
gb|KEF52126.1|  glycerol kinase                                         243   3e-73    Exophiala aquamarina CBS 119918
gb|KIX93773.1|  hypothetical protein Z520_10397                         243   3e-73    Fonsecaea multimorphosa CBS 102226
ref|XP_010761524.1|  glycerol kinase                                    243   3e-73    Paracoccidioides brasiliensis Pb18
ref|WP_038679022.1|  glycerol kinase                                    243   4e-73    Pimelobacter simplex
gb|EPB83489.1|  glycerol kinase                                         242   5e-73    Mucor circinelloides f. circinelloides 1006PhL
gb|KIW98601.1|  glycerol kinase                                         242   6e-73    Cladophialophora bantiana CBS 173.52
ref|XP_009055569.1|  hypothetical protein LOTGIDRAFT_209470             243   6e-73    Lottia gigantea
gb|ESZ94780.1|  glycerol kinase                                         242   6e-73    Sclerotinia borealis F-4128
gb|KEZ40309.1|  Glycerol kinase 2                                       243   7e-73    Scedosporium apiospermum
gb|KFY31403.1|  hypothetical protein V493_01143                         242   8e-73    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_001796578.1|  hypothetical protein SNOG_06196                    242   1e-72    Parastagonospora nodorum SN15
ref|XP_002843966.1|  glycerol kinase 2                                  241   1e-72    Microsporum canis CBS 113480
ref|WP_016329086.1|  glycerol kinase                                    241   1e-72    Thermus oshimai
ref|WP_011956505.1|  glycerol kinase                                    241   1e-72    Roseiflexus sp. RS-1
gb|EEH23527.1|  glycerol kinase                                         241   1e-72    Paracoccidioides brasiliensis Pb03
ref|XP_007739070.1|  glycerol kinase                                    241   1e-72    Cladophialophora psammophila CBS 110553
ref|XP_002837355.1|  hypothetical protein                               242   2e-72    Tuber melanosporum Mel28
gb|KIW62746.1|  glycerol kinase                                         241   2e-72    Phialophora americana
ref|XP_011436346.1|  PREDICTED: glycerol kinase-like isoform X2         241   2e-72    
ref|XP_005091681.1|  PREDICTED: putative glycerol kinase 3-like         242   2e-72    
gb|KFA61070.1|  hypothetical protein S40285_06341                       241   2e-72    Stachybotrys chlorohalonata IBT 40285
ref|WP_020624849.1|  glycerol kinase                                    240   2e-72    Pseudonocardia sp. P2
ref|XP_008327167.1|  PREDICTED: glycerol kinase-like                    241   3e-72    Cynoglossus semilaevis [half-smooth tongue sole]
emb|CCT70018.1|  probable GUT1-glycerol kinase                          242   4e-72    Fusarium fujikuroi IMI 58289
ref|XP_011436344.1|  PREDICTED: glycerol kinase-like isoform X1         241   4e-72    Crassostrea gigas
gb|AIK22411.1|  glycerol kinase                                         239   5e-72    Pimelobacter simplex
ref|XP_005484433.1|  PREDICTED: glycerol kinase isoform X2              240   5e-72    Zonotrichia albicollis
ref|XP_007290490.1|  glycerol kinase                                    241   6e-72    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_005484432.1|  PREDICTED: glycerol kinase isoform X1              240   6e-72    Zonotrichia albicollis
gb|EGD95974.1|  glycerol kinase                                         239   6e-72    Trichophyton tonsurans CBS 112818
ref|XP_007289663.1|  putative glycerol kinase                           243   7e-72    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|ENN76749.1|  hypothetical protein YQE_06814                          239   7e-72    Dendroctonus ponderosae
gb|AEE61761.1|  unknown                                                 239   7e-72    Dendroctonus ponderosae
gb|EFX79590.1|  hypothetical protein DAPPUDRAFT_319506                  240   7e-72    Daphnia pulex
gb|EGE01178.1|  glycerol kinase                                         239   7e-72    Trichophyton equinum CBS 127.97
ref|XP_003845263.1|  similar to glycerol kinase                         240   8e-72    Leptosphaeria maculans JN3
ref|WP_014445904.1|  glycerol kinase                                    239   8e-72    Actinoplanes missouriensis
gb|EEH64510.1|  glycerol kinase                                         239   8e-72    Actinomyces coleocanis DSM 15436
gb|KIV91759.1|  glycerol kinase                                         239   9e-72    Exophiala mesophila
ref|WP_012851581.1|  glycerol kinase                                    239   9e-72    Thermomonospora curvata
ref|NP_001004077.1|  glycerol kinase 2                                  240   1e-71    Rattus norvegicus [brown rat]
ref|WP_012174815.1|  glycerol kinase                                    238   1e-71    Desulfococcus oleovorans
gb|ETE58690.1|  Glycerol kinase                                         232   1e-71    Ophiophagus hannah
gb|AIY17559.2|  Glycerol kinase                                         238   1e-71    Pimelobacter simplex
gb|EPE08983.1|  glycerol kinase                                         241   2e-71    Ophiostoma piceae UAMH 11346
gb|EXK30956.1|  glycerol kinase                                         241   2e-71    Fusarium oxysporum f. sp. melonis 26406
ref|NP_034424.1|  glycerol kinase 2                                     239   2e-71    Mus musculus [mouse]
gb|EGU77732.1|  hypothetical protein FOXB_11754                         241   2e-71    Fusarium oxysporum Fo5176
gb|AFC46723.1|  glycerol kinase                                         233   2e-71    Mycobacterium intracellulare MOTT-02
ref|XP_007761772.1|  glycerol kinase                                    239   2e-71    Cladophialophora yegresii CBS 114405
ref|XP_003237179.1|  glycerol kinase                                    238   2e-71    Trichophyton rubrum CBS 118892
gb|EZF71154.1|  glycerol kinase                                         238   2e-71    Trichophyton soudanense CBS 452.61
gb|EXM09636.1|  glycerol kinase                                         241   2e-71    Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXA40461.1|  glycerol kinase                                         240   2e-71    Fusarium oxysporum f. sp. pisi HDV247
gb|EWG39393.1|  glycerol kinase                                         240   2e-71    Fusarium verticillioides 7600
gb|EWZ39665.1|  glycerol kinase                                         240   2e-71    Fusarium oxysporum Fo47
ref|XP_006442413.1|  hypothetical protein CICLE_v10020202mg             236   2e-71    
emb|CEJ02635.1|  Putative Glycerol kinase                               238   2e-71    Rhizopus microsporus
ref|XP_005303408.1|  PREDICTED: glycerol kinase isoform X3              239   2e-71    Chrysemys picta bellii
gb|EWY88820.1|  glycerol kinase                                         240   2e-71    Fusarium oxysporum FOSC 3-a
ref|XP_011487479.1|  PREDICTED: glycerol kinase-like isoform X1         238   2e-71    Oryzias latipes [Japanese rice fish]
ref|WP_040313060.1|  glycerol kinase                                    238   2e-71    Actinomyces coleocanis
ref|XP_010569615.1|  PREDICTED: glycerol kinase isoform X4              238   2e-71    Haliaeetus leucocephalus
sp|Q63060.1|GLPK_RAT  RecName: Full=Glycerol kinase; Short=GK; Sh...    238   2e-71    Rattus norvegicus [brown rat]
ref|XP_004081419.1|  PREDICTED: glycerol kinase-like isoform X2         238   2e-71    Oryzias latipes [Japanese rice fish]
ref|XP_010569613.1|  PREDICTED: glycerol kinase isoform X2              239   2e-71    Haliaeetus leucocephalus
gb|EZF71155.1|  glycerol kinase                                         238   2e-71    Trichophyton soudanense CBS 452.61
gb|EZF12740.1|  glycerol kinase                                         238   2e-71    Trichophyton rubrum MR850
gb|KDB23476.1|  glycerol kinase                                         238   3e-71    Trichophyton interdigitale MR816
ref|WP_022884044.1|  glycerol kinase                                    238   3e-71    Glaciibacter superstes
ref|XP_005817108.1|  PREDICTED: glycerol kinase-like                    232   3e-71    
ref|NP_077357.2|  glycerol kinase                                       238   3e-71    Rattus norvegicus [brown rat]
dbj|GAD93635.1|  glycerol kinase, putative                              239   3e-71    Byssochlamys spectabilis No. 5
ref|XP_008299996.1|  PREDICTED: glycerol kinase-like                    229   3e-71    Stegastes partitus
ref|WP_025090897.1|  glycerol kinase                                    237   3e-71    Ochrobactrum
ref|XP_005303406.1|  PREDICTED: glycerol kinase isoform X1              239   3e-71    Chrysemys picta bellii
ref|WP_028473143.1|  glycerol kinase                                    238   3e-71    Nocardioides alkalitolerans
ref|WP_015217632.1|  glycerol kinase                                    237   4e-71    Anabaena cylindrica
gb|KDB23477.1|  glycerol kinase                                         237   4e-71    Trichophyton interdigitale MR816
ref|XP_001214980.1|  glycerol kinase 2                                  239   4e-71    Aspergillus terreus NIH2624
ref|XP_005303407.1|  PREDICTED: glycerol kinase isoform X2              238   4e-71    Chrysemys picta bellii
ref|XP_010569612.1|  PREDICTED: glycerol kinase isoform X1              238   4e-71    Haliaeetus leucocephalus
ref|XP_416788.3|  PREDICTED: glycerol kinase isoformX3                  238   4e-71    
ref|XP_010569614.1|  PREDICTED: glycerol kinase isoform X3              238   4e-71    Haliaeetus leucocephalus
emb|CEG63395.1|  Putative Glycerol kinase                               237   4e-71    Rhizopus microsporus
ref|XP_004934697.1|  PREDICTED: glycerol kinase isoform X4              238   4e-71    
gb|EHK44930.1|  hypothetical protein TRIATDRAFT_39628                   237   4e-71    Trichoderma atroviride IMI 206040
ref|WP_027359785.1|  glycerol kinase                                    237   4e-71    Desulforegula conservatrix
ref|XP_005144605.1|  PREDICTED: glycerol kinase isoform X1              238   5e-71    Melopsittacus undulatus
gb|KEY70743.1|  hypothetical protein S7711_03239                        238   5e-71    Stachybotrys chartarum IBT 7711
gb|KFA76269.1|  hypothetical protein S40288_03598                       238   5e-71    Stachybotrys chartarum IBT 40288
ref|XP_005144606.1|  PREDICTED: glycerol kinase isoform X2              238   5e-71    Melopsittacus undulatus
ref|XP_007084972.1|  PREDICTED: glycerol kinase-like isoform X2         237   6e-71    Panthera tigris altaica
ref|XP_005144607.1|  PREDICTED: glycerol kinase isoform X3              238   6e-71    Melopsittacus undulatus
ref|XP_006679513.1|  hypothetical protein BATDEDRAFT_30202              236   6e-71    Batrachochytrium dendrobatidis JAM81
gb|KIW00193.1|  glycerol kinase                                         238   6e-71    Verruconis gallopava
ref|WP_039206505.1|  glycerol kinase                                    237   6e-71    Brevibacterium
ref|XP_006257049.1|  PREDICTED: glycerol kinase isoform X4              238   6e-71    Rattus norvegicus [brown rat]
ref|WP_010231844.1|  glycerol kinase                                    236   7e-71    Pseudonocardia
ref|XP_006257050.1|  PREDICTED: glycerol kinase isoform X6              238   7e-71    Rattus norvegicus [brown rat]
ref|XP_002108430.1|  hypothetical protein TRIADDRAFT_20207              237   7e-71    Trichoplax adhaerens
ref|XP_003640559.2|  PREDICTED: glycerol kinase isoformX2               238   7e-71    Gallus gallus [bantam]
ref|WP_006215657.1|  Glycerol kinase                                    236   8e-71    Kocuria palustris
ref|XP_003640558.2|  PREDICTED: glycerol kinase isoformX1               238   9e-71    Gallus gallus [bantam]
ref|WP_018461519.1|  hypothetical protein                               236   9e-71    Thermus oshimai
gb|EKV13298.1|  Glycerol kinase, putative                               236   1e-70    Penicillium digitatum PHI26
ref|XP_007583629.1|  putative glycerol kinase protein                   238   1e-70    
ref|XP_003717501.1|  glycerol kinase                                    236   1e-70    Magnaporthe oryzae 70-15
ref|XP_008598371.1|  glycerol kinase                                    236   1e-70    Beauveria bassiana ARSEF 2860
ref|XP_006987541.1|  PREDICTED: glycerol kinase-like                    237   1e-70    Peromyscus maniculatus bairdii
ref|XP_006768248.1|  PREDICTED: glycerol kinase-like                    237   1e-70    Myotis davidii
gb|EFX03253.1|  glycerol kinase                                         238   1e-70    Grosmannia clavigera kw1407
ref|WP_006467832.1|  glycerol kinase                                    236   1e-70    Ochrobactrum intermedium
ref|WP_026919229.1|  glycerol kinase                                    236   1e-70    Gordonia shandongensis
ref|WP_025777989.1|  glycerol kinase                                    236   1e-70    Brevibacterium sp. VCM10
gb|KGQ06803.1|  Glycerol kinase                                         236   1e-70    Beauveria bassiana D1-5
ref|WP_030435889.1|  glycerol kinase                                    236   1e-70    Actinoplanes subtropicus
emb|CEI95054.1|  Putative Glycerol kinase                               235   1e-70    Rhizopus microsporus
gb|KFB51593.1|  AGAP006778-PA-like protein                              236   1e-70    Anopheles sinensis
ref|WP_028821303.1|  glycerol kinase                                    236   1e-70    Propionimicrobium lymphophilum
ref|WP_016456919.1|  MULTISPECIES: glycerol kinase                      236   1e-70    Propionimicrobium
gb|EKG13278.1|  Carbohydrate kinase FGGY                                237   1e-70    Macrophomina phaseolina MS6
ref|XP_007084971.1|  PREDICTED: glycerol kinase-like isoform X1         237   1e-70    Panthera tigris altaica
ref|XP_001649900.1|  AAEL004853-PA                                      236   1e-70    Aedes aegypti
ref|WP_021588079.1|  glycerol kinase                                    236   2e-70    Ochrobactrum sp. EGD-AQ16
ref|XP_007430530.1|  PREDICTED: glycerol kinase isoform X2              236   2e-70    
gb|ELQ38941.1|  glycerol kinase                                         239   2e-70    Magnaporthe oryzae Y34
ref|XP_008053562.1|  PREDICTED: glycerol kinase 2-like                  229   2e-70    Carlito syrichta
ref|XP_005037351.1|  PREDICTED: glycerol kinase isoform X4              236   2e-70    Ficedula albicollis
dbj|GAM87358.1|  hypothetical protein ANO11243_053820                   236   2e-70    fungal sp. No.11243
ref|XP_005516767.1|  PREDICTED: glycerol kinase                         236   2e-70    
ref|XP_004989699.1|  hypothetical protein PTSG_09443                    228   2e-70    Salpingoeca rosetta
ref|NP_032220.1|  glycerol kinase isoform 1                             236   2e-70    Mus musculus [mouse]
ref|XP_661520.1|  hypothetical protein AN3916.2                         238   2e-70    Aspergillus nidulans FGSC A4
ref|WP_030529577.1|  glycerol kinase                                    235   2e-70    Phycicoccus jejuensis
emb|CCF45414.1|  glycerol kinase                                        236   2e-70    
ref|WP_030367620.1|  glycerol kinase                                    235   2e-70    
ref|WP_015209401.1|  glycerol kinase                                    235   2e-70    
ref|WP_010079812.1|  glycerol kinase                                    235   3e-70    
ref|XP_008964375.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    236   3e-70    
ref|XP_007430529.1|  PREDICTED: glycerol kinase isoform X1              236   3e-70    
ref|WP_021797488.1|  glycerol kinase                                    235   3e-70    
ref|XP_006975425.1|  PREDICTED: glycerol kinase 2                       236   3e-70    
gb|KFZ18912.1|  hypothetical protein V502_03900                         235   3e-70    
ref|XP_005037348.1|  PREDICTED: glycerol kinase isoform X1              236   3e-70    
ref|WP_009882939.1|  glycerol kinase                                    235   3e-70    
ref|XP_005037349.1|  PREDICTED: glycerol kinase isoform X2              236   3e-70    
ref|WP_013178983.1|  glycerol kinase                                    234   3e-70    
ref|XP_008141779.1|  PREDICTED: glycerol kinase-like                    236   4e-70    
ref|XP_009216069.1|  glycerol kinase                                    237   4e-70    
ref|XP_003172411.1|  glycerol kinase                                    235   4e-70    
emb|CDM35394.1|  Putative glycerol kinase 3                             237   4e-70    
ref|NP_001080640.1|  glycerol kinase                                    236   4e-70    
ref|XP_004587889.1|  PREDICTED: glycerol kinase isoform X2              235   4e-70    
ref|XP_005037350.1|  PREDICTED: glycerol kinase isoform X3              236   4e-70    
dbj|BAE57019.1|  unnamed protein product                                234   4e-70    
ref|NP_001281069.1|  glycerol kinase isoform 4                          236   5e-70    
ref|NP_997609.1|  glycerol kinase isoform 2                             235   5e-70    
gb|EDL29154.1|  glycerol kinase, isoform CRA_a                          235   5e-70    
ref|XP_003793789.1|  PREDICTED: glycerol kinase isoform 3               234   5e-70    
ref|XP_004850116.1|  PREDICTED: glycerol kinase isoform X3              235   6e-70    
ref|XP_750736.1|  glycerol kinase                                       236   6e-70    
gb|KEY82231.1|  glycerol kinase                                         236   6e-70    
ref|WP_035948571.1|  glycerol kinase                                    234   6e-70    
ref|XP_003793788.1|  PREDICTED: glycerol kinase isoform 2               234   6e-70    
ref|XP_005508158.1|  PREDICTED: glycerol kinase                         235   6e-70    
ref|XP_006987588.1|  PREDICTED: glycerol kinase isoform X3              234   6e-70    
ref|XP_006963775.1|  glycerol kinase-like protein                       234   6e-70    
ref|XP_005410185.1|  PREDICTED: glycerol kinase isoform X4              234   7e-70    
ref|XP_004663744.1|  PREDICTED: glycerol kinase isoform X2              234   7e-70    
ref|WP_024936622.1|  glycerol kinase                                    234   7e-70    
ref|XP_005080115.1|  PREDICTED: glycerol kinase isoform X4              234   7e-70    
ref|XP_007785100.1|  glycerol kinase                                    236   7e-70    
dbj|BAC31861.1|  unnamed protein product                                235   7e-70    
ref|XP_003300497.1|  hypothetical protein PTT_11744                     235   7e-70    
gb|KIL91975.1|  hypothetical protein FAVG1_04380                        236   7e-70    
ref|XP_006918341.1|  PREDICTED: glycerol kinase isoform X2              234   7e-70    
ref|XP_004681245.1|  PREDICTED: glycerol kinase 2                       235   7e-70    
ref|XP_008724472.1|  glycerol kinase                                    234   8e-70    
ref|WP_028924103.1|  glycerol kinase                                    234   8e-70    
gb|EHB05478.1|  Glycerol kinase                                         235   8e-70    
gb|ENH81505.1|  glycerol kinase                                         235   8e-70    
ref|WP_037769357.1|  glycerol kinase                                    234   8e-70    
ref|WP_002857756.1|  glycerol kinase                                    234   9e-70    
ref|XP_004587888.1|  PREDICTED: glycerol kinase isoform X1              235   9e-70    
ref|XP_005369796.1|  PREDICTED: glycerol kinase isoform X3              234   9e-70    
ref|WP_026416635.1|  glycerol kinase                                    234   9e-70    
gb|EKG19925.1|  Carbohydrate kinase FGGY                                235   1e-69    
ref|XP_006084678.1|  PREDICTED: glycerol kinase-like                    234   1e-69    
ref|NP_001090867.1|  glycerol kinase                                    235   1e-69    
emb|CEJ80119.1|  Putative Glycerol kinase                               234   1e-69    
ref|XP_001560626.1|  hypothetical protein BC1G_00654                    235   1e-69    
ref|XP_004386289.1|  PREDICTED: glycerol kinase isoform 3               234   1e-69    
ref|XP_004850115.1|  PREDICTED: glycerol kinase isoform X2              234   1e-69    
ref|XP_011383719.1|  PREDICTED: glycerol kinase isoform X3              234   1e-69    
gb|KFZ02369.1|  hypothetical protein V500_00242                         234   1e-69    
ref|XP_004416415.1|  PREDICTED: glycerol kinase isoform 8               232   1e-69    
ref|XP_004430929.1|  PREDICTED: glycerol kinase 2                       234   1e-69    
ref|XP_006151522.1|  PREDICTED: glycerol kinase 2-like                  234   1e-69    
ref|XP_008270708.1|  PREDICTED: glycerol kinase isoform X3              234   1e-69    
dbj|BAE41209.1|  unnamed protein product                                234   1e-69    
emb|CCD51759.1|  similar to glycerol kinase                             235   1e-69    
gb|EMR89696.1|  putative glycerol kinase protein                        235   1e-69    
ref|XP_008270710.1|  PREDICTED: glycerol kinase isoform X5              234   1e-69    
ref|XP_011383720.1|  PREDICTED: glycerol kinase isoform X4              234   1e-69    
ref|XP_011220385.1|  PREDICTED: glycerol kinase isoform X4              234   1e-69    
ref|XP_005337335.1|  PREDICTED: glycerol kinase 2                       234   1e-69    
ref|XP_004850114.1|  PREDICTED: glycerol kinase isoform X1              234   1e-69    
ref|XP_008516757.1|  PREDICTED: glycerol kinase 2                       234   1e-69    
ref|XP_005410183.1|  PREDICTED: glycerol kinase isoform X2              234   1e-69    
ref|XP_008957431.1|  PREDICTED: glycerol kinase                         233   1e-69    
ref|XP_009230026.1|  glycerol kinase                                    234   1e-69    
ref|WP_004946255.1|  glycerol kinase                                    233   1e-69    
ref|XP_008820950.1|  PREDICTED: glycerol kinase                         234   1e-69    
ref|XP_003793787.1|  PREDICTED: glycerol kinase isoform 1               234   1e-69    
gb|EWG48859.1|  glycerol kinase                                         233   1e-69    
ref|XP_001598363.1|  hypothetical protein SS1G_00451                    235   1e-69    
ref|NP_001243862.1|  glycerol kinase 2                                  234   1e-69    
ref|WP_012920815.1|  glycerol kinase                                    233   1e-69    
ref|XP_005410182.1|  PREDICTED: glycerol kinase isoform X1              234   1e-69    
ref|XP_007646701.1|  PREDICTED: glycerol kinase isoform X3              234   1e-69    
ref|XP_003790104.1|  PREDICTED: glycerol kinase 2                       234   1e-69    
ref|XP_005080113.1|  PREDICTED: glycerol kinase isoform X2              234   1e-69    
ref|WP_015623342.1|  glycerol kinase                                    233   1e-69    
gb|KIW77253.1|  glycerol kinase                                         234   2e-69    
ref|WP_014181673.1|  glycerol kinase                                    233   2e-69    
ref|WP_044172405.1|  glycerol kinase                                    233   2e-69    
ref|XP_006918340.1|  PREDICTED: glycerol kinase isoform X1              234   2e-69    
ref|XP_003464785.1|  PREDICTED: glycerol kinase                         234   2e-69    
ref|XP_005080112.1|  PREDICTED: glycerol kinase isoform X1              234   2e-69    
ref|XP_005882680.1|  PREDICTED: glycerol kinase-like                    234   2e-69    
ref|XP_005807877.1|  PREDICTED: glycerol kinase-like                    234   2e-69    
ref|XP_002478964.1|  glycerol kinase, putative                          234   2e-69    
ref|XP_005329225.1|  PREDICTED: glycerol kinase isoform X2              233   2e-69    
ref|XP_006258827.1|  PREDICTED: glycerol kinase                         234   2e-69    
ref|WP_014807545.1|  glycerol kinase                                    233   2e-69    
ref|XP_007813385.1|  glycerol kinase                                    233   2e-69    
ref|XP_003924117.1|  PREDICTED: glycerol kinase isoform X4              233   2e-69    
ref|XP_004663743.1|  PREDICTED: glycerol kinase isoform X1              234   2e-69    
ref|XP_001692205.1|  hypothetical protein CHLREDRAFT_128764             232   2e-69    
ref|XP_004612512.1|  PREDICTED: glycerol kinase                         235   2e-69    
ref|XP_003924118.1|  PREDICTED: glycerol kinase isoform X3              233   2e-69    
gb|KID78011.1|  Glycerol kinase                                         233   2e-69    
gb|EDL96050.1|  rCG36418                                                233   2e-69    
ref|XP_006987586.1|  PREDICTED: glycerol kinase isoform X1              234   2e-69    
ref|XP_003640303.1|  PREDICTED: glycerol kinase isoform X1              234   2e-69    
ref|XP_001819021.2|  glycerol kinase                                    235   2e-69    
ref|XP_005641284.1|  PREDICTED: glycerol kinase isoform X4              234   2e-69    
ref|XP_006987587.1|  PREDICTED: glycerol kinase isoform X2              234   2e-69    
ref|WP_041104831.1|  glycerol kinase                                    233   2e-69    
ref|XP_008284277.1|  PREDICTED: glycerol kinase-like isoform X2         233   2e-69    
ref|XP_005369794.1|  PREDICTED: glycerol kinase isoform X1              234   2e-69    
ref|XP_005369795.1|  PREDICTED: glycerol kinase isoform X2              234   2e-69    
ref|WP_020621628.1|  glycerol kinase                                    233   2e-69    
ref|XP_002762798.1|  PREDICTED: glycerol kinase isoform X10             233   2e-69    
ref|XP_001364949.1|  PREDICTED: glycerol kinase-like                    234   2e-69    
ref|WP_024894315.1|  glycerol kinase                                    233   2e-69    
emb|CCF44486.1|  glycerol kinase                                        233   2e-69    
ref|WP_044659371.1|  glycerol kinase                                    233   2e-69    
ref|XP_011220384.1|  PREDICTED: glycerol kinase isoform X3              233   2e-69    
ref|XP_001257963.1|  glycerol kinase, putative                          234   2e-69    
ref|NP_000158.1|  glycerol kinase isoform b                             233   2e-69    
ref|XP_003962188.1|  PREDICTED: glycerol kinase-like                    233   2e-69    
ref|WP_020384896.1|  glycerol kinase                                    233   2e-69    
ref|XP_004888693.1|  PREDICTED: glycerol kinase                         235   2e-69    
ref|WP_036315487.1|  glycerol kinase                                    233   2e-69    
ref|WP_036337846.1|  glycerol kinase                                    233   2e-69    
ref|XP_007646699.1|  PREDICTED: glycerol kinase isoform X1              234   2e-69    
ref|WP_014453961.1|  glycerol kinase                                    233   2e-69    
ref|WP_010532995.1|  glycerol kinase                                    233   2e-69    
ref|XP_007646700.1|  PREDICTED: glycerol kinase isoform X2              234   2e-69    
ref|XP_008987365.1|  PREDICTED: glycerol kinase isoform X9              233   2e-69    
ref|XP_004022034.1|  PREDICTED: glycerol kinase isoform 3               233   2e-69    
gb|AAQ02574.1|  glycerol kinase                                         233   2e-69    
ref|XP_007541421.1|  PREDICTED: glycerol kinase isoform X2              234   2e-69    
ref|XP_009232965.1|  PREDICTED: glycerol kinase isoform X3              233   3e-69    
ref|XP_011383718.1|  PREDICTED: glycerol kinase isoform X2              234   3e-69    
ref|XP_005899810.1|  PREDICTED: glycerol kinase isoform X3              233   3e-69    
ref|XP_002815317.2|  PREDICTED: putative glycerol kinase 3              234   3e-69    
ref|WP_029312269.1|  glycerol kinase                                    232   3e-69    
ref|XP_004386288.1|  PREDICTED: glycerol kinase isoform 2               234   3e-69    
ref|NP_976325.1|  glycerol kinase isoform a                             233   3e-69    
ref|XP_011383717.1|  PREDICTED: glycerol kinase isoform X1              234   3e-69    
gb|EPE03807.1|  glycerol kinase                                         233   3e-69    
ref|XP_001488442.3|  PREDICTED: glycerol kinase isoformX1               233   3e-69    
gb|ETN60880.1|  glycerol kinase                                         233   3e-69    
gb|KFA65845.1|  hypothetical protein S40285_04646                       233   3e-69    
ref|XP_004386287.1|  PREDICTED: glycerol kinase isoform 1               233   3e-69    
dbj|GAM40117.1|  glycerol kinase                                        233   3e-69    
gb|KID98996.1|  glycerol kinase                                         233   3e-69    
gb|KID87902.1|  glycerol kinase                                         233   3e-69    
ref|XP_003261230.1|  PREDICTED: glycerol kinase isoform 3               233   3e-69    
ref|XP_007819303.1|  glycerol kinase                                    233   3e-69    
ref|NP_001127474.1|  glycerol kinase                                    233   3e-69    
ref|XP_011220383.1|  PREDICTED: glycerol kinase isoform X2              233   3e-69    
gb|AIC58621.1|  GK3P                                                    233   3e-69    
ref|WP_013677120.1|  glycerol kinase                                    232   3e-69    
sp|Q14409.2|GLPK3_HUMAN  RecName: Full=Putative glycerol kinase 3...    233   3e-69    
dbj|BAF84971.1|  unnamed protein product                                233   3e-69    
ref|WP_030528182.1|  glycerol kinase                                    232   3e-69    
ref|XP_004416414.1|  PREDICTED: glycerol kinase isoform 7               233   3e-69    
ref|XP_005701025.1|  PREDICTED: glycerol kinase isoform X3              233   3e-69    
ref|XP_504821.1|  YALI0F00484p                                          232   3e-69    
ref|WP_030727468.1|  glycerol kinase                                    232   3e-69    
ref|XP_005329224.1|  PREDICTED: glycerol kinase isoform X1              233   3e-69    
ref|XP_007541420.1|  PREDICTED: glycerol kinase isoform X1              233   3e-69    
ref|XP_002917096.1|  PREDICTED: glycerol kinase isoform X1              233   4e-69    
ref|XP_006056353.1|  PREDICTED: glycerol kinase isoform X3              233   4e-69    
ref|XP_006639381.1|  PREDICTED: glycerol kinase-like                    231   4e-69    
ref|WP_037049024.1|  glycerol kinase                                    232   4e-69    
ref|WP_026862827.1|  glycerol kinase                                    232   4e-69    
ref|XP_003774796.1|  PREDICTED: glycerol kinase-like                    233   4e-69    
ref|WP_014059525.1|  glycerol kinase                                    232   4e-69    
ref|WP_019525312.1|  MULTISPECIES: glycerol kinase                      232   4e-69    
ref|XP_008429219.1|  PREDICTED: glycerol kinase isoform X3              231   4e-69    
ref|WP_038037768.1|  glycerol kinase                                    232   4e-69    
gb|EXL75811.1|  glycerol kinase                                         232   4e-69    
ref|XP_003966700.1|  PREDICTED: glycerol kinase-like                    234   4e-69    
ref|WP_020001533.1|  MULTISPECIES: glycerol kinase                      232   4e-69    
ref|WP_006946725.1|  glycerol kinase                                    232   4e-69    
ref|WP_036416524.1|  glycerol kinase                                    226   4e-69    
ref|XP_008838460.1|  PREDICTED: glycerol kinase-like                    233   4e-69    
ref|XP_003924116.1|  PREDICTED: glycerol kinase isoform X2              233   4e-69    
gb|KEY65705.1|  hypothetical protein S7711_07532                        232   4e-69    
ref|XP_010333144.1|  PREDICTED: glycerol kinase isoform X1              233   4e-69    
ref|WP_033273090.1|  MULTISPECIES: glycerol kinase                      232   4e-69    
gb|ETW22828.1|  glycerol kinase                                         226   4e-69    
ref|WP_038570215.1|  glycerol kinase                                    232   4e-69    
gb|EMT71501.1|  Glycerol kinase                                         231   4e-69    
gb|KFA72479.1|  hypothetical protein S40288_08601                       232   4e-69    
ref|XP_006835621.1|  PREDICTED: glycerol kinase-like isoform X3         232   4e-69    
ref|XP_008020290.1|  hypothetical protein SETTUDRAFT_40870              233   5e-69    
gb|EXK28283.1|  glycerol kinase                                         231   5e-69    
ref|XP_005995031.1|  PREDICTED: glycerol kinase isoform X5              232   5e-69    
ref|XP_007493667.1|  PREDICTED: glycerol kinase-like isoform X5         232   5e-69    
ref|WP_037917882.1|  hypothetical protein                               232   5e-69    
ref|XP_007818344.1|  glycerol kinase                                    232   5e-69    
ref|WP_015752519.1|  glycerol kinase                                    232   5e-69    
ref|XP_003917589.1|  PREDICTED: glycerol kinase isoform X3              233   5e-69    
gb|ENH75487.1|  Glycerol kinase                                         231   5e-69    
ref|NP_001233305.1|  glycerol kinase                                    233   5e-69    
ref|XP_003917588.1|  PREDICTED: glycerol kinase isoform X4              233   5e-69    
ref|XP_001267955.1|  glycerol kinase, putative                          234   5e-69    
ref|WP_044276192.1|  glycerol kinase                                    232   5e-69    
ref|WP_031572611.1|  glycerol kinase                                    231   5e-69    
gb|KFG85089.1|  putative glycerol kinase                                232   5e-69    
ref|XP_010356471.1|  PREDICTED: glycerol kinase isoform X6              232   5e-69    
ref|XP_003650464.1|  hypothetical protein THITE_2109948                 233   5e-69    
gb|EHK27069.1|  hypothetical protein TRIVIDRAFT_91895                   232   5e-69    
ref|XP_004435125.1|  PREDICTED: glycerol kinase isoform 4               232   6e-69    
ref|XP_002762799.1|  PREDICTED: glycerol kinase isoform X8              233   6e-69    
ref|XP_005642816.1|  hypothetical protein COCSUDRAFT_20832              232   6e-69    
ref|XP_004000428.1|  PREDICTED: glycerol kinase isoform X2              233   6e-69    
ref|XP_006209480.1|  PREDICTED: glycerol kinase isoform X3              232   6e-69    
ref|XP_008284276.1|  PREDICTED: glycerol kinase-like isoform X1         232   6e-69    
ref|WP_030149055.1|  glycerol kinase                                    231   6e-69    



>emb|CDO98178.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   394 bits (1013),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+VF+GSIDQGTTSTRFIIYDRSA+P+ SHQ+EFTQFYPQAGWVEHDP EIL+SV+VC+S
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDRSAKPIASHQLEFTQFYPQAGWVEHDPNEILESVRVCIS  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATA+GHNV   LKAIG+TNQRETTVVWSKS+G PLYNA+VWMD RT+ ICRKLE+
Sbjct  64   KAIDKATAEGHNVDGGLKAIGLTNQRETTVVWSKSTGRPLYNAVVWMDIRTSPICRKLEQ  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            ELPGGRTHFV+TCGLPISTYFSA+KLLWLLENV+AVKEAVK+GDALFGTIDTWLIWN+TG
Sbjct  124  ELPGGRTHFVDTCGLPISTYFSALKLLWLLENVDAVKEAVKSGDALFGTIDTWLIWNLTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GVG GLHVTD+SNASRTMLMNLKTLDWD PTL+
Sbjct  184  GVGNGLHVTDISNASRTMLMNLKTLDWDKPTLD  216



>ref|XP_002273367.1| PREDICTED: glycerol kinase [Vitis vinifera]
 emb|CBI36391.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   394 bits (1012),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 207/217 (95%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+KE+ VFVGSIDQGTTSTRFIIYDRSA+PV SHQ+EFTQFYP+AGWVEHDP+EIL+SV+
Sbjct  1    MAKED-VFVGSIDQGTTSTRFIIYDRSAQPVGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC+ KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+GLPLY+AIVWMDART+SICR
Sbjct  60   VCIEKAIDKATADGHNVDSGLKAIGLTNQRETTLIWSKSTGLPLYHAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHFVETCGLPISTYFSA+KLLWLLENV+AVK+AV+ GDALFGTIDTWLIW
Sbjct  120  KLEKELPGGRTHFVETCGLPISTYFSALKLLWLLENVDAVKKAVEAGDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            NMTGG+  G+HVTDVSNASRTMLMNLKTLDWD PTL+
Sbjct  180  NMTGGLNGGVHVTDVSNASRTMLMNLKTLDWDKPTLD  216



>emb|CAN76048.1| hypothetical protein VITISV_037711 [Vitis vinifera]
Length=522

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 206/217 (95%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+KE+ VFVGSIDQGTTSTRFIIYDRSA+PV SHQ+EFTQFYP+AGWVEHDP+EIL+SV 
Sbjct  1    MAKED-VFVGSIDQGTTSTRFIIYDRSAQPVGSHQVEFTQFYPEAGWVEHDPMEILESVX  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC+ KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+GLPLY+AIVWMDART+SICR
Sbjct  60   VCIXKAIDKATADGHNVDSGLKAIGLTNQRETTLIWSKSTGLPLYHAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEK+LPGGRTHFVETCGLPISTYFSA+KLLWLLENV+AVK+AV+ GDALFGTIDTWLIW
Sbjct  120  KLEKKLPGGRTHFVETCGLPISTYFSALKLLWLLENVDAVKKAVEAGDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            NMTGG+  G+HVTDVSNASRTMLMNLKTLDWD PTL+
Sbjct  180  NMTGGLNGGVHVTDVSNASRTMLMNLKTLDWDKPTLD  216



>ref|XP_007023296.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY25918.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
Length=448

 Score =   387 bits (993),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKEE VF+GS+DQGTTSTRFIIYD+SARP+ SHQ+EFTQFYP+AGWVEHDP+EIL+SV+
Sbjct  1    MSKEE-VFIGSVDQGTTSTRFIIYDKSARPIGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+S+CR
Sbjct  60   VCIAKALDKATADGHNVDSGLKAIGLTNQRETTLLWSKSTGCPLYNAIVWMDARTSSVCR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHFVE+CGLPISTYFSA+KLLWL+ENV+AVK A+K GDALFGTIDTWLIW
Sbjct  120  KLEKELPGGRTHFVESCGLPISTYFSAVKLLWLMENVDAVKAAIKEGDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG+  GLHVTDVSNASRTMLM+LKTLDWD  TL+
Sbjct  180  NLTGGINGGLHVTDVSNASRTMLMDLKTLDWDKTTLQ  216



>ref|XP_007023295.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY25917.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
Length=450

 Score =   387 bits (993),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKEE VF+GS+DQGTTSTRFIIYD+SARP+ SHQ+EFTQFYP+AGWVEHDP+EIL+SV+
Sbjct  1    MSKEE-VFIGSVDQGTTSTRFIIYDKSARPIGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+S+CR
Sbjct  60   VCIAKALDKATADGHNVDSGLKAIGLTNQRETTLLWSKSTGCPLYNAIVWMDARTSSVCR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHFVE+CGLPISTYFSA+KLLWL+ENV+AVK A+K GDALFGTIDTWLIW
Sbjct  120  KLEKELPGGRTHFVESCGLPISTYFSAVKLLWLMENVDAVKAAIKEGDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG+  GLHVTDVSNASRTMLM+LKTLDWD  TL+
Sbjct  180  NLTGGINGGLHVTDVSNASRTMLMDLKTLDWDKTTLQ  216



>ref|XP_007023294.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY25916.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
Length=522

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKEE VF+GS+DQGTTSTRFIIYD+SARP+ SHQ+EFTQFYP+AGWVEHDP+EIL+SV+
Sbjct  1    MSKEE-VFIGSVDQGTTSTRFIIYDKSARPIGSHQVEFTQFYPEAGWVEHDPMEILESVR  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+S+CR
Sbjct  60   VCIAKALDKATADGHNVDSGLKAIGLTNQRETTLLWSKSTGCPLYNAIVWMDARTSSVCR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHFVE+CGLPISTYFSA+KLLWL+ENV+AVK A+K GDALFGTIDTWLIW
Sbjct  120  KLEKELPGGRTHFVESCGLPISTYFSAVKLLWLMENVDAVKAAIKEGDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG+  GLHVTDVSNASRTMLM+LKTLDWD  TL+
Sbjct  180  NLTGGINGGLHVTDVSNASRTMLMDLKTLDWDKTTLQ  216



>ref|XP_008461141.1| PREDICTED: glycerol kinase [Cucumis melo]
Length=523

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K E VFVGSIDQGTTSTRFIIYDR +RP+ SHQ EFTQFYP+AGWVEHDPVEIL+SVK
Sbjct  1    MAKAEDVFVGSIDQGTTSTRFIIYDRHSRPIGSHQAEFTQFYPEAGWVEHDPVEILESVK  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATA G+NV   LKAIG+TNQRETT+VWSKSSG PL+NAIVWMDART+SICR
Sbjct  61   VCMAKALDKATAAGYNVDNGLKAIGLTNQRETTLVWSKSSGSPLHNAIVWMDARTSSICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKEL GGRTHFV+TCGLPISTYFSA+KL+WL+ENVEAV+E+++ GDALFGTIDTWLIW
Sbjct  121  KLEKELSGGRTHFVDTCGLPISTYFSAVKLIWLMENVEAVRESIEKGDALFGTIDTWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  181  NLTGGVNGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  217



>ref|XP_006492058.1| PREDICTED: glycerol kinase-like [Citrus sinensis]
Length=523

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K ++VF+G+IDQGTTSTRFIIYD  ARP+ SHQ+EFTQFYP+AGWVEH+P+EIL+SV+
Sbjct  1    MAKAKEVFIGAIDQGTTSTRFIIYDHQARPIGSHQVEFTQFYPEAGWVEHEPMEILESVR  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMDART+S+CR
Sbjct  61   VCMAKALDKATADGHNVDSGLKAIGLTNQRETTVLWSKSTGCPLYNAIVWMDARTSSVCR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGG+THF+E  GLPISTYFSA+KLLW++ENV+AVKEA+K GDALFGTIDTWLIW
Sbjct  121  KLEKELPGGKTHFLEAVGLPISTYFSAVKLLWMMENVDAVKEAIKKGDALFGTIDTWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  181  NLTGGVNGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  217



>ref|XP_006427440.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
 gb|ESR40680.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
Length=523

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 203/217 (94%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K ++VF+G+IDQGTTSTRFIIYD  ARP+ SHQ+EFTQFYP+AGWVEH+P+EIL+SV+
Sbjct  1    MAKAKEVFIGAIDQGTTSTRFIIYDHQARPIGSHQVEFTQFYPEAGWVEHEPMEILESVR  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMDART+S+CR
Sbjct  61   VCMAKALDKATADGHNVDSGLKAIGLTNQRETTVLWSKSTGCPLYNAIVWMDARTSSVCR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGG+THF++  GLPISTYFSA+KLLW++ENV+AVKEA+K GDALFGTIDTWLIW
Sbjct  121  KLEKELPGGKTHFLDAVGLPISTYFSAVKLLWMMENVDAVKEAIKKGDALFGTIDTWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  181  NLTGGVNGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  217



>ref|XP_004235901.1| PREDICTED: glycerol kinase [Solanum lycopersicum]
Length=522

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            + +VF+GSIDQGTTSTRFI YDR AR V SHQ+EFTQFYPQAGWVEHDP+EI++SV++C+
Sbjct  3    DSEVFIGSIDQGTTSTRFIFYDRFARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            ++A+DKATA+GHNV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMDART+SICRKLE
Sbjct  63   ARALDKATANGHNVDSGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDARTSSICRKLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NVE + EAVK GDA+FGTIDTWLIWN+T
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVEGLNEAVKKGDAIFGTIDTWLIWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV KGLHVTD+SNASRTMLMNLKTLDWD  TL+
Sbjct  183  GGVEKGLHVTDISNASRTMLMNLKTLDWDKSTLD  216



>ref|XP_009758692.1| PREDICTED: glycerol kinase [Nicotiana sylvestris]
Length=522

 Score =   385 bits (988),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E+VF+GSIDQGTTSTRFIIYDR AR V SHQ+EFTQFYPQAGWVEHDP+EI++SV++C+
Sbjct  3    DEEVFIGSIDQGTTSTRFIIYDRLARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATADGHNV   LKAIG+TNQRETTVVWSKS+GLPLYNAIVWMD RT+SICRKLE
Sbjct  63   AKALDKATADGHNVDSGLKAIGLTNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRKLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NV+ + EAVK GDA+FGTIDTWLIWN+T
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVDGLSEAVKKGDAVFGTIDTWLIWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTDVSNASRTMLMNLKTLDWD  TL+
Sbjct  183  GGVENGLHVTDVSNASRTMLMNLKTLDWDKSTLD  216



>ref|XP_009593517.1| PREDICTED: glycerol kinase [Nicotiana tomentosiformis]
Length=522

 Score =   384 bits (987),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E+VF+GSIDQGTTSTRFIIYDR AR V SHQ+EFTQFYPQAGWVEHDP+EI++SV++C+
Sbjct  3    DEEVFIGSIDQGTTSTRFIIYDRLARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATADGHNV   LKAIG+TNQRETTVVWSKS+GLPLYNAIVWMD RT+SICRKLE
Sbjct  63   AKALDKATADGHNVDSGLKAIGLTNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRKLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NV+ + EAVK GDA+FGTIDTWLIWN+T
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVDGLSEAVKKGDAVFGTIDTWLIWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTDVSNASRTMLMNLKTLDWD  TL+
Sbjct  183  GGVENGLHVTDVSNASRTMLMNLKTLDWDKSTLD  216



>ref|XP_002517681.1| glycerol kinase, putative [Ricinus communis]
 gb|EEF44845.1| glycerol kinase, putative [Ricinus communis]
Length=521

 Score =   384 bits (985),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K+E  F+G+IDQGTTSTRFIIY+R A  + SHQ+EFTQFYPQAGWVEHD +EIL+SVK
Sbjct  1    MAKQEPAFIGAIDQGTTSTRFIIYNRHANSIGSHQVEFTQFYPQAGWVEHDAMEILESVK  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KAVDKATADGHNV  LLKAIG+TNQRETTV+WSKS+G+PLYNAIVWMD RT+SICR
Sbjct  61   VCMAKAVDKATADGHNVDGLLKAIGLTNQRETTVIWSKSTGVPLYNAIVWMDVRTSSICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHF+ETCGLP+STYFSA+K+LWL+ENV+AVKEA+K GDALFGTID+WLIW
Sbjct  121  KLEKELPGGRTHFIETCGLPLSTYFSAVKILWLMENVDAVKEAIKKGDALFGTIDSWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
            N+TGGV  GLHVTDVSNASRTMLMN+KTL+WD PTL
Sbjct  181  NLTGGVKGGLHVTDVSNASRTMLMNIKTLEWDKPTL  216



>ref|XP_007215813.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
 gb|EMJ17012.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
Length=530

 Score =   384 bits (986),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K + VFVGSIDQGTTSTRFIIYDRSARPV SHQ+EFTQFYP+AGWVEHD +EIL+SV+VC
Sbjct  10   KTDDVFVGSIDQGTTSTRFIIYDRSARPVGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++KA+DKATADGHNV   LKAIG+TNQRETT++WSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLIWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            EKEL GGRTHF+ETCGLPISTYFSA+KLLWLLENV+ VKEAVK+GDALFGTIDTWLIWN+
Sbjct  130  EKELSGGRTHFLETCGLPISTYFSALKLLWLLENVDKVKEAVKSGDALFGTIDTWLIWNL  189

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGGV  G+HVTDVSNASRTMLMNLKTL+WD PTL+
Sbjct  190  TGGVKGGIHVTDVSNASRTMLMNLKTLEWDNPTLK  224



>ref|XP_008228677.1| PREDICTED: glycerol kinase [Prunus mume]
Length=530

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K + VFVGSIDQGTTSTRFIIYDRSARP+ SHQ+EFTQFYP+AGWVEHD +EIL+SV+VC
Sbjct  10   KTDDVFVGSIDQGTTSTRFIIYDRSARPIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            EKEL GGRTHF+ETCGLPISTYFSA+KLLWLLENV+ VKEAVK+GDALFGTIDTWLIWN+
Sbjct  130  EKELSGGRTHFLETCGLPISTYFSALKLLWLLENVDKVKEAVKSGDALFGTIDTWLIWNL  189

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGGV  G+HVTDVSNASRTMLMNLKTL+WD PTL+
Sbjct  190  TGGVKGGIHVTDVSNASRTMLMNLKTLEWDNPTLK  224



>ref|XP_006341400.1| PREDICTED: glycerol kinase-like [Solanum tuberosum]
Length=518

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            + +VF+GSIDQGTTSTRFIIYDR AR V SHQ+EFTQFYPQAGWVEHDP+EI++SV++C+
Sbjct  3    DSEVFIGSIDQGTTSTRFIIYDRLARAVGSHQVEFTQFYPQAGWVEHDPMEIVESVRICM  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            ++A+DKATA+GHNV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMDART+SICRKLE
Sbjct  63   ARALDKATANGHNVDSGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDARTSSICRKLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KELPGGRTHFVE+CGLPISTYFSA+KLLWLL+NVE + EAVK GDA+FGTIDTWLIWN+T
Sbjct  123  KELPGGRTHFVESCGLPISTYFSALKLLWLLDNVEGLNEAVKKGDAIFGTIDTWLIWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTD+SNASRTMLMNLKTL+WD  TL+
Sbjct  183  GGVENGLHVTDISNASRTMLMNLKTLEWDKSTLD  216



>gb|EYU21675.1| hypothetical protein MIMGU_mgv1a019703mg [Erythranthe guttata]
Length=510

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+VFVGSIDQGTTSTRFIIYDRSA+PV SHQ+EFTQFYPQ+GWVEHDP EIL+SV++C++
Sbjct  4    EEVFVGSIDQGTTSTRFIIYDRSAKPVGSHQVEFTQFYPQSGWVEHDPTEILESVRLCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAVDKATA GHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMD RT+ ICRKLEK
Sbjct  64   KAVDKATAAGHNVDSGLKAIGLTNQRETTVIWSKSTGSPLYNAIVWMDVRTSPICRKLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            ELPGGRTHF E CGLPISTYFSA+K+LWLLENVEAVK+AV+ GDALFGTIDTWLIWN+TG
Sbjct  124  ELPGGRTHFTEACGLPISTYFSALKVLWLLENVEAVKKAVEKGDALFGTIDTWLIWNLTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G GKGLHVTDVSNASRTMLMNLK LDWD   LE
Sbjct  184  GKGKGLHVTDVSNASRTMLMNLKNLDWDKTILE  216



>ref|XP_004135863.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 ref|XP_004163547.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 gb|KGN45247.1| hypothetical protein Csa_7G432280 [Cucumis sativus]
Length=523

 Score =   382 bits (980),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K E VFVGSIDQGTTS+RFIIYDR +RP+ SHQ EFTQFYP+AGWVEHDPVEIL+SVK
Sbjct  1    MAKAEDVFVGSIDQGTTSSRFIIYDRHSRPIGSHQAEFTQFYPEAGWVEHDPVEILESVK  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATA G+NV   LKAIG+TNQRETT+VWSKS+G PL++AIVWMDART+SICR
Sbjct  61   VCMAKALDKATAAGYNVDNGLKAIGLTNQRETTLVWSKSTGFPLHHAIVWMDARTSSICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKEL GGRTHFV+TCGLPISTYFSA+KL+WL+ENVEAV+E++K  DALFGTIDTWLIW
Sbjct  121  KLEKELSGGRTHFVDTCGLPISTYFSAVKLIWLMENVEAVRESIKKEDALFGTIDTWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  181  NLTGGVNGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  217



>gb|KDP37048.1| hypothetical protein JCGZ_06104 [Jatropha curcas]
Length=523

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K E  F+G+IDQGTTSTRFIIYD+ AR V SHQ+EFTQFYPQAGWVEHDP+EIL+SV+
Sbjct  1    MAKNEPAFIGAIDQGTTSTRFIIYDQHARSVGSHQVEFTQFYPQAGWVEHDPMEILESVR  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            +C++KAVDKATADGHNV   LKAIGITNQRETT+VWSKSSG PL+NAIVWMDART++ICR
Sbjct  61   LCMAKAVDKATADGHNVDGALKAIGITNQRETTLVWSKSSGAPLHNAIVWMDARTSAICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHFVET GLPISTYFSAMK+LWL+ENV+AVK A K GDALFGT+DTWLIW
Sbjct  121  KLEKELPGGRTHFVETSGLPISTYFSAMKILWLMENVDAVKLATKTGDALFGTVDTWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMN+KTLDWD  TL+
Sbjct  181  NLTGGVSGGLHVTDVSNASRTMLMNIKTLDWDKTTLQ  217



>ref|XP_010250262.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=529

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/226 (81%), Positives = 202/226 (89%), Gaps = 10/226 (4%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M K E+ F+GSIDQGTTSTRFIIYD+SARPV SHQIEFTQFYPQAGWVEH+P+EIL+SV+
Sbjct  1    MEKVER-FIGSIDQGTTSTRFIIYDQSARPVGSHQIEFTQFYPQAGWVEHNPMEILESVR  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            +C+ KA+DKAT DGHNV + LKAIG+TNQRETT+VWSKS+GLPLYNAIVWMDARTTSICR
Sbjct  60   ICMEKAIDKATVDGHNVEKGLKAIGLTNQRETTLVWSKSTGLPLYNAIVWMDARTTSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHFVETCGLPISTYFSA+KLLWLLENV AVKEAV  GDALFGT+DTWLIW
Sbjct  120  KLEKELPGGRTHFVETCGLPISTYFSAVKLLWLLENVSAVKEAVGKGDALFGTVDTWLIW  179

Query  604  NMTGGVG---------KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG            G+HVTDVSNASRTMLMNLKTLDWD PTL+
Sbjct  180  NLTGGCEGEDRNQNKITGIHVTDVSNASRTMLMNLKTLDWDRPTLD  225



>ref|XP_010033977.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 ref|XP_010033978.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 gb|KCW53847.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
 gb|KCW53848.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
Length=522

 Score =   380 bits (975),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +EQV+VGS+DQGTTSTRFIIYDR+AR + SHQ+EFTQF P AGWVEHDP+EIL++V+VC+
Sbjct  3    DEQVYVGSLDQGTTSTRFIIYDRNARSIGSHQVEFTQFCPHAGWVEHDPMEILETVRVCM  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KAVDKATADGHNV   LKAIG+TNQRET +VW KS+G PLYNAIVWMDART+SICRKLE
Sbjct  63   AKAVDKATADGHNVDGGLKAIGLTNQRETALVWRKSTGHPLYNAIVWMDARTSSICRKLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KELPGGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVKEA+K GDALFGTIDTWLIWN+T
Sbjct  123  KELPGGRTHFVETCGLPISTYFSAVKLLWLMENVDAVKEAIKEGDALFGTIDTWLIWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GG   GLHVTD SNASRTMLMNLK+L+WD PTLE
Sbjct  183  GGTAGGLHVTDASNASRTMLMNLKSLEWDKPTLE  216



>ref|XP_010097187.1| Glycerol kinase [Morus notabilis]
 gb|EXB67254.1| Glycerol kinase [Morus notabilis]
Length=523

 Score =   379 bits (974),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSK+E+VFVGSIDQGTTSTRFIIYDR A+PV S+Q+EFTQFYP+AGWVEHDP EIL++VK
Sbjct  1    MSKQEEVFVGSIDQGTTSTRFIIYDRFAKPVGSYQVEFTQFYPEAGWVEHDPREILETVK  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++ AV+KATADGH+V   LKAIG+TNQRETT+VWSKS+G PL+NA+VWMD RT+SICR
Sbjct  61   VCIATAVEKATADGHDVKNGLKAIGLTNQRETTLVWSKSTGAPLHNALVWMDVRTSSICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKEL GGR HFVETCGLPISTYFSA+KLLWL+ENV+AVK AV+ GDALFGTIDTWLIW
Sbjct  121  KLEKELSGGRAHFVETCGLPISTYFSAVKLLWLIENVDAVKNAVELGDALFGTIDTWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTL+WD PTLE
Sbjct  181  NLTGGVNGGLHVTDVSNASRTMLMNLKTLEWDKPTLE  217



>ref|XP_011073388.1| PREDICTED: glycerol kinase-like [Sesamum indicum]
Length=522

 Score =   379 bits (973),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            ++VF+GSIDQGTTSTRF IYD +ARPV SHQIEFTQFYPQ+GWVEHDP+EIL+SV++C++
Sbjct  4    DEVFIGSIDQGTTSTRFFIYDSAARPVGSHQIEFTQFYPQSGWVEHDPMEILESVRLCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAVDKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMD RT+S+CRKLEK
Sbjct  64   KAVDKATADGHNVDSGLKAIGLTNQRETTVIWSKSTGCPLYNAIVWMDVRTSSLCRKLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            ELPGG+THF+ETCGLPISTYFSA+K+LWLL+NV+AVKEAVK GDALFGTIDTWLIWN+TG
Sbjct  124  ELPGGKTHFLETCGLPISTYFSALKVLWLLDNVDAVKEAVKKGDALFGTIDTWLIWNLTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G   GLHVTDVSNASRTMLMNLKTLDWD   L+
Sbjct  184  GKENGLHVTDVSNASRTMLMNLKTLDWDATILD  216



>ref|XP_010063499.1| PREDICTED: glycerol kinase [Eucalyptus grandis]
 gb|KCW70740.1| hypothetical protein EUGRSUZ_F03908 [Eucalyptus grandis]
Length=524

 Score =   379 bits (973),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 202/214 (94%), Gaps = 1/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E+V+VGSIDQGTTSTRFI+YDRSAR + SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC+
Sbjct  3    DEEVYVGSIDQGTTSTRFILYDRSARAIASHQVEFTQFYPEAGWVEHDPMEILESVKVCL  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATA+G+NV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMDART+SICRKLE
Sbjct  63   AKAIDKATANGYNVDGGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDARTSSICRKLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            +ELPGGRTHFVETCGLPISTYFSA+KLLWL ENV+AVK A++ GDALFGT+DTWLIWN+T
Sbjct  123  QELPGGRTHFVETCGLPISTYFSAVKLLWLKENVDAVKVAMQKGDALFGTVDTWLIWNLT  182

Query  613  GGV-GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
            GG+ G GLHVTDVSNASRTMLMNLKTLDWD PTL
Sbjct  183  GGINGGGLHVTDVSNASRTMLMNLKTLDWDQPTL  216



>ref|XP_006385291.1| glycerol kinase family protein [Populus trichocarpa]
 gb|ERP63088.1| glycerol kinase family protein [Populus trichocarpa]
Length=519

 Score =   376 bits (966),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  F+GSIDQGT+STRFIIYDR++R V SHQ+EFTQ YPQAGWVEHDP+EIL+SVKVC+
Sbjct  5    KEAAFIGSIDQGTSSTRFIIYDRNSRCVGSHQVEFTQLYPQAGWVEHDPMEILESVKVCM  64

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KAVD A+A+GHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RTTS+CR+LE
Sbjct  65   AKAVDNASAEGHNVDAALKAIGLTNQRETTLVWSKSTGRPLYNAIVWMDVRTTSVCRRLE  124

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KE+PGGRTHFVETCGLPISTYFSAMKL+WL+ENV+AVKE +K  DALFGT+D+WLIWN+T
Sbjct  125  KEMPGGRTHFVETCGLPISTYFSAMKLIWLMENVDAVKEGIKKKDALFGTVDSWLIWNLT  184

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTDVSNASRTMLMNLKTL+WD PTLE
Sbjct  185  GGVKGGLHVTDVSNASRTMLMNLKTLEWDKPTLE  218



>ref|XP_010429953.1| PREDICTED: glycerol kinase [Camelina sativa]
Length=522

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 200/217 (92%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+KE   F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EIL+SVK
Sbjct  1    MAKESG-FIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VKEA+K GDA+FGTIDTWLIW
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKEAIKKGDAIFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            NMTGGV  GLHVTDV+NASRTMLMNLKTL+WD  TL+
Sbjct  180  NMTGGVNGGLHVTDVTNASRTMLMNLKTLNWDQDTLK  216



>ref|NP_001031307.1| glycerol kinase [Arabidopsis thaliana]
 gb|AEE36408.1| glycerol kinase-like protein [Arabidopsis thaliana]
Length=482

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC+
Sbjct  3    KENGFIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVKVCI  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LE
Sbjct  63   AKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+K GDA+FGTIDTWLIWNMT
Sbjct  123  KELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWNMT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GG+  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  183  GGINGGLHVTDVTNASRTMLMNLKTLSWDQDTLK  216



>gb|ABK32113.1| At1g80460 [Arabidopsis thaliana]
Length=522

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC+
Sbjct  3    KENGFIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVKVCI  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LE
Sbjct  63   AKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+K GDA+FGTIDTWLIWNMT
Sbjct  123  KELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWNMT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GG+  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  183  GGINGGLHVTDVTNASRTMLMNLKTLSWDQDTLK  216



>ref|NP_178161.1| glycerol kinase [Arabidopsis thaliana]
 sp|Q9M8L4.1|GLPK_ARATH RecName: Full=Glycerol kinase; Short=Glycerokinase; AltName: 
Full=ATP:glycerol 3-phosphotransferase; AltName: Full=Protein 
GLYCEROL INSENSITIVE 1; AltName: Full=Protein NONHOST RESISTANCE 
TO P. S. PHASEOLICOLA 1 [Arabidopsis thaliana]
 gb|AAF27123.1|AC018849_11 putative glycerol kinase; 69575-71670 [Arabidopsis thaliana]
 gb|AAO61418.1| glycerol kinase [Arabidopsis thaliana]
 dbj|BAH19502.1| AT1G80460 [Arabidopsis thaliana]
 gb|AEE36407.1| glycerol kinase-like protein [Arabidopsis thaliana]
Length=522

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  F+GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC+
Sbjct  3    KENGFIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVKVCI  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LE
Sbjct  63   AKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+K GDA+FGTIDTWLIWNMT
Sbjct  123  KELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWNMT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GG+  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  183  GGINGGLHVTDVTNASRTMLMNLKTLSWDQDTLK  216



>emb|CDY39977.1| BnaC06g40550D [Brassica napus]
Length=522

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAIKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GV  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  184  GVNGGLHVTDVTNASRTMLMNLKTLSWDEDTLK  216



>ref|XP_011044862.1| PREDICTED: glycerol kinase [Populus euphratica]
Length=519

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 194/214 (91%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  F+GSIDQGT+STRFIIYDR  R V SHQ+EFTQ YPQAGWVEHDP+EIL+SVKVC+
Sbjct  5    KEAAFIGSIDQGTSSTRFIIYDRDCRCVGSHQVEFTQLYPQAGWVEHDPMEILESVKVCM  64

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KAVDKA+A+GHNV   LKAIG+TNQRETT+VWSKS+G P YNAIVWMD RTTS+CR+LE
Sbjct  65   AKAVDKASAEGHNVDAALKAIGLTNQRETTLVWSKSTGRPFYNAIVWMDVRTTSVCRRLE  124

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KE+PGGRTHFVETCGLPISTYFSAMKL+WL+ENV+ VKE ++  DALFGT+D+WLIWN+T
Sbjct  125  KEMPGGRTHFVETCGLPISTYFSAMKLIWLMENVDLVKEGIEKKDALFGTVDSWLIWNLT  184

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  185  GGVKGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  218



>ref|XP_009334628.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=530

 Score =   374 bits (961),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 198/215 (92%), Gaps = 0/215 (0%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K ++VF+GSIDQGTTSTRFIIYDRSAR + SHQ+EFTQFYP+AGWVEHD +EIL+SV+VC
Sbjct  10   KPDEVFIGSIDQGTTSTRFIIYDRSARAIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            EKEL GGRTHF ETCGLPISTYFSA+KLLWLLENV+ VKEAV++GDALFGTIDTWLIWN+
Sbjct  130  EKELSGGRTHFAETCGLPISTYFSALKLLWLLENVDNVKEAVQSGDALFGTIDTWLIWNL  189

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGGV  G+HVTDVSNASRTMLMNLKTL+WD   L+
Sbjct  190  TGGVKGGIHVTDVSNASRTMLMNLKTLEWDGTILK  224



>ref|XP_004506960.1| PREDICTED: glycerol kinase-like [Cicer arietinum]
Length=519

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 200/217 (92%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKE   F+GSIDQGT+STRF+IYD+SA+ +  HQ+EFTQFYP+AGWVEHDPVEIL+SVK
Sbjct  1    MSKE-NFFIGSIDQGTSSTRFVIYDKSAKQIGFHQVEFTQFYPEAGWVEHDPVEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KAVDKATADG NV + LKAIG+TNQRETT++WSKS+G+PL+NAIVWMDART SICR
Sbjct  60   VCIAKAVDKATADGFNVDKGLKAIGLTNQRETTLLWSKSTGVPLHNAIVWMDARTASICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGRTHFVE+CGLPISTYFSA+KLLWL+ENV+ VKEA+K GDALFGTIDTWLIW
Sbjct  120  RLEKELSGGRTHFVESCGLPISTYFSALKLLWLMENVDPVKEAIKKGDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTLDWD  TL+
Sbjct  180  NLTGGVKGGLHVTDVSNASRTMLMNLKTLDWDASTLK  216



>ref|XP_009106746.1| PREDICTED: glycerol kinase-like [Brassica rapa]
Length=522

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAMKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GV  GLHVTDV+NASRTMLMNLKTL+WD  TL+
Sbjct  184  GVNGGLHVTDVTNASRTMLMNLKTLNWDEETLK  216



>emb|CDX87311.1| BnaA07g35620D [Brassica napus]
Length=522

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAMKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GV  GLHVTDV+NASRTMLMNLKTL+WD  TL+
Sbjct  184  GVNGGLHVTDVTNASRTMLMNLKTLNWDEETLK  216



>emb|CDX79385.1| BnaC06g19180D [Brassica napus]
Length=522

 Score =   374 bits (959),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVETCGLPISTYFSAMKLLWL+ENV+AVK+A+K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVETCGLPISTYFSAMKLLWLMENVDAVKDAIKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G+  GLHVTDV+NASRTMLMNLKTL WD  T++
Sbjct  184  GINGGLHVTDVTNASRTMLMNLKTLSWDEETIK  216



>ref|XP_009336317.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338517.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338518.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=524

 Score =   374 bits (959),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 198/215 (92%), Gaps = 0/215 (0%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K ++V +GSIDQGTTSTRFIIYDRSAR + SHQ+EFTQFYP+AGWVEHD +EIL+SV+VC
Sbjct  4    KPDEVLIGSIDQGTTSTRFIIYDRSARAIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  63

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  64   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  123

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            EKEL GGRTHFVETCGLPISTYFSA+KLLWLLENV+ VKEAV++GDALFGTIDTWLIWN+
Sbjct  124  EKELSGGRTHFVETCGLPISTYFSALKLLWLLENVDKVKEAVQSGDALFGTIDTWLIWNL  183

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGGV  G+HVTDVSNASRTMLMNLKTL+WD   L+
Sbjct  184  TGGVKGGIHVTDVSNASRTMLMNLKTLEWDSTILK  218



>ref|XP_008372701.1| PREDICTED: glycerol kinase [Malus domestica]
 ref|XP_008372702.1| PREDICTED: glycerol kinase [Malus domestica]
Length=530

 Score =   374 bits (959),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 199/215 (93%), Gaps = 0/215 (0%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K ++V +GSIDQGTTSTRFIIYDRSAR + SHQ+EFTQFYP+AGWVEHD +EIL+SV+VC
Sbjct  10   KPDEVLIGSIDQGTTSTRFIIYDRSARAIGSHQVEFTQFYPEAGWVEHDAMEILESVRVC  69

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++KA+DKATADGHNV   LKAIG+TNQRETT+VWSKS+G PLYNAIVWMD RT+SICRKL
Sbjct  70   MAKALDKATADGHNVDSGLKAIGLTNQRETTLVWSKSTGCPLYNAIVWMDVRTSSICRKL  129

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            EKEL GGRTHFVETCGLPISTYFSA+KLLWLLENV+ VK+AV++GDALFGTIDTWLIWN+
Sbjct  130  EKELSGGRTHFVETCGLPISTYFSALKLLWLLENVDKVKKAVQSGDALFGTIDTWLIWNL  189

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGGV  G+HVTDVSNASRTMLMNLKTL+WD  TL+
Sbjct  190  TGGVKGGIHVTDVSNASRTMLMNLKTLEWDSTTLK  224



>ref|XP_006302136.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35034.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=444

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 198/217 (91%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+KE   ++GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EIL+SVK
Sbjct  1    MAKESG-YIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+T+QRET VVWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETIVVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+++K GDA+FGTIDTWLIW
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDSIKKGDAIFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            NMTGGV  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  180  NMTGGVNGGLHVTDVTNASRTMLMNLKTLSWDHDTLK  216



>ref|XP_003604353.1| Glycerol kinase [Medicago truncatula]
 gb|AES86550.1| glycerol kinase-like protein [Medicago truncatula]
Length=519

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKE+ VF+G+IDQGT+S+RFIIYD+SA+P+ SHQ+EFTQFYPQAGWVEH+P+EIL+SVK
Sbjct  1    MSKED-VFIGAIDQGTSSSRFIIYDKSAQPIGSHQVEFTQFYPQAGWVEHNPMEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KAVDKATA+G NV + LKAIG+TNQRETT+VWSKS+G PL+NA+VWMD RTTS+CR
Sbjct  60   VCITKAVDKATANGFNVDKGLKAIGLTNQRETTLVWSKSTGAPLHNALVWMDVRTTSVCR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGRTHFVE+CGLPISTYFSAMKLLWL+ENV+AVKEA+K  DALFGTIDTWLIW
Sbjct  120  RLEKELSGGRTHFVESCGLPISTYFSAMKLLWLMENVDAVKEAIKKKDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTD SNASRTMLMNLKTL+WD  TL+
Sbjct  180  NLTGGVKGGLHVTDASNASRTMLMNLKTLNWDESTLK  216



>gb|KEH28675.1| glycerol kinase-like protein [Medicago truncatula]
Length=508

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKE+ VF+G+IDQGT+S+RFIIYD+SA+P+ SHQ+EFTQFYPQAGWVEH+P+EIL+SVK
Sbjct  1    MSKED-VFIGAIDQGTSSSRFIIYDKSAQPIGSHQVEFTQFYPQAGWVEHNPMEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KAVDKATA+G NV + LKAIG+TNQRETT+VWSKS+G PL+NA+VWMD RTTS+CR
Sbjct  60   VCITKAVDKATANGFNVDKGLKAIGLTNQRETTLVWSKSTGAPLHNALVWMDVRTTSVCR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGRTHFVE+CGLPISTYFSAMKLLWL+ENV+AVKEA+K  DALFGTIDTWLIW
Sbjct  120  RLEKELSGGRTHFVESCGLPISTYFSAMKLLWLMENVDAVKEAIKKKDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTD SNASRTMLMNLKTL+WD  TL+
Sbjct  180  NLTGGVKGGLHVTDASNASRTMLMNLKTLNWDESTLK  216



>ref|XP_011081977.1| PREDICTED: glycerol kinase [Sesamum indicum]
Length=522

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+VF+GSIDQGTTSTRFIIYDRSARP+ SHQ+EFTQFYPQ+GWVEHDP+EIL+SV+ C++
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDRSARPLASHQVEFTQFYPQSGWVEHDPMEILESVRECIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATA GHNV   LKAIG+TNQRETTVVWS+S+G PL+ AIVWMD RT+SICRKLEK
Sbjct  64   KAIDKATAAGHNVVSGLKAIGLTNQRETTVVWSRSTGCPLHKAIVWMDVRTSSICRKLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGRTHFVE CGLPISTYFSA+KLLWLLENV+AVKEAVK GDALFGTIDTWLIWN+TG
Sbjct  124  ELSGGRTHFVEACGLPISTYFSALKLLWLLENVDAVKEAVKKGDALFGTIDTWLIWNLTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
            G   GLHVTD+SNASRTMLMNLKTL+WD   L
Sbjct  184  GKENGLHVTDLSNASRTMLMNLKTLEWDKTIL  215



>emb|CDX67948.1| BnaA07g19880D [Brassica napus]
Length=522

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAIKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G+  GLHVTDV+NASRTMLMNLKTL WD  T++
Sbjct  184  GINGGLHVTDVTNASRTMLMNLKTLSWDEETIK  216



>ref|XP_010472924.1| PREDICTED: glycerol kinase-like isoform X1 [Camelina sativa]
 ref|XP_010472925.1| PREDICTED: glycerol kinase-like isoform X2 [Camelina sativa]
Length=522

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+KE   ++GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVK
Sbjct  1    MAKESG-YIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VKEA+K GDA+FGTIDTWLIW
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKEAIKKGDAIFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            NMTGGV  GLHVTDV+NASRTMLMNLKTL+WD  TL+
Sbjct  180  NMTGGVNGGLHVTDVTNASRTMLMNLKTLNWDQDTLK  216



>ref|XP_006389796.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27082.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=455

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AV++ +K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVQDGIKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G   GLHVTDV+NASRTMLMNL TLDWD  TL+
Sbjct  184  GANGGLHVTDVTNASRTMLMNLNTLDWDDNTLK  216



>ref|XP_002887828.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64087.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
Length=522

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC+
Sbjct  3    KENGFIGSIDQGTTSTRFIIYDHHARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCI  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LE
Sbjct  63   AKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+K GDA+FGTIDTWLIWNMT
Sbjct  123  KELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWNMT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTDV+NASRTMLMNLKTL+WD  TL+
Sbjct  183  GGVDGGLHVTDVTNASRTMLMNLKTLNWDQDTLK  216



>ref|XP_010417705.1| PREDICTED: glycerol kinase-like [Camelina sativa]
Length=522

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+KE   ++GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVK
Sbjct  1    MAKESG-YIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR
Sbjct  60   VCIAKALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VKEA+K GDA+FGTIDTWLIW
Sbjct  120  RLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKEAIKKGDAIFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            NMTGGV  GLHVTDV+NASRTMLMNLKTL+WD  TL+
Sbjct  180  NMTGGVNGGLHVTDVTNASRTMLMNLKTLNWDQDTLK  216



>ref|XP_009104463.1| PREDICTED: glycerol kinase [Brassica rapa]
 ref|XP_009104464.1| PREDICTED: glycerol kinase [Brassica rapa]
Length=522

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETT+VWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTIVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+A+K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDAIKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G+  GLHVTDV+NASRTMLMNLK+L WD  T++
Sbjct  184  GINGGLHVTDVTNASRTMLMNLKSLSWDEETIK  216



>gb|KFK42437.1| hypothetical protein AALP_AA2G256400 [Arabis alpina]
Length=522

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  F+GS+DQGTTSTRFIIYDR AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC+
Sbjct  3    KENGFIGSVDQGTTSTRFIIYDRDARSVASHQVEFTQFYPEAGWVEHDPMEILESVKVCI  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATA GHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART++ICR+LE
Sbjct  63   AKAIDKATAAGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSAICRRLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+ +K+GDA+FGTIDTWLIWNMT
Sbjct  123  KELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDGIKSGDAIFGTIDTWLIWNMT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  183  GGVNGGLHVTDVTNASRTMLMNLKTLKWDEETLK  216



>emb|CDY37598.1| BnaA02g19720D [Brassica napus]
Length=522

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E  F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYPQAGWVEHDP+EIL+SVKVC++
Sbjct  4    ENGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPQAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KAIDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AVK+ +K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVKDGIKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G   GLHVTDV+NASRTMLMNLKTL WD  T++
Sbjct  184  GSNGGLHVTDVTNASRTMLMNLKTLSWDEDTIK  216



>ref|XP_004303284.1| PREDICTED: glycerol kinase-like [Fragaria vesca subsp. vesca]
Length=522

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 198/217 (91%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKE  V+VGSIDQGTTSTRFIIYDR +R V SHQ+EF Q YP+AGWVEHDP+EIL+SV+
Sbjct  1    MSKE-AVYVGSIDQGTTSTRFIIYDRDSRTVGSHQVEFNQIYPEAGWVEHDPMEILESVR  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADGHN+   LKAIG+TNQRETT++WSKS+G PLYNAIVWMDART+ +CR
Sbjct  60   VCMAKALDKATADGHNIDSGLKAIGLTNQRETTLIWSKSTGSPLYNAIVWMDARTSGVCR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKEL GGRTHF E CGLPISTYFSA+KLLWL+ENV+AVKEA+K+ DALFGTIDTWLIW
Sbjct  120  KLEKELSGGRTHFSEVCGLPISTYFSAVKLLWLMENVDAVKEAIKSEDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG+  G+HVTDVSNASRTMLMNLKTL+WD PTLE
Sbjct  180  NLTGGLNGGVHVTDVSNASRTMLMNLKTLEWDQPTLE  216



>ref|XP_010907017.1| PREDICTED: glycerol kinase [Elaeis guineensis]
Length=521

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+VF+GSIDQGTTSTRFIIYDR A+PV SHQ+EFTQ YP+AGWVEHDP EIL+SV+VC+ 
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDREAKPVASHQVEFTQHYPEAGWVEHDPTEILESVRVCME  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAV+KA A G  V   +KAIG+TNQRETTV+WSKS+GLPLYNAIVWMDART+SIC++LEK
Sbjct  64   KAVEKAAAGGRQVKGRVKAIGLTNQRETTVMWSKSTGLPLYNAIVWMDARTSSICKRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR HFVETCGLPISTYFSA+K+LWL+ENV+AV EAV++GDALFGTIDTWLIWN+TG
Sbjct  124  ELSGGRNHFVETCGLPISTYFSALKILWLMENVDAVGEAVQSGDALFGTIDTWLIWNLTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G G+GLHVTD SNA+RTMLM+LKTLDWD PTLE
Sbjct  184  GCGRGLHVTDCSNAARTMLMDLKTLDWDRPTLE  216



>ref|XP_006389795.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27081.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=522

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC++
Sbjct  4    EKGFIGSIDQGTTSTRFIIYDHDARAVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMDART+SICR+LEK
Sbjct  64   KALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+AV++ +K GDA+FGTIDTWLIWNMTG
Sbjct  124  ELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDAVQDGIKKGDAIFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G   GLHVTDV+NASRTMLMNL TLDWD  TL+
Sbjct  184  GANGGLHVTDVTNASRTMLMNLNTLDWDDNTLK  216



>ref|XP_006302137.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35035.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=522

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E  ++GSIDQGTTSTRFIIYD  ARPV SHQ+EFTQFYP+AGWVEHDP+EIL+SVKVC+
Sbjct  3    KESGYIGSIDQGTTSTRFIIYDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVKVCI  62

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            +KA+DKATADGHNV   LKAIG+T+QRET VVWSKS+GLPL+ AIVWMDART+SICR+LE
Sbjct  63   AKALDKATADGHNVDGGLKAIGLTDQRETIVVWSKSTGLPLHKAIVWMDARTSSICRRLE  122

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            KEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+++K GDA+FGTIDTWLIWNMT
Sbjct  123  KELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDSIKKGDAIFGTIDTWLIWNMT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GGV  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  183  GGVNGGLHVTDVTNASRTMLMNLKTLSWDHDTLK  216



>gb|KHG30375.1| Glycerol kinase [Gossypium arboreum]
Length=550

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 199/225 (88%), Gaps = 1/225 (0%)
 Frame = +1

Query  40   TREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDP  219
            T    ++KMSKE Q F+ SIDQGTTSTRF IYD+SAR + SH +EFTQFYP+AGWVEHDP
Sbjct  21   TNNPQKKKMSKE-QTFIASIDQGTTSTRFFIYDKSARIIGSHHVEFTQFYPEAGWVEHDP  79

Query  220  VEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  399
            +EIL+SV+ C++KA+DKATADG+NV   LKAIG+TNQRET VVWSKS+G PLYNAIVWMD
Sbjct  80   MEILESVRSCMTKALDKATADGYNVDSGLKAIGLTNQRETVVVWSKSTGSPLYNAIVWMD  139

Query  400  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFG  579
             RT+SICRKLEKELPGGRTHFVE+CGLP+STYFSA+KLLWL+EN E V+ A+K GDALFG
Sbjct  140  VRTSSICRKLEKELPGGRTHFVESCGLPLSTYFSAVKLLWLMENKEEVRAAIKKGDALFG  199

Query  580  TIDTWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TIDTWLIWN+TGGV  G+HVTDVSNASRTMLMNLKTLDWD  TL+
Sbjct  200  TIDTWLIWNLTGGVNGGIHVTDVSNASRTMLMNLKTLDWDKETLK  244



>ref|XP_010537930.1| PREDICTED: glycerol kinase [Tarenaya hassleriana]
Length=522

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            ++ F+GSIDQGTTSTRFIIYD  AR V SHQ+EFTQ+YP+AGWVEH+P+EIL+SVK+CV+
Sbjct  4    DKGFIGSIDQGTTSTRFIIYDHHARSVGSHQVEFTQYYPEAGWVEHNPMEILESVKLCVA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAVDKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPLYNAIVWMDART+SIC +LEK
Sbjct  64   KAVDKATADGHNVDAGLKAIGLTDQRETTVVWSKSTGLPLYNAIVWMDARTSSICMRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGRTHFV TCGLPISTYFSA+KL+WL+ENV+AVKEA+K GDALFGTIDTWLIWNMTG
Sbjct  124  ELSGGRTHFVRTCGLPISTYFSALKLIWLMENVDAVKEAIKKGDALFGTIDTWLIWNMTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GV  GLHVTDV+NASRTMLMNL+TL WD   L+
Sbjct  184  GVDGGLHVTDVTNASRTMLMNLRTLSWDNDVLK  216



>gb|AIT39761.1| glycerol kinase, partial [Chrysanthemum boreale]
Length=514

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = +1

Query  91   GSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAVDK  270
            GSIDQGTTSTRFIIYD++A+ + SHQ+EFTQF PQAGWVEHDPVEIL+SVK+C+SKA+DK
Sbjct  1    GSIDQGTTSTRFIIYDKNAQSIGSHQVEFTQFCPQAGWVEHDPVEILESVKMCISKAIDK  60

Query  271  ATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELPGG  450
            ATADG+NV   L AIGITNQRETTVVWSKS+GLPLYNAIVWMD RTTSICR+LE EL GG
Sbjct  61   ATADGYNVDNGLTAIGITNQRETTVVWSKSTGLPLYNAIVWMDVRTTSICRRLETELSGG  120

Query  451  RTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVGKG  630
            +THF+E+CGLPISTYFSA+KLLWLLENV AVKEAVK GDALFGTID+WLIWN+TGGV  G
Sbjct  121  KTHFLESCGLPISTYFSALKLLWLLENVNAVKEAVKKGDALFGTIDSWLIWNLTGGVNNG  180

Query  631  LHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            LHVTDVSNASRTMLMNLK LDWD  TL+
Sbjct  181  LHVTDVSNASRTMLMNLKKLDWDQSTLD  208



>gb|KHN01314.1| Putative glycerol kinase [Glycine soja]
Length=519

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 197/217 (91%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKE+ VFVG+IDQGT+S+RFIIYD     V  H +EFTQFYPQAGWVEHDP+EIL+SVK
Sbjct  1    MSKED-VFVGAIDQGTSSSRFIIYDAKTGVVGCHHVEFTQFYPQAGWVEHDPMEILESVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VCV+KAVDKATADG NV + LKAIG+TNQRETT++WSKS+GLPL+NAIVWMDART+SICR
Sbjct  60   VCVAKAVDKATADGFNVDKGLKAIGLTNQRETTLLWSKSTGLPLHNAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGR HFVE+CGLPISTYFSA+KLLWL+ENV+AVKEA+K  DALFGTIDTWLIW
Sbjct  120  RLEKELSGGRNHFVESCGLPISTYFSALKLLWLMENVDAVKEAIKKKDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTLDWD  TL+
Sbjct  180  NLTGGVNGGLHVTDVSNASRTMLMNLKTLDWDASTLK  216



>gb|EPS68115.1| hypothetical protein M569_06657, partial [Genlisea aurea]
Length=509

 Score =   366 bits (940),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+VFVGSIDQGTTSTRFIIYDR A+P+ SHQ+EFTQFYPQ GWVEHDP+EIL+SV++C++
Sbjct  1    EEVFVGSIDQGTTSTRFIIYDRFAKPIGSHQVEFTQFYPQYGWVEHDPMEILESVRLCIA  60

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKATA+GHNV   LKAIG+TNQRET V+WSKS+GLPLYNA+VWMD RT+SICRKLE+
Sbjct  61   KAIDKATAEGHNVDSGLKAIGLTNQRETAVIWSKSTGLPLYNAVVWMDIRTSSICRKLEQ  120

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR HFVE CGLPISTYFSA+K++WLLENV++VKEAV+  DALFGTID+WLIWNMTG
Sbjct  121  ELSGGRNHFVEACGLPISTYFSALKVMWLLENVDSVKEAVEKEDALFGTIDSWLIWNMTG  180

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G   G+HVTDVSNASRTMLMNLKTLDWD   L+
Sbjct  181  GKNSGVHVTDVSNASRTMLMNLKTLDWDESILK  213



>ref|XP_006652916.1| PREDICTED: glycerol kinase-like [Oryza brachyantha]
Length=538

 Score =   367 bits (942),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 195/226 (86%), Gaps = 9/226 (4%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            ++ EE+V+V SIDQGTTSTRFIIYDR A+PV SHQ+EF Q YP+AGWVEHDP+EI++SVK
Sbjct  8    VAAEEEVYVASIDQGTTSTRFIIYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVK  67

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C++ A+DKAT DGHNV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR
Sbjct  68   TCMANALDKATTDGHNVDAGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICR  127

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LE EL GGRTHFVETCGLPISTYFSA+K+LWL+ENV+AVK AV+ GDALFGTIDTWLIW
Sbjct  128  RLESELSGGRTHFVETCGLPISTYFSALKVLWLIENVDAVKNAVQAGDALFGTIDTWLIW  187

Query  604  NMTGGVGK---------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGVG          G HVTD SNASRTMLMNLK LDWD PTLE
Sbjct  188  NLTGGVGGTDRDGKQVFGQHVTDCSNASRTMLMNLKALDWDKPTLE  233



>gb|KJB66375.1| hypothetical protein B456_010G138000 [Gossypium raimondii]
Length=522

 Score =   366 bits (940),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MSKE Q F+ SIDQGTTSTRF IYD+SAR + SH +EFTQFYP+AGWVEHDP+EIL+SV+
Sbjct  1    MSKE-QTFIASIDQGTTSTRFFIYDKSARIIGSHHVEFTQFYPEAGWVEHDPMEILESVR  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C++KA+DKATADG+NV   LKAIG+TNQRET VVWSKS+G PLYNAIVWMD RT+SICR
Sbjct  60   SCMTKALDKATADGYNVDSGLKAIGLTNQRETVVVWSKSTGSPLYNAIVWMDVRTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KLEKELPGGRTHFVE+CGLP+STYFSA+KLLWL+EN E V+ A+K GDALFGTIDTWLIW
Sbjct  120  KLEKELPGGRTHFVESCGLPLSTYFSAVKLLWLMENKEEVRAAIKKGDALFGTIDTWLIW  179

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  G+HVTDVSNASRTMLMNL+TLDWD  TL+
Sbjct  180  NLTGGVNGGIHVTDVSNASRTMLMNLQTLDWDKATLK  216



>ref|XP_007135771.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
 gb|ESW07765.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
Length=521

 Score =   366 bits (940),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MS E  VFVG+IDQGT+S+RFIIYD + + +  H +EFTQFYPQAGWVEHD  EIL+SVK
Sbjct  1    MSSEGDVFVGAIDQGTSSSRFIIYDTAGKVIGCHHVEFTQFYPQAGWVEHDATEILESVK  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VCV+KAVDKATADG NV + L+AIG+TNQRETTVVWSKSSGLPLYNAIVWMDART+SICR
Sbjct  61   VCVAKAVDKATADGFNVDKGLRAIGLTNQRETTVVWSKSSGLPLYNAIVWMDARTSSICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGR HFVE+CGLPISTYFSA+KLLWL+ENV AVKEA+K  DALFGTID+WLIW
Sbjct  121  RLEKELSGGRNHFVESCGLPISTYFSALKLLWLMENVLAVKEAIKKKDALFGTIDSWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGGV  GLHVTDVSNASRTMLMNLKTL+WD   L+
Sbjct  181  NLTGGVKGGLHVTDVSNASRTMLMNLKTLEWDESVLQ  217



>ref|NP_001237303.1| glycerol kinase [Glycine max]
 gb|AAR86687.1| glycerol kinase [Glycine max]
Length=519

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E VFVG+IDQGT+S+RFIIYD     V  H +EFTQFYPQAGWVEHDP+EIL+SVKVCV+
Sbjct  4    EDVFVGAIDQGTSSSRFIIYDAKTGVVGCHHVEFTQFYPQAGWVEHDPMEILESVKVCVA  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAVDKATADG NV + LKAIG+TNQRETT++WSKS+GLPL+NAIVWMDART+SICR+LEK
Sbjct  64   KAVDKATADGFNVDKGLKAIGLTNQRETTLLWSKSTGLPLHNAIVWMDARTSSICRRLEK  123

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR HFVE+CGLPISTYFSA+KLLWL+ENV+AVKEA+K  DALFGTIDTWLIWN+TG
Sbjct  124  ELSGGRNHFVESCGLPISTYFSALKLLWLMENVDAVKEAIKKKDALFGTIDTWLIWNLTG  183

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GV  GLHVTDVSNASRTMLMNLKTLDWD  TL+
Sbjct  184  GVNGGLHVTDVSNASRTMLMNLKTLDWDASTLK  216



>gb|AAR88660.1| glycerol kinase [Pandanus amaryllifolius]
Length=531

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 198/226 (88%), Gaps = 9/226 (4%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+  ++VFV +IDQGTTSTRFIIYD+ A+ V SHQ+EFTQFYP+AGWVEH+P+EIL+SV+
Sbjct  1    MAGRKEVFVAAIDQGTTSTRFIIYDQDAKAVASHQVEFTQFYPEAGWVEHNPMEILESVR  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATADG+NV   L+AIG+TNQRETTV WSKS+GLPLYNAIVWMD RT+SICR
Sbjct  61   VCMAKALDKATADGYNVDGGLRAIGLTNQRETTVAWSKSTGLPLYNAIVWMDVRTSSICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL GGRTHFVETCGLPISTYFSA+K+LWL+EN+ AVKEA+K GDALFGT+DTWLIW
Sbjct  121  RLEKELSGGRTHFVETCGLPISTYFSALKILWLMENISAVKEAIKLGDALFGTVDTWLIW  180

Query  604  NMTGGVG---------KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG            GLH+TD SNASRTMLMNLKTLDWD PTLE
Sbjct  181  NLTGGCCGVDREQNTVHGLHITDCSNASRTMLMNLKTLDWDHPTLE  226



>ref|XP_010691126.1| PREDICTED: glycerol kinase [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   364 bits (935),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K E  F+GSIDQGTTSTRFIIYD SA+ + SHQIEFTQFYP AGWVEHDP+EIL+SV+
Sbjct  1    MAKSEDTFIGSIDQGTTSTRFIIYDGSAKTIGSHQIEFTQFYPVAGWVEHDPMEILESVR  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            +C++KA+DKATA+GHNV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMD RT+SICR
Sbjct  61   ICITKALDKATAEGHNVDSGLKAIGITNQRETTVIWSKSTGLPLYNAIVWMDVRTSSICR  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEK+L GGR HF  +CGLPISTYFSA KLLWLLENVE V++AVK+GDALFGT+DTWLIW
Sbjct  121  RLEKDLSGGRNHFEPSCGLPISTYFSATKLLWLLENVEPVRDAVKSGDALFGTVDTWLIW  180

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG   G+HVTDVSNASRTMLMNLKTL+WD  TL+
Sbjct  181  NLTGGPKNGVHVTDVSNASRTMLMNLKTLNWDEETLK  217



>ref|XP_010244913.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=541

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 199/228 (87%), Gaps = 10/228 (4%)
 Frame = +1

Query  58   RKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKS  237
            ++M KEE VF+GS+DQGT+STRFIIYD+S RPV SHQIEFTQF  + GWVEH+P+EIL+S
Sbjct  11   KEMEKEE-VFIGSVDQGTSSTRFIIYDQSCRPVASHQIEFTQFCCEDGWVEHNPMEILQS  69

Query  238  VKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSI  417
            V++C+ KA+DKAT DGHNV + LKAIG+TNQRETTVVWSKSSG PLYNAIVW+D RT+SI
Sbjct  70   VRLCMEKAIDKATVDGHNVEKGLKAIGLTNQRETTVVWSKSSGCPLYNAIVWLDVRTSSI  129

Query  418  CRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWL  597
            CR+LE++LPGGRTHFVETCGLPISTYFSA+KLLWLLENV AVK AV  GDALFGTIDTWL
Sbjct  130  CRRLEEDLPGGRTHFVETCGLPISTYFSAVKLLWLLENVTAVKHAVNTGDALFGTIDTWL  189

Query  598  IWNMTGGV----GK-----GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            IWN+TGG     GK     GLHVTDVSNASRTMLMNL+TLDWD  TL+
Sbjct  190  IWNLTGGCDGEDGKHNKMTGLHVTDVSNASRTMLMNLRTLDWDKATLD  237



>ref|XP_003580683.1| PREDICTED: glycerol kinase [Brachypodium distachyon]
Length=531

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 193/220 (88%), Gaps = 6/220 (3%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            EE+V+V SIDQGTTSTRFI+YDR ARPV SHQ+EF Q YP+AGWVEHDP+EI++SV+ C+
Sbjct  7    EEEVYVASIDQGTTSTRFIVYDRHARPVASHQLEFKQHYPEAGWVEHDPMEIMESVRACM  66

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
            + A++KA ADG NV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMD RT+SICR+LE
Sbjct  67   ANALEKAAADGLNVSAGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDVRTSSICRRLE  126

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
             EL GGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVK+AV+ GDALFGTIDTWLIWN+T
Sbjct  127  GELAGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAVRAGDALFGTIDTWLIWNLT  186

Query  613  GGVGK------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GG+G       G HVTD SNASRTMLMNLK LDWD PTL+
Sbjct  187  GGIGGKDGKQIGQHVTDCSNASRTMLMNLKALDWDKPTLK  226



>ref|XP_004977029.1| PREDICTED: glycerol kinase-like [Setaria italica]
Length=523

 Score =   361 bits (927),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 191/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+V+V +IDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+++VKVC+ 
Sbjct  6    EEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIIETVKVCMK  65

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            +AVDKA    +NV   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ +CR+LE 
Sbjct  66   EAVDKAKDGKYNVVAGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPVCRRLES  125

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGRTHFVETCGLPISTYFSA+KLLWL+ENVEAVK+AV+ GDALFGTIDTWLIWN+TG
Sbjct  126  ELSGGRTHFVETCGLPISTYFSALKLLWLMENVEAVKDAVRTGDALFGTIDTWLIWNLTG  185

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GV  G HVTD SNASRTMLMNLKTLDWD PTL+
Sbjct  186  GVAGGKHVTDCSNASRTMLMNLKTLDWDKPTLD  218



>ref|XP_010913342.1| PREDICTED: glycerol kinase-like [Elaeis guineensis]
Length=537

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 194/228 (85%), Gaps = 13/228 (6%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            + E+V+VGSIDQGT+STRF+IYDR A P+ SHQ+EFTQFYP+AGWVE DP+EIL+SVK+C
Sbjct  6    ENEEVYVGSIDQGTSSTRFVIYDREANPIASHQVEFTQFYPEAGWVEQDPMEILESVKMC  65

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
             +KA+DKATADG+NV R LKAIGI NQRETTVVWSKSSGLPL+NAIVWMDART+S+CR+L
Sbjct  66   TAKALDKATADGYNVDRGLKAIGIANQRETTVVWSKSSGLPLHNAIVWMDARTSSVCRRL  125

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            E ELPGG+ HF++TCGLPIST FSA KLLWL+E VEAVK AV+ GDALFGTIDTWLIWN+
Sbjct  126  ESELPGGKNHFLDTCGLPISTCFSATKLLWLMETVEAVKLAVQAGDALFGTIDTWLIWNL  185

Query  610  TGGVGK-------------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGG G              GLHVTD SNASRTMLMNLKTLDWD  TLE
Sbjct  186  TGGCGGDVGAVDEVQHRVYGLHVTDCSNASRTMLMNLKTLDWDESTLE  233



>ref|XP_009407371.1| PREDICTED: glycerol kinase [Musa acuminata subsp. malaccensis]
Length=531

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 198/226 (88%), Gaps = 9/226 (4%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MS  E+ F+GSIDQGTTSTRFIIYDR A+P+ SHQ+EFTQFYP+AGWVEHDP EI++SV+
Sbjct  1    MSGGEEFFIGSIDQGTTSTRFIIYDRHAQPIASHQVEFTQFYPEAGWVEHDPTEIVQSVR  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            VC++KA+DKATA GHNV   L+AIG+TNQRETTV+WS+S+GLPLYNAIVWMDART++IC 
Sbjct  61   VCMAKALDKATAAGHNVDAGLRAIGLTNQRETTVIWSRSTGLPLYNAIVWMDARTSTICH  120

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L ++LPGGR HFV TCGLPISTYFSA+K++WLLENV+ V++AV++GDA+FGTIDTW+IW
Sbjct  121  RLVRDLPGGRDHFVPTCGLPISTYFSALKIMWLLENVDVVRDAVRSGDAMFGTIDTWMIW  180

Query  604  NMTGGVG---------KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG G          GLHVTD SNA+RTMLM+L+TLDWD PTL+
Sbjct  181  NLTGGCGAVDREENPVHGLHVTDCSNAARTMLMDLRTLDWDRPTLD  226



>gb|AGH08245.1| glycerol kinase [Triticum aestivum]
Length=534

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 193/224 (86%), Gaps = 9/224 (4%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K E+V+V SIDQGTTSTRFIIYDR A PV SHQ+EF Q YP+AGWVEHDP+EI++SVKVC
Sbjct  6    KGEEVYVASIDQGTTSTRFIIYDRHASPVASHQLEFKQHYPEAGWVEHDPMEIIESVKVC  65

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++K ++KA A+G NV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMD RT+SICR+L
Sbjct  66   MAKTLEKAAANGLNVDAGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRRL  125

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            E EL GGRTHFVETCGLP+STYFSA+KLLWL+ENV+AVK+AV+ GDALFGTIDTWLIWN+
Sbjct  126  ESELSGGRTHFVETCGLPLSTYFSALKLLWLMENVDAVKDAVRAGDALFGTIDTWLIWNL  185

Query  610  TGGVGK---------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGG+G          G HVTD SNA+RTMLMNLK LDWD PTLE
Sbjct  186  TGGIGGKDRDGKELVGQHVTDCSNAARTMLMNLKALDWDKPTLE  229



>ref|XP_008795833.1| PREDICTED: glycerol kinase-like [Phoenix dactylifera]
Length=538

 Score =   359 bits (921),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 191/224 (85%), Gaps = 13/224 (6%)
 Frame = +1

Query  82   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
            V+VGSIDQGT+STRF+IYDR A+P+ SHQ+EFTQFYP+AGWVE DP+EIL+SVKVC +KA
Sbjct  10   VYVGSIDQGTSSTRFVIYDREAKPIASHQVEFTQFYPEAGWVEQDPMEILESVKVCTAKA  69

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            VDKATADG+NV R LKAIGI NQRETTVVWSKSSGLP ++AIVWMD RT+SICR+LE EL
Sbjct  70   VDKATADGYNVDRGLKAIGIANQRETTVVWSKSSGLPFHHAIVWMDVRTSSICRRLESEL  129

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            PGG+ HF++ CGLPISTYFSA+KLLWL+E VEAVK AV+ GDALFGTID WLIWN+TGG 
Sbjct  130  PGGKNHFLDACGLPISTYFSAIKLLWLMETVEAVKLAVQAGDALFGTIDAWLIWNLTGGC  189

Query  622  GK-------------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G              GLHVTD SNASRTMLMNLKTLDWD PTLE
Sbjct  190  GGDVGAVDQEQHRVYGLHVTDCSNASRTMLMNLKTLDWDKPTLE  233



>ref|NP_001132106.2| uncharacterized protein LOC100193522 [Zea mays]
 gb|ACG42404.1| glycerol kinase [Zea mays]
 gb|ACF80804.2| unknown [Zea mays]
 tpg|DAA35707.1| TPA: glycerol kinase [Zea mays]
Length=523

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K ++V+V +IDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI+++VKVC
Sbjct  4    KGKEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIIETVKVC  63

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            + +AV KA    HNV   LKAIGITNQRETTV+WSKS+G PLYNAIVWMDART+ +CR+L
Sbjct  64   MKEAVGKAKDGKHNVVAGLKAIGITNQRETTVMWSKSTGRPLYNAIVWMDARTSPVCRRL  123

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            E EL GGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVK+AV+ GDALFGTIDTWLIWN+
Sbjct  124  ENELSGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAVRTGDALFGTIDTWLIWNL  183

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
            TGGV  G HVTD SNASRTMLMNLKTLDWD PTL
Sbjct  184  TGGVAGGQHVTDCSNASRTMLMNLKTLDWDKPTL  217



>ref|XP_008779160.1| PREDICTED: glycerol kinase-like isoform X2 [Phoenix dactylifera]
Length=520

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 192/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+VF+GSIDQGTTSTRFIIYDR A+P+ SHQ+EFTQ+YP+A ++  DP EIL+SV+VC+ 
Sbjct  4    EEVFIGSIDQGTTSTRFIIYDREAKPIASHQVEFTQYYPEAEYLT-DPAEILESVRVCME  62

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAV+KA A G  V   LKAIG+TNQRETTV+WSKS+GLPLYNAIVWMDART+SIC++LEK
Sbjct  63   KAVEKAAAGGRKVEGRLKAIGLTNQRETTVMWSKSTGLPLYNAIVWMDARTSSICKRLEK  122

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGR HFVETCGLPISTYFSA+K+LWL+ENV+AV+EAV++GDALFGTIDTW IWN+TG
Sbjct  123  ELSGGRNHFVETCGLPISTYFSALKILWLMENVDAVREAVRSGDALFGTIDTWTIWNLTG  182

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G G+GLH TD SNA+RTMLM+LKTLDWD PTLE
Sbjct  183  GCGRGLHATDCSNAARTMLMDLKTLDWDMPTLE  215



>ref|XP_002448637.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
 gb|EES12965.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
Length=523

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+V+V +IDQGTTSTRFI+YDR A+PV SHQ+EFTQ YP+AGWVEHDP+EI+++V VC++
Sbjct  6    EEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFTQHYPEAGWVEHDPMEIIETVMVCMN  65

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            +AV KA    +NV   LKAIGITNQRETTV+WSKS+G PLYNAIVWMDART+ +CR+LE 
Sbjct  66   EAVGKAKDGKYNVVAGLKAIGITNQRETTVMWSKSTGHPLYNAIVWMDARTSPVCRRLES  125

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            EL GGRTHFVE CGLPISTYFSA+KLLWL+ENV+AVK+A+K GDALFGTIDTWLIWN+TG
Sbjct  126  ELSGGRTHFVERCGLPISTYFSALKLLWLMENVDAVKDAIKTGDALFGTIDTWLIWNLTG  185

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GV  G HVTD SNASRTMLMNLKTLDWD PTL+
Sbjct  186  GVAGGQHVTDCSNASRTMLMNLKTLDWDKPTLD  218



>gb|AAR18687.1| glycerol kinase-like protein [Oryza sativa Japonica Group]
 gb|EAZ32203.1| hypothetical protein OsJ_16410 [Oryza sativa Japonica Group]
Length=529

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 194/222 (87%), Gaps = 9/222 (4%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+V+V SIDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI++SVK+C++
Sbjct  3    EEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKICMA  62

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKA ADGHN+   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR+LE 
Sbjct  63   KALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRLES  122

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            +L GGRTHFVETCGLPISTYFSA+K+LWL+ENV+AVK AV+ GDALFGTIDTWLIWN+TG
Sbjct  123  DLSGGRTHFVETCGLPISTYFSALKVLWLIENVDAVKNAVRAGDALFGTIDTWLIWNLTG  182

Query  616  GVGK---------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G+G          G HVTD SNASRTMLMNLK LDWD PTLE
Sbjct  183  GIGGTDRDGNKVFGHHVTDCSNASRTMLMNLKALDWDKPTLE  224



>gb|EMT01355.1| Putative glycerol kinase [Aegilops tauschii]
Length=561

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 193/251 (77%), Gaps = 36/251 (14%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAG----------------  201
            K E+V+V SIDQGTTSTRFIIYDR A PV SHQ+EF Q YP+AG                
Sbjct  6    KGEEVYVASIDQGTTSTRFIIYDRHASPVASHQLEFKQHYPEAGCDVVSPLGSTDLCLKL  65

Query  202  -----------WVEHDPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVV  348
                       WVEHDP+EI++SVKVC++K ++KA A+G NV   LKAIGITNQRETTVV
Sbjct  66   YLCVCYMILFIWVEHDPMEIIESVKVCMAKTLEKAAANGLNVDAGLKAIGITNQRETTVV  125

Query  349  WSKSSGLPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLE  528
            WSKS+GLPLYNAIVWMD RT+SICR+LE EL GGRTHFVETCGLPISTYFSA+KLLWL+E
Sbjct  126  WSKSTGLPLYNAIVWMDVRTSSICRRLESELSGGRTHFVETCGLPISTYFSALKLLWLME  185

Query  529  NVEAVKEAVKNGDALFGTIDTWLIWNMTGGVGK---------GLHVTDVSNASRTMLMNL  681
            NV+AVK+AV+ GDALFGTIDTWLIWN+TGG+G          G HVTD SNA+RTMLMNL
Sbjct  186  NVDAVKDAVRAGDALFGTIDTWLIWNLTGGIGGKDRDGKELVGQHVTDCSNAARTMLMNL  245

Query  682  KTLDWDXPTLE  714
            K LDWD PTLE
Sbjct  246  KALDWDKPTLE  256



>emb|CAJ86056.1| H0821G03.7 [Oryza sativa Indica Group]
 emb|CAH68428.1| H0811D08.16 [Oryza sativa Indica Group]
Length=529

 Score =   343 bits (880),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 194/222 (87%), Gaps = 9/222 (4%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+V+V SIDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI++SVK+C++
Sbjct  3    EEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKICMA  62

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKA ADGHN+   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR+LE 
Sbjct  63   KALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRLES  122

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            +L GGRTHFV+TCGLPISTYFSA+K+LWL+ENV+AVK AV+ GDALFGTIDTWLIWN+TG
Sbjct  123  DLSGGRTHFVKTCGLPISTYFSALKVLWLIENVDAVKNAVRAGDALFGTIDTWLIWNLTG  182

Query  616  GVGK---------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G+G          G HVTD SNASRTMLMNLK LDWD PTLE
Sbjct  183  GIGGTDRDGNKVFGHHVTDCSNASRTMLMNLKALDWDKPTLE  224



>ref|NP_001054071.1| Os04g0647800 [Oryza sativa Japonica Group]
 dbj|BAF15985.1| Os04g0647800 [Oryza sativa Japonica Group]
Length=529

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 193/222 (87%), Gaps = 9/222 (4%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+V+V SIDQGTTSTRFI+YDR A+PV SHQ+EF Q YP+AGWVEHDP+EI++SVK+C++
Sbjct  3    EEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKICMA  62

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KA+DKA ADGHN+   LKAIGITNQRETTV+WSKS+GLPLYNAIVWMDART+ ICR+LE 
Sbjct  63   KALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRLES  122

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            +L GGRTHFVETCGL ISTYFSA+K+LWL+ENV+AVK AV+ GDALFGTIDTWLIWN+TG
Sbjct  123  DLSGGRTHFVETCGLAISTYFSALKVLWLIENVDAVKNAVRAGDALFGTIDTWLIWNLTG  182

Query  616  GVGK---------GLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G+G          G HVTD SNASRTMLMNLK LDWD PTLE
Sbjct  183  GIGGTDRDGNKVFGHHVTDCSNASRTMLMNLKALDWDKPTLE  224



>gb|ABK24550.1| unknown [Picea sitchensis]
Length=534

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 190/229 (83%), Gaps = 10/229 (4%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E  M KEE   +GSIDQGTTSTRFIIYD+SA+ V +HQ+EFTQ  PQAGWVEHDP+EIL+
Sbjct  2    ESTMEKEE-ALIGSIDQGTTSTRFIIYDQSAKVVAAHQVEFTQICPQAGWVEHDPLEILE  60

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            +VK+C+ +A +KA A G  V   LKAIGITNQRETT+VWS+S+GLPLYNAIVWMDART+S
Sbjct  61   TVKICMQEACEKAKAAGRAVETGLKAIGITNQRETTIVWSRSTGLPLYNAIVWMDARTSS  120

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            ICR+LEKEL  G+ HFVET GLPISTYFSA+KL+WLLE+V+AVK AVKNGDALFGT+D+W
Sbjct  121  ICRRLEKELQNGKNHFVETTGLPISTYFSALKLMWLLESVDAVKTAVKNGDALFGTVDSW  180

Query  595  LIWNMTGGVG---------KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            LIWN+TGG+          +G HVTD SNA+RTMLM+LKTLDW   TLE
Sbjct  181  LIWNLTGGIKGSRKNGTKVQGSHVTDCSNAARTMLMDLKTLDWHASTLE  229



>ref|XP_002984877.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
 gb|EFJ14127.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
Length=519

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 178/210 (85%), Gaps = 2/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FV +IDQGTTSTRFI+YD+ A+PV SHQ+EF Q YPQAGWVEHDP+EILKSVKVC+ + +
Sbjct  7    FVAAIDQGTTSTRFILYDQDAKPVASHQLEFEQIYPQAGWVEHDPLEILKSVKVCMEETL  66

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
            +KA + G +V   +KAIGITNQRET+++WSKS+G PLYNAIVWMD RT+SIC++LE+ L 
Sbjct  67   NKAPSKGLSVA--VKAIGITNQRETSIIWSKSTGKPLYNAIVWMDGRTSSICKRLEENLS  124

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GG  HFVE+CGLPISTYFSA+KLLWLLE V  VK AV  GDALFGT+D+WLIWNMTGG+ 
Sbjct  125  GGSKHFVESCGLPISTYFSALKLLWLLETVPEVKSAVLAGDALFGTVDSWLIWNMTGGIS  184

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             GLHVTD SNA+RTMLMNLKTL WD   LE
Sbjct  185  GGLHVTDCSNAARTMLMNLKTLSWDKGILE  214



>gb|ABK25673.1| unknown [Picea sitchensis]
Length=530

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 187/226 (83%), Gaps = 10/226 (4%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M KEE  F+GSIDQGTTSTRF+IYD+ A+ V +HQ+EFTQ  PQAGWVEHDP+EIL++VK
Sbjct  1    MEKEE-TFIGSIDQGTTSTRFMIYDQYAKVVATHQVEFTQICPQAGWVEHDPLEILETVK  59

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            +C+ +A +KA   G  V   LKAIGITNQRETT+VWS+S+GLPLYNAIVWMDART+SICR
Sbjct  60   ICMQEACEKAKVAGKAVETGLKAIGITNQRETTIVWSRSTGLPLYNAIVWMDARTSSICR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +LEKEL  G+ HFVET GLPISTYFSA+KL+WLLE+V+ VK AVKNGDALFGT+D+WLIW
Sbjct  120  RLEKELQNGKNHFVETTGLPISTYFSALKLMWLLESVDTVKTAVKNGDALFGTVDSWLIW  179

Query  604  NMTGGVG---------KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            N+TGG+          +G HVTD SNA+RTMLM+LKTL+W   TLE
Sbjct  180  NLTGGIKGSRKDGTKVQGSHVTDCSNAARTMLMDLKTLNWHASTLE  225



>ref|XP_002985935.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
 gb|EFJ13112.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
Length=519

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FV +IDQGTTSTRFI+YD+ A+PV SHQ+EF Q YPQAGWVEHDP+EILKSVKVC+ + +
Sbjct  7    FVAAIDQGTTSTRFILYDQDAKPVASHQLEFEQIYPQAGWVEHDPLEILKSVKVCMEETL  66

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
            +KA + G +    +KAIGITNQRET+++WSKS+G PLYNAIVWMD RT+SIC++LE+ L 
Sbjct  67   NKAASKGLSFA--VKAIGITNQRETSIIWSKSTGKPLYNAIVWMDGRTSSICKRLEENLS  124

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GG  HFVE+CGLPISTYFSA+KLLWLLE V  VK AV  GDALFGT+D+WLIWNMTGG+ 
Sbjct  125  GGSKHFVESCGLPISTYFSALKLLWLLETVPEVKSAVLAGDALFGTVDSWLIWNMTGGIS  184

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             GLHVTD SNA+RTMLMNLKTL WD   LE
Sbjct  185  GGLHVTDCSNAARTMLMNLKTLSWDKGILE  214



>gb|EMS68114.1| Glycerol kinase [Triticum urartu]
Length=479

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            KEE+V+V SIDQGTTSTRFIIYDR A PV SHQ+EF Q YP+AGWVEHDP+EI++SVKVC
Sbjct  6    KEEEVYVASIDQGTTSTRFIIYDRHASPVASHQLEFKQHYPEAGWVEHDPMEIMESVKVC  65

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++K ++KA A G NV   LKAIGITNQRETTVVWSKS+GLPLYNAIVWMD RT+SICR+L
Sbjct  66   MAKTLEKAAASGLNVDAGLKAIGITNQRETTVVWSKSTGLPLYNAIVWMDVRTSSICRRL  125

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            E EL GGRTHFVETCGLPISTYFSA+KLLWL+ENV+AVK+AV+ GDALFGTIDTWLIWN+
Sbjct  126  ESELSGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAVRAGDALFGTIDTWLIWNL  185

Query  610  TGGVG  624
            TGG+G
Sbjct  186  TGGIG  190



>gb|KDO47427.1| hypothetical protein CISIN_1g0098681mg, partial [Citrus sinensis]
Length=477

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +1

Query  202  WVEHDPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYN  381
            WVEH+P+EIL+SV+VC++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYN
Sbjct  1    WVEHEPMEILESVRVCMAKALDKATADGHNVDSGLKAIGLTNQRETTVLWSKSTGCPLYN  60

Query  382  AIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKN  561
            AIVWMDART+S+CRKLEKELPGG+THF+E  GLPISTYFSA+KLLW++ENV+AVKEA+K 
Sbjct  61   AIVWMDARTSSVCRKLEKELPGGKTHFLEAVGLPISTYFSAVKLLWMMENVDAVKEAIKK  120

Query  562  GDALFGTIDTWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GDALFGTIDTWLIWN+TGGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  121  GDALFGTIDTWLIWNLTGGVNGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  171



>ref|XP_001763943.1| predicted protein [Physcomitrella patens]
 gb|EDQ71347.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 175/224 (78%), Gaps = 4/224 (2%)
 Frame = +1

Query  49   EGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEI  228
            +GE++   +   +V +IDQGTTSTRFI+YD +A+ VVSHQ+EFTQ YPQAGWVEHDP+EI
Sbjct  2    KGEKR--PDTATYVAAIDQGTTSTRFIVYDTAAKVVVSHQLEFTQIYPQAGWVEHDPMEI  59

Query  229  LKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDART  408
            L +V+  +  A+ K    G ++   LKAIGITNQRETTV+WS+S+G P YNA+VWMD+RT
Sbjct  60   LDTVRKAMEGALAKGKEKGLDILDNLKAIGITNQRETTVIWSRSTGKPYYNAVVWMDSRT  119

Query  409  TSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTID  588
            +SICR LEK+ P G   FV TCGLPI  YFSA K+LWL+E+V  VK  V++GDALFGTID
Sbjct  120  SSICRHLEKQHPEGGRRFVSTCGLPIHPYFSATKILWLMEHVPEVKAGVESGDALFGTID  179

Query  589  TWLIWNMTGGVG--KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TWLIWN+TGG+   + +HVTD +NA+RTMLM+L TL W  PTL+
Sbjct  180  TWLIWNLTGGLNAEEPVHVTDCTNAARTMLMDLTTLQWHEPTLK  223



>dbj|BAH56977.1| AT1G80460 [Arabidopsis thaliana]
Length=423

 Score =   283 bits (724),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +1

Query  220  VEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  399
            +EIL+SVKVC++KA+DKATADGHNV   LKAIG+T+QRETTVVWSKS+GLPL+ AIVWMD
Sbjct  1    MEILESVKVCIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMD  60

Query  400  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFG  579
            ART+SICR+LEKEL GGR+HFVE+CGLPISTYFSAMKLLWL+ENV+ VK+A+K GDA+FG
Sbjct  61   ARTSSICRRLEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFG  120

Query  580  TIDTWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TIDTWLIWNMTGG+  GLHVTDV+NASRTMLMNLKTL WD  TL+
Sbjct  121  TIDTWLIWNMTGGINGGLHVTDVTNASRTMLMNLKTLSWDQDTLK  165



>ref|XP_008779159.1| PREDICTED: glycerol kinase-like isoform X1 [Phoenix dactylifera]
Length=476

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  214  DPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVW  393
            DP EIL+SV+VC+ KAV+KA A G  V   LKAIG+TNQRETTV+WSKS+GLPLYNAIVW
Sbjct  5    DPAEILESVRVCMEKAVEKAAAGGRKVEGRLKAIGLTNQRETTVMWSKSTGLPLYNAIVW  64

Query  394  MDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDAL  573
            MDART+SIC++LEKEL GGR HFVETCGLPISTYFSA+K+LWL+ENV+AV+EAV++GDAL
Sbjct  65   MDARTSSICKRLEKELSGGRNHFVETCGLPISTYFSALKILWLMENVDAVREAVRSGDAL  124

Query  574  FGTIDTWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            FGTIDTW IWN+TGG G+GLH TD SNA+RTMLM+LKTLDWD PTLE
Sbjct  125  FGTIDTWTIWNLTGGCGRGLHATDCSNAARTMLMDLKTLDWDMPTLE  171



>ref|XP_006852853.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
 gb|ERN14320.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
Length=477

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  202  WVEHDPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYN  381
            WVEHDP+EIL+SV+ C+ KA+DKAT  GHNV   LKAIGITNQRETT+VWSKS+G PLYN
Sbjct  7    WVEHDPMEILESVRDCMEKALDKATVAGHNVESGLKAIGITNQRETTLVWSKSTGDPLYN  66

Query  382  AIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKN  561
            AIVWMD RT+SICR+LE+ LPGGRTHF ET GLP+STYFSA+KL+WLLENV+AVK A ++
Sbjct  67   AIVWMDVRTSSICRRLEESLPGGRTHFTETTGLPVSTYFSALKLIWLLENVDAVKAAAQS  126

Query  562  GDALFGTIDTWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GDALFGT+DTWLIWN+TGGV KG+HVTD SNASRTMLM+L TL W  PTLE
Sbjct  127  GDALFGTVDTWLIWNLTGGVHKGVHVTDCSNASRTMLMDLATLTWHAPTLE  177



>gb|KIX03908.1| glycerol kinase [Rhinocladiella mackenziei CBS 650.93]
Length=512

 Score =   258 bits (658),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 156/217 (72%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSMQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHNV   +KA+GITNQRETTVVW+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVKQFETQGHNV-NTIKAVGITNQRETTVVWNKETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL++ L  G     + CG+P+STY S  KLLWLLENV  V EA   G   FGTIDTWL++
Sbjct  120  KLKQRL--GADKLTDICGIPLSTYPSVGKLLWLLENVPQVNEAHDKGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + + V+D SNASRTM MNLKTL++D   L+
Sbjct  178  KLNGGPKRNIFVSDPSNASRTMFMNLKTLNYDESLLD  214



>ref|XP_007734806.1| glycerol kinase [Capronia epimyces CBS 606.96]
 gb|EXJ82683.1| glycerol kinase [Capronia epimyces CBS 606.96]
Length=512

 Score =   255 bits (651),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 155/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    +VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ+GW EHDP+EI+ SV+
Sbjct  1    MGSVPEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQSGWHEHDPLEIVTSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+ +A ++    GHN+  + KAIGITNQRETTV+W K +G PLYNAIVW D RT ++ R
Sbjct  61   RCIDEACNQFENQGHNLDSI-KAIGITNQRETTVLWDKETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G     E CGLP+STY S  KLLWLLENV  VK A + G   FGTIDTWL++
Sbjct  120  KLKHRL--GSDKLTEICGLPLSTYPSVGKLLWLLENVPKVKAAYEKGVLAFGTIDTWLVF  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG+ + + VTD SNASRTM MN+ TL +D   L+
Sbjct  178  KLNGGIKRNIFVTDPSNASRTMFMNIHTLSYDDSLLD  214



>gb|KIW59223.1| glycerol kinase [Exophiala xenobiotica]
 gb|KIW59224.1| glycerol kinase, variant [Exophiala xenobiotica]
Length=512

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSIQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C++ AV +    GHN+   +KA+GITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ECINGAVKQFETQGHNINS-IKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL++ L  G     + CGLP+STY S  KLLWLLEN   VK+A   G   FGTID WL++
Sbjct  120  KLKQRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKQAYDRGTLAFGTIDAWLVF  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG+ K + V+D SNASRTM MN+KTL +D   ++
Sbjct  178  KLNGGIKKNVFVSDPSNASRTMFMNIKTLKYDESLID  214



>ref|XP_007721505.1| glycerol kinase [Capronia coronata CBS 617.96]
 gb|EXJ94011.1| glycerol kinase [Capronia coronata CBS 617.96]
Length=515

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 151/207 (73%), Gaps = 3/207 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            + FVGSIDQGTTSTRF+I++RS  PV SHQIEF Q+YPQ+GW EHDP+EI+ SV+ C+  
Sbjct  10   ETFVGSIDQGTTSTRFLIFNRSGEPVASHQIEFKQYYPQSGWHEHDPLEIISSVEQCIEG  69

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV      GH     +KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL++ 
Sbjct  70   AVKDLENQGHAKAS-IKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALVRKLKQR  128

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G     E CGLP+STY S  KLLWLL N   VK+A + G+  FGTID+WL++ + GG
Sbjct  129  L--GADKLQELCGLPLSTYPSVGKLLWLLANEPKVKDAYEKGNLAFGTIDSWLVYRLNGG  186

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
              K + V+D +NASRTM MNL+TLD+D
Sbjct  187  PNKNVFVSDPTNASRTMFMNLRTLDYD  213



>gb|KIW74117.1| glycerol kinase [Fonsecaea pedrosoi CBS 271.37]
Length=512

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSTQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN+   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHNI-NTIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A + G   FGTID WL++
Sbjct  120  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDAYEKGVLAFGTIDAWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + + V+D SNASRTM MNLKTL++D   L+
Sbjct  178  KLNGGPKRNIFVSDPSNASRTMFMNLKTLEYDDSLLD  214



>gb|KIW53862.1| glycerol kinase [Exophiala xenobiotica]
Length=523

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 149/207 (72%), Gaps = 3/207 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            +VFVGSIDQGTTSTRF+I++R   PV SHQIEF QFYPQ GW EHDP+EI+ SV+ C+  
Sbjct  18   EVFVGSIDQGTTSTRFLIFNRDGEPVASHQIEFKQFYPQPGWHEHDPLEIVSSVEQCIEG  77

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV      GH+    +KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RK++  
Sbjct  78   AVKDLETQGHSSSN-IKAVGITNQRETTVVWDYETGEPLYNAIVWTDTRTQALIRKIKLR  136

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G     E CGLP+STY S  KLLWLLENV  V++A + G+  FGT+D WL++ + GG
Sbjct  137  L--GADRLQELCGLPLSTYPSVGKLLWLLENVPKVQDAYEKGNLAFGTVDAWLVYRLNGG  194

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
              K + V+D +NASRT  MNLKTLD+D
Sbjct  195  PKKNVFVSDPTNASRTCFMNLKTLDYD  221



>ref|XP_003072057.1| glycerol kinase, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER29912.1| glycerol kinase, putative [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW18978.1| glycerol kinase [Coccidioides posadasii str. Silveira]
Length=510

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 154/212 (73%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K+ + F+GSIDQGTTS+RF+I++++   V SHQ+EFTQ YPQ GW EHDP EI+ SV+
Sbjct  1    MAKDIESFIGSIDQGTTSSRFLIFNKNGEVVASHQLEFTQIYPQPGWHEHDPKEIVTSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      G+NV   +KA+GITNQRETTVVW K +G PLYNAIVW D RT S+ R
Sbjct  61   RCIDGAVSSFEHQGYNV-ESIKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQSLIR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L++ L  G  H  E CGLP+STY S  KLLWLLENV  VK+A + G   FGTIDTWL++
Sbjct  120  RLKRRLGHGEVH--EHCGLPLSTYPSVGKLLWLLENVPKVKDAYEKGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG  K + VTD SNASRTM MN++T  +D
Sbjct  178  MLNGGPKKNVFVTDPSNASRTMFMNIRTRQYD  209



>ref|XP_002623248.1| glycerol kinase [Blastomyces dermatitidis SLH14081]
 gb|EEQ71496.1| glycerol kinase [Blastomyces dermatitidis SLH14081]
 gb|EGE78851.1| glycerol kinase [Blastomyces dermatitidis ATCC 18188]
 gb|EQL36571.1| glycerol kinase [Blastomyces dermatitidis ATCC 26199]
 gb|EQL36572.1| glycerol kinase, variant [Blastomyces dermatitidis ATCC 26199]
Length=510

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    Q FVGSIDQGTTS+RF+I++ +   VVSHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSVGQTFVGSIDQGTTSSRFLIFNPAGDVVVSHQLEFRQIYPQPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV    + GH++ + +KA+GITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KTIKAVGITNQRETTVVWDRETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+K L  G       CGLP+STY S  KLLW++ENV   KEA + G   FGT+DTWL++
Sbjct  120  KLKKRL--GANDLQALCGLPLSTYPSVGKLLWIIENVPKAKEAYEKGTLAFGTVDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  K ++VTD SNASRTM MN+KTL +D   +E
Sbjct  178  KLNGGTEKNIYVTDPSNASRTMFMNIKTLQYDEQLIE  214



>gb|KIW41707.1| glycerol kinase [Exophiala oligosperma]
Length=512

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+  V+
Sbjct  1    MGSVQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVAGVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN+   +KA+GITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ECIDGAVKQFENQGHNINS-IKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL++ L  G     + CGLP+STY S  KLLWLLEN   VK A + G   FGTID WL++
Sbjct  120  KLKQRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKAAYEKGTLAFGTIDAWLVF  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG+ + + V+D SNASRTM MN+KTL +D
Sbjct  178  KLNGGLKRNIFVSDPSNASRTMFMNIKTLKYD  209



>gb|KIX96461.1| hypothetical protein Z520_07727 [Fonsecaea multimorphosa CBS 
102226]
Length=512

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 153/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSTQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN+   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHNI-NTIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALIR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A   G   FGTID WL++
Sbjct  120  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDAHDKGVLAFGTIDAWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + + V+D SNASRTM MNLKTL++D   L+
Sbjct  178  KLNGGPKRNIFVSDPSNASRTMFMNLKTLEYDDSLLD  214



>ref|XP_007746125.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
 gb|EXJ69310.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
Length=512

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSSQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVASVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GH+V  + KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHSVNSI-KAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A + G   FGTID WL++
Sbjct  120  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDAYEKGVLAFGTIDAWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + + V+D SNASRTM MNLKTL++D   L+
Sbjct  178  RLNGGPKRNIFVSDPSNASRTMFMNLKTLEYDDSLLD  214



>gb|KIW12125.1| glycerol kinase [Exophiala spinifera]
Length=515

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = +1

Query  82   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
            VFVGSIDQGTTSTRF+I++R   P+ SHQIEF Q YPQ GW EHDP+EI+ SV+ C+  A
Sbjct  11   VFVGSIDQGTTSTRFLIFNRDGEPIASHQIEFKQIYPQPGWHEHDPLEIISSVEQCIEGA  70

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            V      GH+  ++ KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RK++  L
Sbjct  71   VKDFETQGHSSAKI-KAVGITNQRETTVVWDYETGEPLYNAIVWTDTRTQALIRKIKLRL  129

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
              G     E CGLP+STY S  KLLWLLENV  VKEA + G+  FGTID WL++ + G  
Sbjct  130  --GADRLQELCGLPLSTYPSVGKLLWLLENVPKVKEAYEKGNLAFGTIDAWLVYRLNGAT  187

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWD  699
             K + V+D +NASRT  MNLKTLD+D
Sbjct  188  KKNVFVSDPTNASRTCFMNLKTLDYD  213



>gb|ERS98066.1| glycerol kinase [Sporothrix schenckii ATCC 58251]
Length=625

 Score =   253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 165/237 (70%), Gaps = 14/237 (6%)
 Frame = +1

Query  4    P*THRQSANCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQ  183
            P   R  A+   T EE ERK       FVGSIDQGTTS+RFII+D    PV SHQ+EF  
Sbjct  48   PQAERLPADLFVTDEEKERKW------FVGSIDQGTTSSRFIIFDGDGSPVASHQLEFEN  101

Query  184  FYPQAGWVEHDPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSS  363
             YP +GW EHDP+E+L SV  C+ KAV++    GH+  +L++++GITNQRETT+VW   +
Sbjct  102  LYPNSGWHEHDPMELLASVTTCMEKAVEQFVEKGHS-KQLIRSVGITNQRETTLVWDSET  160

Query  364  GLPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAV  543
            G PLYNA+VW D RTT + R+L K  P   T  ++ CGLP+STY S++KL WLL+NVEAV
Sbjct  161  GEPLYNAVVWPDTRTTGLVRQL-KNAPMADT-LLDLCGLPLSTYPSSVKLRWLLDNVEAV  218

Query  544  KEAVKNGDALFGTIDTWLIWNMTGGV-----GKGLHVTDVSNASRTMLMNLKTLDWD  699
            ++A + G   FGT+D+WLI+ + GG      GKG+HVTD +NASRTM MNLKTL +D
Sbjct  219  RKASEEGRLAFGTVDSWLIYKLNGGPTGGHDGKGVHVTDSTNASRTMFMNLKTLKYD  275



>gb|KIW39098.1| glycerol kinase [Exophiala oligosperma]
Length=523

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 148/206 (72%), Gaps = 3/206 (1%)
 Frame = +1

Query  82   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
            VFVGSIDQGTTSTRF+I++R   PV SHQIEF Q YPQ+GW EHDP+EI+ SV+ C+  A
Sbjct  19   VFVGSIDQGTTSTRFLIFNRDGEPVASHQIEFKQIYPQSGWHEHDPLEIITSVEQCIEGA  78

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            V      GH+  ++ KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RK++  L
Sbjct  79   VKDFETQGHSSAKI-KAVGITNQRETTVVWDYETGEPLYNAIVWTDTRTQALIRKIKLRL  137

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
              G     E CGLP+STY S  KLLWLLENV  VKEA + G+  FGTID WL++ + G  
Sbjct  138  --GADRLQELCGLPLSTYPSVGKLLWLLENVPKVKEAYEKGNLAFGTIDAWLVYRLNGAT  195

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWD  699
             K + V+D +NASRT  MNL+TLD+D
Sbjct  196  KKNVFVSDPTNASRTCFMNLRTLDYD  221



>gb|KIW93314.1| glycerol kinase [Cladophialophora bantiana CBS 173.52]
Length=512

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 153/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSSQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVASVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GH+V  + KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVQQFQDQGHSVNSI-KAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G       CGLP+STY S  KLLWLLEN   VK+A + G   FGTID WL++
Sbjct  120  KLKHRL--GADKLTNICGLPLSTYPSVGKLLWLLENEPKVKDAYEKGVLAFGTIDAWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + + V+D SNASRTM MNLKTL++D   L+
Sbjct  178  RLNGGPKRNIFVSDPSNASRTMFMNLKTLEYDDSLLD  214



>gb|KIH87229.1| glycerol kinase [Sporothrix brasiliensis 5110]
Length=625

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 164/237 (69%), Gaps = 14/237 (6%)
 Frame = +1

Query  4    P*THRQSANCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQ  183
            P   R  A+   T EE ERK       FVGSIDQGTTS+RFII+D    PV SHQ+EF  
Sbjct  48   PQAERLPADLFVTDEEKERKW------FVGSIDQGTTSSRFIIFDGDGSPVASHQLEFEN  101

Query  184  FYPQAGWVEHDPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSS  363
             YP +GW EHDP+E+L SV  C+ KAV++    GH+  +L++++GITNQRETT+VW   +
Sbjct  102  LYPNSGWHEHDPMELLASVTTCMEKAVEQFVEKGHS-KQLIRSVGITNQRETTLVWDSET  160

Query  364  GLPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAV  543
            G PLYNA+VW D RTT + R+L K  P   T   + CGLP+STY S++KL WLL+NVEAV
Sbjct  161  GEPLYNAVVWPDTRTTGLVRQL-KNAPKADT-LQDICGLPLSTYPSSVKLRWLLDNVEAV  218

Query  544  KEAVKNGDALFGTIDTWLIWNMTGGV-----GKGLHVTDVSNASRTMLMNLKTLDWD  699
            ++A + G   FGT+D+WLI+ + GG      GKG+HVTD +NASRTM MNLKTL +D
Sbjct  219  RKASEEGRLAFGTVDSWLIYKLNGGPTGGHDGKGVHVTDSTNASRTMFMNLKTLKYD  275



>gb|KIW25190.1| glycerol kinase [Cladophialophora immunda]
Length=520

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 153/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  9    MGSTQEVFVGSIDQGTTSSRFLIFNKRGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  68

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN+   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  69   KCIDGAVQQFQDQGHNI-NTIKAVGITNQRETTVLWNKETGEPLYNAIVWTDLRTQALVR  127

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G     + CGLP+STY S  KLLWLLEN   VK+A + G   FGTID WL++
Sbjct  128  KLKHRL--GADKLTDICGLPLSTYPSVGKLLWLLENEPKVKDAYEKGVLAFGTIDAWLVY  185

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + + V+D SNASRTM MNL TL++D   L+
Sbjct  186  KLNGGPKRNIFVSDPSNASRTMFMNLNTLEYDDSLLD  222



>ref|XP_009154657.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
 ref|XP_009154658.1| glycerol kinase, variant [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54196.1| glycerol kinase, variant [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54197.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
Length=523

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            + FVGSIDQGTTSTRF+I+++S  P+ SHQIEF Q+YPQ+GW EHDP+EI+ SV+ C+  
Sbjct  18   ETFVGSIDQGTTSTRFLIFNKSGEPIASHQIEFKQYYPQSGWHEHDPLEIISSVEQCIDG  77

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV      GH+   + KA+GITNQRETTVVW+  +G PLY+AIVW D RT ++ RKL+  
Sbjct  78   AVKDLENQGHSRASI-KAVGITNQRETTVVWNHETGEPLYHAIVWTDTRTQALVRKLKHR  136

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G     E CGLP+STY S  KLLWLLEN   VKEA   G   FGTID+WL++ + GG
Sbjct  137  L--GADRLQELCGLPLSTYPSVGKLLWLLENEPKVKEAYDKGILAFGTIDSWLVYKLNGG  194

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
              K + V+D +NASRTM MNL+TLD+D
Sbjct  195  PKKNVFVSDPTNASRTMFMNLRTLDYD  221



>gb|KDO39538.1| hypothetical protein CISIN_1g0368921mg, partial [Citrus sinensis]
Length=336

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 138/158 (87%), Gaps = 3/158 (2%)
 Frame = +1

Query  241  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  420
            +VC++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMDAR +S  
Sbjct  2    RVCMAKALDKATADGHNVDTGLKAIGLTNQRETTVLWSKSTGCPLYNAIVWMDARNSS--  59

Query  421  RKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLI  600
             ++ + +  G+THF+E  GLPIST F+A+KLLW++ENV+ VKEA+K GDALFGTIDTWLI
Sbjct  60   -EIGEGIIWGKTHFLEAVGLPISTCFTAVKLLWMMENVDVVKEAIKKGDALFGTIDTWLI  118

Query  601  WNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            WN+TGGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  119  WNLTGGVNGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  156



>gb|EEQ90810.1| glycerol kinase [Blastomyces dermatitidis ER-3]
Length=510

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    Q FVGSIDQGTTS+RF+I++ +   VVSHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSVGQTFVGSIDQGTTSSRFLIFNPAGDVVVSHQLEFRQIYPQPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV    + GH++ + +KA+GITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KTIKAVGITNQRETTVVWDRETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+K L       +  CGLP+STY S  KLLW++ENV   KEA + G   FGT+DTWL++
Sbjct  120  KLKKRLEANDLQAL--CGLPLSTYPSVGKLLWIIENVPKAKEAYEKGTLAFGTVDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  K ++VTD SNASRTM MN+KTL +D   +E
Sbjct  178  KLNGGTEKNIYVTDPSNASRTMFMNIKTLQYDEQLIE  214



>gb|EAS27500.3| glycerol kinase [Coccidioides immitis RS]
Length=546

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 153/213 (72%), Gaps = 3/213 (1%)
 Frame = +1

Query  61   KMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSV  240
            +M K+ + F+GSIDQGTTS+RF+I++++     SHQ+EFTQ YPQ GW EHDP EI+ SV
Sbjct  36   EMGKDIESFIGSIDQGTTSSRFLIFNKNGEVAASHQLEFTQIYPQPGWHEHDPKEIVTSV  95

Query  241  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  420
            + C+  AV      G+NV   +KA+GITNQRETTVVW K +G PLYNAIVW D RT S+ 
Sbjct  96   ERCIDGAVSSFEHQGYNV-ESIKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQSLI  154

Query  421  RKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLI  600
            R+L++ L  G  H  E CGLP+STY S  KLLWLLENV  VK+A + G   FGTIDTWL+
Sbjct  155  RRLKRRLGHGEVH--ERCGLPLSTYPSVGKLLWLLENVPKVKDAYEKGVLAFGTIDTWLV  212

Query  601  WNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            + + GG  K + VTD SNASRTM MN++T  +D
Sbjct  213  YMLNGGPKKNVFVTDPSNASRTMFMNIRTRQYD  245



>ref|XP_008082000.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
 gb|EHK98240.1| putative Glycerol kinase [Glarea lozoyensis 74030]
 gb|EPE30589.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
Length=518

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 149/214 (70%), Gaps = 3/214 (1%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            +E+ FVGSIDQGTTSTRF+I+++   PV SHQIEF QFYPQ GW EHDP EI++SV  C+
Sbjct  11   QEESFVGSIDQGTTSTRFLIFNKDGEPVASHQIEFKQFYPQPGWHEHDPTEIIESVNQCI  70

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
              AV      GH+  R +KA+GITNQRETTVVW K +G PLYNAIVW D R  ++ RKL+
Sbjct  71   EGAVKAFEQQGHSA-RSIKAVGITNQRETTVVWDKQTGEPLYNAIVWTDTRHQNLVRKLK  129

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
              L  G       CGLP+STY S  KLLW++ENV+ V  A + G+  FGT+D WL++ + 
Sbjct  130  ARL--GAEQLQALCGLPLSTYPSVGKLLWMIENVKEVSAAYEAGNLCFGTVDAWLVYKLN  187

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GG  K + V+D SNASRTM MN+ TL +D   L+
Sbjct  188  GGPKKNIFVSDPSNASRTMFMNIHTLKYDESLLD  221



>gb|KIW13824.1| glycerol kinase [Exophiala spinifera]
Length=512

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 149/212 (70%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    +VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+  V+
Sbjct  1    MGSVHEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVAGVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN+   +KA+GITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ECIDGAVKQFENQGHNINS-IKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL++ L  G     + CGLP+STY S  KLLWLLEN   V++A + G   FGTID WL++
Sbjct  120  KLKQRL--GADRLTDICGLPLSTYPSVGKLLWLLENEPKVQKAYERGTLAFGTIDAWLVF  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG  + + V+D SNASRTM MN+KTL +D
Sbjct  178  KLNGGTKRNIFVSDPSNASRTMFMNIKTLKYD  209



>gb|KEF63543.1| glycerol kinase [Exophiala aquamarina CBS 119918]
Length=514

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 154/216 (71%), Gaps = 5/216 (2%)
 Frame = +1

Query  52   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  231
            G+ + SKE  VFVG+IDQGTTS+RF+I+++S  PV SHQIEF Q+YPQ GW EHDP+EI+
Sbjct  2    GDTQASKE--VFVGAIDQGTTSSRFLIFNKSGEPVASHQIEFKQYYPQPGWHEHDPLEII  59

Query  232  KSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  411
             SV+ C+  AV      GH  G  +KA+GITNQRETTVVW+  +G PLYNAIVW D RT 
Sbjct  60   SSVEQCIDGAVKDLENQGH-AGSSIKAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQ  118

Query  412  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDT  591
            ++ RKL++ L  G        GLP+STY S  KLLWLLEN   VKEA + G   FGTID 
Sbjct  119  ALIRKLKRRL--GADQLPGLSGLPLSTYPSVGKLLWLLENEPKVKEAYEKGILAFGTIDA  176

Query  592  WLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            WL++ + GG  K + V+D +NASRT+ MNLKTL++D
Sbjct  177  WLVYKLNGGPKKNVFVSDPTNASRTLFMNLKTLNYD  212



>ref|XP_007762002.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
 gb|EXJ54487.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
Length=512

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 154/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    + F+GSIDQGTTS+RF+I++++  PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSPSEHFIGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPHPGWHEHDPLEIISSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GH+  + +KAIGITNQRETTV+W+K +G PLYNAIVW D R  ++ R
Sbjct  61   QCIDGAVKQFETQGHSA-QSIKAIGITNQRETTVLWNKETGEPLYNAIVWTDTRHQNLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL++ L  G    +E  G+P+STY S  KLLWLLEN   VKEA + G   FGTIDTWL++
Sbjct  120  KLKQRL--GADQLIELAGVPLSTYPSVGKLLWLLENEAKVKEAYEKGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  K + V+D SNASRTM MNL+TLD+D   L+
Sbjct  178  KLNGGPKKNVFVSDPSNASRTMFMNLRTLDYDESLLD  214



>ref|XP_007875438.1| hypothetical protein PNEG_03356 [Pneumocystis murina B123]
 gb|EMR08184.1| hypothetical protein PNEG_03356 [Pneumocystis murina B123]
Length=514

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 155/211 (73%), Gaps = 3/211 (1%)
 Frame = +1

Query  67   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKV  246
            SK    ++G+IDQGTTSTRF+I+DR+   V  HQ EF Q YP  GW+EHDP+EIL+SV++
Sbjct  5    SKMFSEYIGAIDQGTTSTRFLIFDRTGSIVSLHQHEFKQIYPHPGWIEHDPMEILESVEI  64

Query  247  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  426
            C+ K ++       +V R +K +GITNQRET VVW K +G PLYNAIVW D RT  + R+
Sbjct  65   CIRKTIEDFVKKNKSV-RQIKGLGITNQRETIVVWDKDTGKPLYNAIVWSDTRTIEVVRE  123

Query  427  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWN  606
            L+++      H  + CGLPISTYFSA+KL WLL+NV +V+E   +G   FGTID+WLI+N
Sbjct  124  LKQKEDASEVH--KICGLPISTYFSAVKLRWLLDNVRSVREVYDSGRLAFGTIDSWLIYN  181

Query  607  MTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            +TG +  G+H+TD +NASRTML+N++TL++D
Sbjct  182  LTGNIDGGIHITDATNASRTMLLNIRTLEYD  212



>gb|AGM32757.1| putative glycerol kinase 3-like protein, partial [Coptotermes 
formosanus]
Length=239

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVV-SHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+ID+GT+S RF+I+    R VV SHQI+ +  YPQ GWVE DP EIL +V+ C+ KA
Sbjct  11   LVGAIDEGTSSARFLIFAAHTRQVVASHQIQISNAYPQEGWVEQDPKEILTAVQQCIEKA  70

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            V+K  A+G     ++ A+GITNQRETTVVW   +G PL+NAIVW+DARTTS   ++ + +
Sbjct  71   VEKLQANGVEPSDIV-AVGITNQRETTVVWDARTGEPLHNAIVWLDARTTSTVDEILETV  129

Query  442  PGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            P    ++++  CGLPIS YFSA+KL WL+ENV  V++A+      FGT+DTWLIWN+TGG
Sbjct  130  PNKSLNYLKPLCGLPISPYFSALKLHWLMENVPRVRQAIDEKHCCFGTVDTWLIWNLTGG  189

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H+TDV+NASRTMLMN++TL WD
Sbjct  190  KDGGIHITDVTNASRTMLMNIETLQWD  216



>ref|XP_002544072.1| glycerol kinase [Uncinocarpus reesii 1704]
 gb|EEP78743.1| glycerol kinase [Uncinocarpus reesii 1704]
Length=510

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 155/211 (73%), Gaps = 3/211 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+K+ + F+GSIDQGTTS+RF+I++++   V SHQ+EFTQ YPQ GW EHDP+EI+ SV+
Sbjct  1    MAKDVESFIGSIDQGTTSSRFLIFNQNGEVVASHQLEFTQIYPQPGWHEHDPIEIVTSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      G+NVG  +KA+GITNQRETTVVW+K +G PLYNAIVW D RT S+ R
Sbjct  61   RCIDGAVSSFEHQGYNVGS-IKAVGITNQRETTVVWNKETGEPLYNAIVWTDTRTQSLIR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L++ L  G +   E CGLP+STY S  KLLWLL+ V  VKEA +NG   FGTIDTWL++
Sbjct  120  RLKQRL--GHSELQEHCGLPLSTYPSVGKLLWLLDCVPRVKEAYENGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDW  696
             + GG    + VTD SNASRTM M+++T  +
Sbjct  178  KLNGGPKNNVFVTDPSNASRTMFMDIRTRQY  208



>gb|KIV83409.1| glycerol kinase [Exophiala sideris]
Length=512

 Score =   247 bits (630),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    +VF+GSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP EI+ SV+
Sbjct  1    MGSVPEVFIGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPEEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN+   +KA+GITNQRETTVVW+K +G  LYNAIVW D R   + R
Sbjct  61   QCIDGAVKQFETQGHNI-NTIKAVGITNQRETTVVWNKETGEALYNAIVWTDTRHQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL++ L  G     + CGLP+STY S  KLLWL+ENV+ VK+A + G   FGTIDTWL++
Sbjct  120  KLKQRL--GADKLTDICGLPLSTYPSVGKLLWLIENVDKVKQAYEKGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG  + + V+D SNASRTM MN+ TL +D
Sbjct  178  KLNGGTKRNVFVSDPSNASRTMFMNISTLKYD  209



>ref|XP_008730990.1| glycerol kinase [Cladophialophora carrionii CBS 160.54]
 gb|ETI20422.1| glycerol kinase [Cladophialophora carrionii CBS 160.54]
Length=512

 Score =   247 bits (630),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 151/217 (70%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    + F+GSIDQGTTS+RF+I++++  PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSPSEHFIGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN    +KA+GITNQRETTV+W+K +G PLYNAIVW D R  ++ R
Sbjct  61   QCIDGAVKQFETQGHNA-HSIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRHQNLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G    +E  G+P+STY S  KLLWLLEN   VKEA + G   FGTIDTWL++
Sbjct  120  KLKHRL--GADQLIELAGVPLSTYPSVGKLLWLLENEPKVKEAYEKGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  K + V+D SNASRTM MNL TLD+D   L+
Sbjct  178  KLNGGPKKNVFVSDPSNASRTMFMNLHTLDYDESLLD  214



>gb|EER38708.1| glycerol kinase [Histoplasma capsulatum H143]
Length=509

 Score =   247 bits (630),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 151/217 (70%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    Q F+GSIDQGTTS+RF+I+  +   V SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSIGQTFLGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYPQPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV    + GH++ + +KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KAIKAIGITNQRETTVVWDKDTGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+K L  G       CGLP+STY S  KLLW++ENV   KEA + G   FGTIDTWLI+
Sbjct  120  KLKKRL--GANDLQALCGLPLSTYPSVGKLLWIIENVPKAKEAYEKGTLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  K ++VTD +NASRTM MN+ TL +D   +E
Sbjct  178  KLNGGTKKNVYVTDPTNASRTMFMNITTLQYDEQLIE  214



>ref|XP_009161485.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY61024.1| glycerol kinase [Exophiala dermatitidis NIH/UT8656]
Length=512

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 155/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    +VFVGSIDQGTTS+RF+I++++  PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSSPEVFVGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+ +A  +    GH++   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDEACKQFETQGHSL-HSIKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G    +E CG+P+STY S  KLLWLLE+   VK A + G   FGTIDTWL++
Sbjct  120  KLKHRL--GADKLMEICGVPLSTYPSVGKLLWLLEHEPKVKAAYEKGVLAFGTIDTWLVF  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG+ + + VTD SNASRTM MN+ TL +D   L+
Sbjct  178  KLNGGLKRNVFVTDPSNASRTMFMNIHTLTYDESLLD  214



>gb|EEH03542.1| glycerol kinase [Histoplasma capsulatum G186AR]
Length=510

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 152/217 (70%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    Q F+GSIDQGTTS+RF+I+  +   V SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSIGQTFLGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYPQPGWHEHDPLEIISSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV    + GH++ + +KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-KAIKAIGITNQRETTVVWDKDTGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+K L G     +  CGLP+STY S  KLLW++ENV   KEA + G   FGTIDTWLI+
Sbjct  120  KLKKRLGGNDLQAL--CGLPLSTYPSVGKLLWIIENVPKAKEAYEKGTLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  K ++VTD +NASRTM MN+ TL +D   +E
Sbjct  178  KLNGGTKKNVYVTDPTNASRTMFMNITTLQYDEQLIE  214



>emb|CCJ30886.1| unnamed protein product [Pneumocystis jirovecii]
Length=507

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 158/212 (75%), Gaps = 6/212 (3%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MS E   ++G+IDQGTTS+RF I+D++      +Q EF Q Y   GW+EH+P+EIL SVK
Sbjct  1    MSSE---YIGAIDQGTTSSRFFIFDKNGCIASLYQHEFPQIYSSPGWIEHNPMEILNSVK  57

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
            +C+ KA+ +    G ++ RL+KA+GI NQRETTVVW K++G+PLYNAIVW D RTT    
Sbjct  58   ICIEKAIGEFVKKGKSI-RLIKAVGIANQRETTVVWDKTTGIPLYNAIVWSDTRTTETVY  116

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L+++      H  E CGLPISTYFSA+KL WLL+NV+ V++    G+  FGTID+WLI+
Sbjct  117  QLKQKEYASEIH--EKCGLPISTYFSAVKLRWLLDNVKDVRDVYDQGNLAFGTIDSWLIY  174

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            N+TGG+  G+H+TDV+N+SRTML+N++TL +D
Sbjct  175  NLTGGINGGIHITDVTNSSRTMLLNIRTLKYD  206



>gb|EGC47863.1| glycerol kinase [Histoplasma capsulatum H88]
Length=510

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            Q F+GSIDQGTTS+RF+I+  +   V SHQ+EF Q YPQ GW EHDP+EI+ SV+ C+  
Sbjct  6    QTFLGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYPQPGWHEHDPLEIVSSVEKCIDG  65

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV    + GH++ + +KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ RKL+K 
Sbjct  66   AVASFESQGHSI-KAIKAIGITNQRETTVVWDKDTGEPLYNAIVWTDTRTQALVRKLKKR  124

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G       CGLP+STY S  KLLW++ENV   KEA + G   FGTIDTWLI+ + GG
Sbjct  125  L--GANDLQALCGLPLSTYPSVGKLLWIIENVPKAKEAYEKGTLAFGTIDTWLIYKLNGG  182

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              K ++VTD +NASRTM MN+ TL +D   +E
Sbjct  183  TKKNVYVTDPTNASRTMFMNITTLQYDEQLIE  214



>ref|XP_002792127.1| glycerol kinase [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH34868.1| glycerol kinase [Paracoccidioides sp. 'lutzii' Pb01]
Length=510

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 153/217 (71%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    + FVGSIDQGTTS+RF+I+  +   V SHQ+EF Q Y Q GW EHDP+EI+ SV+
Sbjct  1    MGSANESFVGSIDQGTTSSRFLIFSPAGEVVASHQLEFRQIYSQPGWHEHDPLEIVGSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV    + GH++ + +KAIGITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-QSIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQTLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G     + CGLP+STY S  KLLW++ENV  VKEA + G+  FGT+DTWL++
Sbjct  120  KLKNRL--GANELQDLCGLPLSTYPSVGKLLWMIENVRKVKEAYEKGELAFGTVDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + ++VTD SNASRTM MN+KTL +D   +E
Sbjct  178  RLNGGTKRDIYVTDASNASRTMFMNIKTLQYDDHLIE  214



>gb|KIX09632.1| glycerol kinase [Rhinocladiella mackenziei CBS 650.93]
Length=516

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 147/216 (68%), Gaps = 3/216 (1%)
 Frame = +1

Query  52   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  231
            G+       ++FVGSIDQGTTSTRF+I++R   P+ SHQ+EF Q YP  GW EHDP+EI+
Sbjct  2    GDTARHPSHEIFVGSIDQGTTSTRFLIFNRDGDPIASHQVEFKQMYPHPGWHEHDPLEII  61

Query  232  KSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  411
             SV+ C+  AV      GH    + KA+GITNQRETTVVW+  +G PLYNAIVW D RT 
Sbjct  62   SSVEECIEGAVKDLENQGHASANI-KAVGITNQRETTVVWNSETGEPLYNAIVWTDTRTQ  120

Query  412  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDT  591
            ++ RKL+  L  G     + CGLP+STY S  KLLWLLENV  VK+A   G   FGT+D 
Sbjct  121  ALVRKLKNRL--GADQLQQHCGLPLSTYPSVGKLLWLLENVPKVKDAYDKGILAFGTVDA  178

Query  592  WLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            WL++ + GG  K + V+D +NASRTM MNL TLD+D
Sbjct  179  WLVYKLNGGPKKNVFVSDPTNASRTMFMNLTTLDYD  214



>ref|XP_005702903.1| glycerol kinase [Galdieria sulphuraria]
 ref|XP_005709063.1| glycerol kinase [Galdieria sulphuraria]
 gb|EME26383.1| glycerol kinase [Galdieria sulphuraria]
 gb|EME32543.1| glycerol kinase [Galdieria sulphuraria]
Length=500

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 153/213 (72%), Gaps = 8/213 (4%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            + V+VG++DQGTTSTRF+++++   P+  HQ+E  Q YPQ GWVEHDPVEI+ +  +C+ 
Sbjct  2    QDVYVGAVDQGTTSTRFMLFNKQGEPIAFHQVEHKQIYPQPGWVEHDPVEIINNTILCID  61

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            + V K  A G    + +KAIGITNQRETTVVW K +G PL+NAIVW+D RT   C KL K
Sbjct  62   ETVKKCQAKGIQTSQ-IKAIGITNQRETTVVWDKYTGKPLFNAIVWLDTRTKETCEKLGK  120

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
                 R  + + CGLP+STYFS +KL W+++NV  VK A++ G A+FGTIDTWL+WN+T 
Sbjct  121  N----RDQYRDLCGLPVSTYFSGVKLRWIIDNVPDVKAALEEGRAIFGTIDTWLVWNLT-  175

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              G+  HVTD++NA RT+LMN++ L W+   L+
Sbjct  176  --GRQAHVTDITNAGRTLLMNIEKLQWEPKLLQ  206



>ref|XP_007722970.1| glycerol kinase [Capronia coronata CBS 617.96]
 gb|EXJ90776.1| glycerol kinase [Capronia coronata CBS 617.96]
Length=512

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 154/212 (73%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I++++  PV SHQIEFTQ YPQ GW EHDP EI+ SV+
Sbjct  1    MGSLQEVFVGSIDQGTTSSRFLIFNKAGEPVASHQIEFTQIYPQPGWHEHDPQEIVTSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+++A  +    GH++   +KA+GITNQRETTV+W+K +G PLYNAIVW D RT  + R
Sbjct  61   ECINEACKQFENQGHSLSS-IKAVGITNQRETTVLWNKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G    +E CG+P+STY S  KLLWLL+N   V+ A + G   FGT+D+WL++
Sbjct  120  KLKHRL--GADKLMEICGVPLSTYPSVGKLLWLLDNEPKVRAAYEKGVLAFGTVDSWLVF  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG+ + + VTD SNASRTM MN+ TL +D
Sbjct  178  KLNGGLKRNIFVTDPSNASRTMFMNIHTLKYD  209



>gb|KFH62786.1| glycerol kinase [Mortierella verticillata NRRL 6337]
Length=522

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 150/214 (70%), Gaps = 1/214 (0%)
 Frame = +1

Query  73   EEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCV  252
            E + +VG+ID GTTS+RF+I+D     V+ HQ+E+ Q Y   GWVE DP++IL SV  C+
Sbjct  11   EMRSYVGAIDNGTTSSRFLIFDEMGHLVIGHQLEYRQIYLHPGWVEQDPMDILGSVVSCI  70

Query  253  SKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLE  432
              A+ K    GH++ R  K IGITNQRET VVW +++G PL+NAIVW D RT  I  +L 
Sbjct  71   DGALRKFGLQGHDI-RKFKGIGITNQRETAVVWDRTTGKPLHNAIVWSDTRTKDIVTRLA  129

Query  433  KELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            +    G     E CGLPI+TYFSA+KL WLLEN   VKEA  NG+ +FGT+D+WLI+N+T
Sbjct  130  ESSDKGTDALKEVCGLPITTYFSAVKLRWLLENSPKVKEAHDNGNLMFGTVDSWLIYNLT  189

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            GG   G+HVTDV+NASRTMLM++KTL W    LE
Sbjct  190  GGAEGGIHVTDVTNASRTMLMDIKTLQWSDECLE  223



>gb|KIW30265.1| glycerol kinase [Cladophialophora immunda]
Length=524

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 146/216 (68%), Gaps = 3/216 (1%)
 Frame = +1

Query  52   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  231
            G+   S   + FVGSIDQGTTSTRF+I++R    + SHQIEF QFYP  GW EHDP+EI+
Sbjct  10   GDTTKSASHETFVGSIDQGTTSTRFLIFNRHGEVIASHQIEFKQFYPHPGWHEHDPLEII  69

Query  232  KSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  411
             SV+ C+  AV      GH    + KA+GITNQRETTVVW+  +G PLY AIVW D RT 
Sbjct  70   SSVEQCIDGAVKDLETQGHASANI-KAVGITNQRETTVVWNHETGEPLYRAIVWTDTRTQ  128

Query  412  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDT  591
            ++ RKL+  L  G     + CGLP+STY S  KLLWLLEN   VKEA   G   FGTID 
Sbjct  129  ALIRKLKHRL--GSDQLQQLCGLPLSTYPSVGKLLWLLENEPKVKEAYDKGVLAFGTIDA  186

Query  592  WLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            WL++ + GG  K + V+D +NASRTM MNLKTLD+D
Sbjct  187  WLVYKLNGGPKKNVFVSDPTNASRTMFMNLKTLDYD  222



>ref|XP_004336510.1| glycerol kinase [Acanthamoeba castellanii str. Neff]
 gb|ELR14497.1| glycerol kinase [Acanthamoeba castellanii str. Neff]
Length=559

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 152/213 (71%), Gaps = 4/213 (2%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVG++DQGT+STRFI++D     VVSHQ+E    YPQ GW EH    IL+  + C++ AV
Sbjct  58   FVGALDQGTSSTRFIVFDSRTNIVVSHQMELPPLYPQPGWAEHSGEAILRQSEECIAGAV  117

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL---EK  435
             K  A G+    + KA+GITNQRETT+VW + +G+PLYNAIVW+D+RT +I  +L   E 
Sbjct  118  AKLEALGYAASDI-KAVGITNQRETTLVWDRITGVPLYNAIVWLDSRTHAIVEELLQQEN  176

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
                G+      CGLP+STYFSA KL+WL++NV AV++A+++   +FGT+DTWLIWN+TG
Sbjct  177  FQAAGKDTLRPVCGLPLSTYFSATKLVWLIKNVPAVQQAIQDDRCIFGTVDTWLIWNLTG  236

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G   G HVTDV+NASRTMLMNLKTL WD    E
Sbjct  237  GPNGGAHVTDVTNASRTMLMNLKTLQWDSSACE  269



>ref|XP_008715149.1| glycerol kinase [Cyphellophora europaea CBS 101466]
 gb|ETN43413.1| glycerol kinase [Cyphellophora europaea CBS 101466]
Length=513

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 149/212 (70%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    + F+GSIDQGTTS+RF+I+++   PV SHQIEF Q YP  GW EHDP+EI+ SV+
Sbjct  1    MGSVAESFIGSIDQGTTSSRFLIFNKHGDPVASHQIEFKQIYPHPGWHEHDPLEIIDSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH+V  + KA+GITNQRETTVVW K++G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVAAFEQQGHSVNSI-KAVGITNQRETTVVWDKTTGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L+  L  G     + CGLP+STY S  KLLW +ENV A KEA + G+  FGT+DTWL +
Sbjct  120  RLKLRL--GADKLQDLCGLPLSTYPSVGKLLWFIENVPAAKEAYEKGNLCFGTMDTWLAF  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG+ + + VTD SNASRTM MN+ TL +D
Sbjct  178  RLNGGIKRNVFVTDPSNASRTMFMNIHTLKYD  209



>gb|ESA10637.1| hypothetical protein GLOINDRAFT_3264 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71814.1| glycerol kinase [Rhizophagus irregularis DAOM 197198w]
Length=502

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            F+GSIDQGTTS+RF+I+D     +  HQ+EF Q+YP  GW+EHDP++IL+SV  C+ K +
Sbjct  4    FIGSIDQGTTSSRFLIFDSKGALIDYHQVEFAQYYPNPGWIEHDPIDILESVYECIEKGL  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             K    G++V  + KAIG+TNQRETT+VW K +G  L NAIVW DART  +   L  +  
Sbjct  64   KKFIDKGYSVTDI-KAIGVTNQRETTIVWDKFTGKHLCNAIVWCDARTHHLVHDLNSK--  120

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
             G     E CGLPISTYFSA+KL WLLENV  VKEA +N   +FG +DTWLI+N+TGG+ 
Sbjct  121  HGTNALKELCGLPISTYFSAVKLKWLLENVSTVKEAHENETMIFGNVDTWLIYNLTGGID  180

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             GLH+TDV+NASRTMLM++K L+W    L+
Sbjct  181  GGLHITDVTNASRTMLMDIKKLEWSDELLK  210



>ref|XP_003053171.1| hypothetical protein NECHADRAFT_67500 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU47458.1| hypothetical protein NECHADRAFT_67500 [Nectria haematococca mpVI 
77-13-4]
Length=599

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 160/223 (72%), Gaps = 6/223 (3%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E +  K++  FVGSIDQGTTSTRF+I++    PV SHQIEF   YP +GW EH P+E+L+
Sbjct  76   ETEEEKQKHWFVGSIDQGTTSTRFLIFNGHGEPVASHQIEFENHYPHSGWHEHKPMELLE  135

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            SV+ C++KA +K  ADGH     + +IGITNQRETTV+W K++G PLYNA+VW D RT +
Sbjct  136  SVETCIAKATEKFCADGHTASE-IHSIGITNQRETTVLWDKNTGEPLYNAVVWPDTRTAA  194

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            + R L K  PG      E CGLP+STY S++KLLW+L+NV++V++A   G   FGT+D+W
Sbjct  195  LVRDL-KARPGA-DKLQEKCGLPLSTYPSSVKLLWVLQNVDSVRKAYDEGRLAFGTVDSW  252

Query  595  LIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            LI+ + GG    G  ++VTD +NASRTM MNLKTLD+D   L+
Sbjct  253  LIYQLNGGAKKEGGPVYVTDSTNASRTMFMNLKTLDYDDDLLK  295



>gb|KIV86319.1| glycerol kinase [Exophiala sideris]
 gb|KIV86320.1| glycerol kinase, variant [Exophiala sideris]
Length=523

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 146/207 (71%), Gaps = 3/207 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            + FVGSIDQGTTSTRF+I+     P+ SHQIEF Q YP  GW EHDP+EI++SV+ C+  
Sbjct  18   ETFVGSIDQGTTSTRFLIFKPDGEPIASHQIEFKQIYPHPGWHEHDPLEIIESVQQCIEG  77

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV      GH+ G + KA+GITNQRETTV+W+  +G PLYNAIVW D RT ++ RKL++ 
Sbjct  78   AVKDLENQGHSAGNI-KAVGITNQRETTVLWNHETGEPLYNAIVWTDTRTAALVRKLKQR  136

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G     + CGLP+STY S  KLLWLLEN   VKEA   G   FGTID WL++ + GG
Sbjct  137  L--GADRLPDLCGLPLSTYPSVGKLLWLLENEPKVKEAYDKGILAFGTIDAWLVYRLNGG  194

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
              K + V+D +NASRTM MNLKTL++D
Sbjct  195  PKKNVFVSDPTNASRTMFMNLKTLNYD  221



>emb|CCX34888.1| Similar to Glycerol kinase; acc. no. A9WJ21 [Pyronema omphalodes 
CBS 100304]
Length=627

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 160/226 (71%), Gaps = 4/226 (2%)
 Frame = +1

Query  25   ANCIHTREEGERK-MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAG  201
            A    T + G  K + ++   F  +IDQGTTS+RFII+D+S  PVVSHQ+EF Q YPQ+G
Sbjct  97   AKATQTDKSGSPKPVERKRGTFTCAIDQGTTSSRFIIFDKSGTPVVSHQVEFEQLYPQSG  156

Query  202  WVEHDPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYN  381
            W+EHDP E+LKSV +C+ +A +     G+ +   +KA+GITNQRETT+VW   +G PLYN
Sbjct  157  WIEHDPYELLKSVNLCIERATEAFKEKGYCL-EDIKAMGITNQRETTIVWDTVTGQPLYN  215

Query  382  AIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKN  561
            AIVW D RT+    +L K     +    E CGLP+STY S++KL W+L++V AV  A K 
Sbjct  216  AIVWSDTRTSRFVHELRKRDDADK--LRELCGLPLSTYPSSVKLAWMLKHVPAVTAAHKA  273

Query  562  GDALFGTIDTWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            G   FGT+DTWL++N+TGG GKG++VTD SNASRTM +N+KTL++D
Sbjct  274  GRLSFGTVDTWLLYNLTGGAGKGVYVTDPSNASRTMFVNIKTLEYD  319



>gb|EHL03740.1| putative Glycerol kinase [Glarea lozoyensis 74030]
Length=544

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 154/214 (72%), Gaps = 3/214 (1%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            KE++ FVGSIDQGTTS+RF+++D    PV SHQIEF   YP++GW EHDP+E+L SV+ C
Sbjct  67   KEKKWFVGSIDQGTTSSRFLVFDGEGTPVASHQIEFENIYPESGWHEHDPMELLSSVQEC  126

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            + KA +     GH+  ++ KAIGITNQRETTV W  ++G PLYNA+VW D RTTSI ++L
Sbjct  127  IEKATESFIEKGHSKDQI-KAIGITNQRETTVCWDTNTGEPLYNAVVWPDTRTTSIVKEL  185

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            + +   G    +E CGLP+STY S++KLLWLL NV+A+K+A       FGT+D+WLI+ +
Sbjct  186  KAK--AGADELLEICGLPLSTYPSSVKLLWLLRNVDAIKQAYDEERLSFGTVDSWLIYKL  243

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
             GG    +H+TD +NASRTM MNL T+ +D   L
Sbjct  244  NGGKDANIHITDSTNASRTMFMNLHTMKYDEKLL  277



>dbj|GAN02093.1| conserved hypothetical protein [Mucor ambiguus]
Length=513

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 154/212 (73%), Gaps = 7/212 (3%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            ++G+IDQGTTSTRF+I+D++   V SHQ+EF Q YP+ GW+EHDP ++L SV  C  +AV
Sbjct  4    YIGAIDQGTTSTRFLIFDQAGNHVTSHQLEFEQIYPRPGWIEHDPYDLLDSVIRCSDEAV  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             K    GH++  L KA+GI NQRETT++W + +G PLYNAIVW D RT +    L KEL 
Sbjct  64   RKFGMMGHDITDL-KAVGICNQRETTLIWDRKTGEPLYNAIVWGDTRTNN----LVKELA  118

Query  445  GGRTHF--VETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
              +T F   E CGLPI  YFSA+K+ WL++ +  VK AV+N  A+FGT+DTWLIWN+TGG
Sbjct  119  EKQTDFNVQEICGLPIHNYFSAVKVRWLMDRIPKVKFAVENKRAMFGTVDTWLIWNLTGG  178

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +  G H+TDV+NASRTM MNLK+ +WD   L+
Sbjct  179  IQAGKHITDVTNASRTMFMNLKSREWDQRLLD  210



>ref|XP_009257820.1| hypothetical protein FPSE_06427 [Fusarium pseudograminearum CS3096]
 gb|EKJ73355.1| hypothetical protein FPSE_06427 [Fusarium pseudograminearum CS3096]
 gb|EYB29448.1| hypothetical protein FG05_30234 [Fusarium graminearum]
 emb|CEF76919.1| unnamed protein product [Fusarium graminearum]
Length=606

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 160/218 (73%), Gaps = 6/218 (3%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E +  +++  FVGSIDQGTTSTRF+I++    PV SHQ+EF   YP +GW EHDP+ +L+
Sbjct  83   ETEEERQKHWFVGSIDQGTTSTRFLIFNGHGEPVASHQMEFENLYPASGWHEHDPMTLLE  142

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            S ++C+ KA +K  A GH++   +++IGITNQRETTV+W  ++G PLYNA+VW D RT++
Sbjct  143  SAEICIEKATEKFCAQGHSIEE-IRSIGITNQRETTVLWDNTTGEPLYNAVVWPDTRTSA  201

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            + R L K  PG      E CGLP+STY S++KLLW+L+NVE+V+EA ++G   FGT+D+W
Sbjct  202  LVRDL-KNKPGAE-KLQEACGLPLSTYPSSVKLLWVLQNVESVREAYEDGRLSFGTVDSW  259

Query  595  LIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWD  699
            LI+ + GG    G  + VTD +NASRTM MNLKTLD+D
Sbjct  260  LIYKLNGGQAREGGPIFVTDATNASRTMFMNLKTLDYD  297



>ref|XP_008083904.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
 gb|EPE29795.1| Actin-like ATPase [Glarea lozoyensis ATCC 20868]
Length=570

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 154/214 (72%), Gaps = 3/214 (1%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            KE++ FVGSIDQGTTS+RF+++D    PV SHQIEF   YP++GW EHDP+E+L SV+ C
Sbjct  56   KEKKWFVGSIDQGTTSSRFLVFDGEGTPVASHQIEFENIYPESGWHEHDPMELLSSVQEC  115

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            + KA +     GH+  ++ KAIGITNQRETTV W  ++G PLYNA+VW D RTTSI ++L
Sbjct  116  IEKATESFIEKGHSKDQI-KAIGITNQRETTVCWDTNTGEPLYNAVVWPDTRTTSIVKEL  174

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            + +   G    +E CGLP+STY S++KLLWLL NV+A+K+A       FGT+D+WLI+ +
Sbjct  175  KAK--AGADELLEICGLPLSTYPSSVKLLWLLRNVDAIKQAYDEERLSFGTVDSWLIYKL  232

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
             GG    +H+TD +NASRTM MNL T+ +D   L
Sbjct  233  NGGKDANIHITDSTNASRTMFMNLHTMKYDEKLL  266



>gb|KIN04900.1| hypothetical protein OIDMADRAFT_157379 [Oidiodendron maius Zn]
Length=580

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 154/221 (70%), Gaps = 3/221 (1%)
 Frame = +1

Query  52   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  231
            GE    K++  F+GSID GTTS+RF+I+D   +PV SHQIEFT  +P++GW EHDP E+ 
Sbjct  41   GETDEEKQKHWFIGSIDCGTTSSRFLIFDGEGQPVASHQIEFTNLFPESGWHEHDPEELA  100

Query  232  KSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  411
             +V+ C+ KA +K    GH   + ++ IGITNQRETT+ W  ++G PLYNAIVW D RTT
Sbjct  101  TTVQECIDKATEKFFELGHK-KKDIRTIGITNQRETTICWDTNTGKPLYNAIVWPDTRTT  159

Query  412  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDT  591
            +I R+L+K    G     + CGLP+STY S++K LWL ENVEAVK+A   G   FGT+D+
Sbjct  160  AIVRELKKR--KGADELPQKCGLPLSTYPSSVKFLWLYENVEAVKQAYDEGRCSFGTVDS  217

Query  592  WLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            WLI+ + GG   G+HVTD +NASRTM MNL TL +D   L+
Sbjct  218  WLIYKLNGGKDAGVHVTDTTNASRTMFMNLHTLQYDDELLD  258



>gb|EZF30633.1| glycerol kinase, partial [Trichophyton interdigitale H6]
Length=322

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA   G   FGTIDTWLI+
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDEGRLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD SNASRTM MNL+ +++D
Sbjct  178  KLNGGPEGGVFVTDPSNASRTMFMNLRKVEYD  209



>gb|KIW80416.1| glycerol kinase [Fonsecaea pedrosoi CBS 271.37]
Length=521

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            +VFVGSIDQGTTSTRF++++R    V SHQIEF Q YP  GW EHDP+EI+ SV+ C+  
Sbjct  16   EVFVGSIDQGTTSTRFLVFNRHGEVVASHQIEFKQIYPHPGWHEHDPLEIISSVEQCIDG  75

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV      GH    + KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL+  
Sbjct  76   AVKDLENQGHASASI-KAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALIRKLKHR  134

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G     E CGLP+STY S  KLLWLL+N   VKEA   G   FGTID WL++ + GG
Sbjct  135  L--GSDQLQELCGLPLSTYPSVGKLLWLLDNEPKVKEAYDKGILAFGTIDAWLVYKLNGG  192

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
              K + V+D +NASRTM MNLKTLD+D
Sbjct  193  PKKNVFVSDPTNASRTMFMNLKTLDYD  219



>ref|XP_006679867.1| hypothetical protein BATDEDRAFT_25739 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79188.1| hypothetical protein BATDEDRAFT_25739 [Batrachochytrium dendrobatidis 
JAM81]
Length=272

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 148/206 (72%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            ++GSIDQGT+STRF+++D +   + SHQ EF Q  PQAGWVEHD   I ++V  C+ K V
Sbjct  4    YIGSIDQGTSSTRFMVFDTAGHIIASHQTEFAQVLPQAGWVEHDLEVIYQTVVTCIQKTV  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
               +A G     + KAIGITNQRETT VW +  G PL++AIVW+D RT     +L    P
Sbjct  64   VDMSAMGLQPLDI-KAIGITNQRETTCVWDRLDGKPLHHAIVWLDTRTQDTVERLIAATP  122

Query  445  G-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
               + HF   CGLP+STYFSA+KL WLL+N++AV++A +    +FGTID+WLI+ +TGGV
Sbjct  123  SKSKHHFQSICGLPLSTYFSAVKLRWLLDNIKAVQDANQTDRLMFGTIDSWLIYRLTGGV  182

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWD  699
              G+HVTDV+NASRTML+NLK+LDWD
Sbjct  183  QGGIHVTDVTNASRTMLLNLKSLDWD  208



>gb|KEF52126.1| glycerol kinase [Exophiala aquamarina CBS 119918]
Length=512

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 149/217 (69%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M   ++VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSTQEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVASVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GH+V   +KA+GITNQRETTV+W K +G PLYNAIVW D RT S+ R
Sbjct  61   TCIDGAVKQFETQGHSVNS-IKAVGITNQRETTVLWDKETGEPLYNAIVWTDTRTQSLIR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G        GLP+STY S  KLLWLLEN   VK A   G   FGTID WL++
Sbjct  120  KLKTRL--GADKLTAISGLPLSTYPSVGKLLWLLENEPKVKAAYDKGTLSFGTIDAWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + + V+D SNASRT+ MN++TL +D   L+
Sbjct  178  KLNGGPKRNVFVSDPSNASRTLFMNIETLKYDDSLLD  214



>gb|KIX93773.1| hypothetical protein Z520_10397 [Fonsecaea multimorphosa CBS 
102226]
Length=517

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 146/211 (69%), Gaps = 3/211 (1%)
 Frame = +1

Query  67   SKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKV  246
            +K  + F+GSIDQGTTSTRF+I++R    + SHQIEF Q YP  GW EHDP+EI+ SV+ 
Sbjct  8    NKSHETFIGSIDQGTTSTRFLIFNRHGEVIASHQIEFKQIYPHPGWHEHDPLEIISSVEQ  67

Query  247  CVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRK  426
            C+  AV      GH    + KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RK
Sbjct  68   CIDGAVKDLETQGHASANI-KAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALIRK  126

Query  427  LEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWN  606
            L+  L  G     + CGLP+STY S  KLLWLL+N   VKEA + G+  FGTID WL++ 
Sbjct  127  LKHRL--GSDQLQQLCGLPLSTYPSVGKLLWLLDNEPKVKEAYEKGNLAFGTIDAWLVYK  184

Query  607  MTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            + GG  K + V+D +NASRTM MNL TLD+D
Sbjct  185  LNGGPKKNVFVSDPTNASRTMFMNLTTLDYD  215



>ref|XP_010761524.1| glycerol kinase [Paracoccidioides brasiliensis Pb18]
 gb|EEH49997.1| glycerol kinase [Paracoccidioides brasiliensis Pb18]
Length=510

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 152/217 (70%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    + FVGSIDQGTTS+RF+I+  +   V SHQ+EF Q Y Q GW EHDP+EI++SV+
Sbjct  1    MGCANESFVGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYSQPGWHEHDPLEIVESVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV    + GH++   +KAIGITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-ESIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L+  L  G     E CGLP+STY S  KLLW++ENV  VKEA + G   FGTIDTWL++
Sbjct  120  RLKSRL--GANELQELCGLPLSTYPSVGKLLWMMENVRKVKEAYEKGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + ++VTD SNASRTM MN++TL +D   +E
Sbjct  178  RLNGGTEREIYVTDPSNASRTMFMNIRTLQYDDQLIE  214



>ref|WP_038679022.1| glycerol kinase [Pimelobacter simplex]
Length=512

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 148/210 (70%), Gaps = 5/210 (2%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVG+IDQGTTSTRF+++D +   V  HQ+E  Q  P+AGWVEH+PVEI +     V  A+
Sbjct  7    FVGAIDQGTTSTRFMVFDHAGTEVARHQLEHQQLLPRAGWVEHNPVEIWERTSAVVQTAL  66

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             KA     +    L AIGITNQRETT+VW + +G PLYNAIVW D RT +I   L+++  
Sbjct  67   GKARLGAED----LAAIGITNQRETTIVWHRRTGRPLYNAIVWQDTRTDAIAAALDRDGA  122

Query  445  GGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            GGR   +    GLP +TYFS  KL W+LENV  V+EA + GDALFGT DTW++WN+TGG 
Sbjct  123  GGRGDVIRHRAGLPPATYFSGGKLQWILENVPGVREAAERGDALFGTPDTWILWNLTGGT  182

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
              G+HVTDV+NASRTMLM+L+TL+WD   L
Sbjct  183  DGGVHVTDVTNASRTMLMDLETLNWDDELL  212



>gb|EPB83489.1| glycerol kinase [Mucor circinelloides f. circinelloides 1006PhL]
Length=513

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 155/211 (73%), Gaps = 5/211 (2%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            ++G+IDQGTTSTRF+I+D++   V SHQ+EF Q YP+ GW+EHDP ++L SV  C  +AV
Sbjct  4    YIGAIDQGTTSTRFLIFDQAGNHVTSHQLEFEQIYPRPGWIEHDPYDLLDSVIRCSDEAV  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL-EKEL  441
             K    GH++  L KA+GI NQRETT++W + +G PLYNAIVW D RT ++ ++L EK+ 
Sbjct  64   RKFGMMGHDITDL-KAVGICNQRETTLIWDRKTGEPLYNAIVWGDTRTNNLVKELAEKQT  122

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
                 +  E CGLPI  YFSA+K+ WL++ +  VK AV+N  A+FGT+DTWLIWN+TGG+
Sbjct  123  D---LNVQEICGLPIHNYFSAVKVRWLMDRIPKVKFAVENKRAMFGTVDTWLIWNLTGGI  179

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              G H+TDV+NASRTM MNLK+ +WD   L+
Sbjct  180  QAGKHITDVTNASRTMFMNLKSREWDQRLLD  210



>gb|KIW98601.1| glycerol kinase [Cladophialophora bantiana CBS 173.52]
Length=515

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            + FVGSIDQGTTSTRF+I++R+   + SHQ+EF Q YP  GW EHDP+EI+ SV+ C+  
Sbjct  10   ETFVGSIDQGTTSTRFLIFNRNGEVIASHQMEFKQIYPHPGWHEHDPLEIISSVEQCIDG  69

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV      GH    + KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL+  
Sbjct  70   AVQDLETQGHASANI-KAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALVRKLKHR  128

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G     E CGLP+STY S  KLLWLL+N   VKEA   G   FGTID WL++ + GG
Sbjct  129  L--GSDQLQELCGLPLSTYPSVGKLLWLLDNEPKVKEAYDKGILAFGTIDAWLVYKLNGG  186

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
              K + V+D +NASRTM MNLKTLD+D
Sbjct  187  PKKNVFVSDPTNASRTMFMNLKTLDYD  213



>ref|XP_009055569.1| hypothetical protein LOTGIDRAFT_209470, partial [Lottia gigantea]
 gb|ESO93953.1| hypothetical protein LOTGIDRAFT_209470, partial [Lottia gigantea]
Length=551

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 155/214 (72%), Gaps = 3/214 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSV  240
            M+   +  VG++DQGT+STRF+I+  ++A  +  HQ E  Q+YP+ GWVE DP+EIL+SV
Sbjct  1    MATSRKPLVGAVDQGTSSTRFLIFSSQTAELITYHQTEIQQYYPRDGWVEEDPMEILESV  60

Query  241  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  420
            K C+ KAVD     G +   + K IGITNQRETTVVW K +G PL+NAIVW+D RT S  
Sbjct  61   KTCMEKAVDNLKVLGRDPVDI-KCIGITNQRETTVVWDKITGQPLHNAIVWLDVRTASTV  119

Query  421  RKLEKELPGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWL  597
             +L  + P     ++   CGLP++TYFSA+K+ WL++N E V+EA+++G  +FGTID+WL
Sbjct  120  EELVNKTPEKDKDYLRPYCGLPLATYFSAVKVKWLMDNCEKVREAIRDGRCMFGTIDSWL  179

Query  598  IWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            +WN+TGG  KG H+TDV+NASRTMLMNL  L WD
Sbjct  180  VWNLTGGPEKGQHITDVTNASRTMLMNLHNLQWD  213



>gb|ESZ94780.1| glycerol kinase [Sclerotinia borealis F-4157]
Length=514

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = +1

Query  52   GERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  231
            G+R +    + F+GSIDQGTTSTRF+I++R   PV SHQ+EF+Q YPQ+GW EHDP+EI+
Sbjct  2    GDRNLVSSHESFIGSIDQGTTSTRFLIFNREGEPVASHQVEFSQIYPQSGWHEHDPLEII  61

Query  232  KSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  411
             S++ C+  AV +    GH + R +KA+G+TNQRETTVVW   +G PL NAIVW D R  
Sbjct  62   DSIEACIEGAVKQLEEQGH-LARQIKAVGLTNQRETTVVWDHETGEPLANAIVWTDTRNQ  120

Query  412  SICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDT  591
            ++ RKL+  L  G       CGLP+STY S  KLLWL+EN + V +A   G   FGT+D 
Sbjct  121  ALVRKLKLRL--GSDKLQSLCGLPLSTYPSVGKLLWLIENNDKVADAYARGHLAFGTVDA  178

Query  592  WLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            W+I+ + GG  K + VTD +NASR+M MNL TL +D   L+
Sbjct  179  WVIYKLNGGPKKNVFVTDPTNASRSMFMNLHTLKYDDQLLD  219



>gb|KEZ40309.1| Glycerol kinase 2 [Scedosporium apiospermum]
Length=554

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 164/239 (69%), Gaps = 11/239 (5%)
 Frame = +1

Query  4    P*THRQSANCIHTREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQ  183
            P    +  + I   EEG++      + FVGSIDQGTTS+RF+I++    PV SHQIEF  
Sbjct  20   PPAKERLPDGITATEEGQKN-----RWFVGSIDQGTTSSRFLIFNGDGDPVASHQIEFEN  74

Query  184  FYPQAGWVEHDPVEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSS  363
             YP++GW EHDP+E+L+SV+ C+  AV   T  G+++ R ++++GITNQRETT+VW   +
Sbjct  75   LYPESGWHEHDPLELLRSVEKCIEGAVANFTKAGNDISR-IRSVGITNQRETTIVWDTQT  133

Query  364  GLPLYNAIVWMDARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAV  543
            G PLYNA+VW D RT  + R+L  +   G    +  CGLP+STY S++KLLWL+ENVEAV
Sbjct  134  GEPLYNAVVWPDTRTKHLVRELRNK--EGADDLLNLCGLPLSTYPSSVKLLWLIENVEAV  191

Query  544  KEAVKNGDALFGTIDTWLIWNMTGGVGK---GLHVTDVSNASRTMLMNLKTLDWDXPTL  711
            K+A + G   FGT+D+WLI+ + GG  +   G+HVTD +NASRTM MNL+TL +D   L
Sbjct  192  KKAYEEGRLAFGTVDSWLIYRLNGGAKQENGGIHVTDATNASRTMFMNLRTLQYDDKLL  250



>gb|KFY31403.1| hypothetical protein V493_01143 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=513

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 152/211 (72%), Gaps = 3/211 (1%)
 Frame = +1

Query  82   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
            +F+GSIDQGTTS+RF+I++ +  PV SHQIEF Q YPQ GW EHDP+EI+ SV+ C+  A
Sbjct  10   LFIGSIDQGTTSSRFLIFNEAGDPVASHQIEFKQIYPQPGWHEHDPLEIVSSVEKCIDSA  69

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            V   T  GH +G+ +KAIGITNQRETTVVW++ +G PLYNAIVW D RT ++ R L++ L
Sbjct  70   VSAFTKQGHFLGQ-IKAIGITNQRETTVVWNQETGEPLYNAIVWTDTRTQALVRALKERL  128

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
              G    +E  G+P+STY S  KLLWLL N   V++A + G   FGTIDTWL++ + GG 
Sbjct  129  --GADKILERVGVPLSTYPSIGKLLWLLHNEPKVQDAFERGILAFGTIDTWLVYKLNGGP  186

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             K + VTD SNASRTMLMN+ TL +D   ++
Sbjct  187  EKNVFVTDPSNASRTMLMNINTLQYDEAVID  217



>ref|XP_001796578.1| hypothetical protein SNOG_06196 [Phaeosphaeria nodorum SN15]
 gb|EAT86027.1| hypothetical protein SNOG_06196 [Phaeosphaeria nodorum SN15]
Length=550

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 153/225 (68%), Gaps = 3/225 (1%)
 Frame = +1

Query  40   TREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDP  219
            T++  +    K +  F+GSIDQGTTSTRFII+D    PV  HQIEFTQ YPQ+GW EHDP
Sbjct  22   TQDGSQLDEEKLKNFFIGSIDQGTTSTRFIIFDGLGEPVAQHQIEFTQKYPQSGWHEHDP  81

Query  220  VEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  399
             EI+ SV+ C+ +A        H +  + KAIGITNQRETTVVW   +G PLYNAI W D
Sbjct  82   KEIIASVEECMERATSIFVDMEHEISDI-KAIGITNQRETTVVWDTHTGEPLYNAIAWPD  140

Query  400  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFG  579
             RT  + R+L+     G     + CGLP+STY S++KL+WLL++V+AVKEA   G   FG
Sbjct  141  TRTKGLVRELKAR--DGADKLQDMCGLPLSTYPSSVKLMWLLQHVDAVKEAYDEGRLSFG  198

Query  580  TIDTWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TIDTW+++N+ GG  + LHVTD +NASRTM MNL T+ +D   LE
Sbjct  199  TIDTWILYNLNGGKERDLHVTDTTNASRTMFMNLHTVQYDDQLLE  243



>ref|XP_002843966.1| glycerol kinase 2 [Arthroderma otae CBS 113480]
 gb|EEQ34930.1| glycerol kinase 2 [Arthroderma otae CBS 113480]
Length=514

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 149/217 (69%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + F+GSIDQGTTS+RF+I++     V SHQ+EFTQ YP  GW EHDP EI++SV 
Sbjct  1    MAGVGKSFIGSIDQGTTSSRFLIFNTDGEVVASHQLEFTQIYPHPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C++ AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT ++ R
Sbjct  61   ACINGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G       CGLP+STY S  K+LWL++NV  VKEA  NG   FGTIDTWLI+
Sbjct  120  KLKTRL--GHNELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDNGSLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG   G+ VTD SNASRTM MNL+ +++D   L+
Sbjct  178  KLNGGPRGGVFVTDPSNASRTMFMNLERMEYDEQLLD  214



>ref|WP_016329086.1| glycerol kinase [Thermus oshimai]
 gb|AFV75894.1| glycerol kinase [Thermus oshimai JL-2]
Length=502

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 151/210 (72%), Gaps = 6/210 (3%)
 Frame = +1

Query  82   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
            +++G++DQGTTSTRF+++DR  R +  HQ+E  Q YP+ GWVEHDP+EI    +  +  A
Sbjct  1    MYIGALDQGTTSTRFMVFDRQGREIARHQLEHRQIYPRPGWVEHDPLEIWARTQEAIQGA  60

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            + KA   G   G L  A+GITNQRETTVVW+K++G P +NAIVW D RT +IC  L+ E 
Sbjct  61   LAKA---GVRPGEL-AALGITNQRETTVVWNKNTGEPYHNAIVWQDTRTDAICEALKAE-  115

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
             G    F +  GLP+STYFS  KL W+L++V  V+EA + GDALFGT+DTWLIW +TGG 
Sbjct  116  -GLEEVFRKKTGLPLSTYFSGPKLKWILDHVPGVREAAERGDALFGTVDTWLIWWLTGGP  174

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
              G HVTDV+NASRT+LMNLKTLDWD   L
Sbjct  175  KGGRHVTDVTNASRTLLMNLKTLDWDEELL  204



>ref|WP_011956505.1| glycerol kinase [Roseiflexus sp. RS-1]
 sp|A5UU55.1|GLPK_ROSS1 RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Roseiflexus 
sp. RS-1]
 gb|ABQ90158.1| glycerol kinase [Roseiflexus sp. RS-1]
Length=498

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 148/210 (70%), Gaps = 6/210 (3%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            +V ++DQGTTSTR +I+D + R V   Q E TQ YPQ GWVEHDP+EI    +  +  A+
Sbjct  4    YVAAVDQGTTSTRCMIFDHAGRVVAVDQKEHTQIYPQPGWVEHDPLEIWTRTQEVIDGAL  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             K+  +   +     A+G+TNQRETTVVW K++G P+YNAIVW D RT  IC +L ++  
Sbjct  64   RKSGVERSEIA----AVGVTNQRETTVVWEKATGKPVYNAIVWQDTRTDQICNQLAQD--  117

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GG+  F    GLP++TYFS  K+ W+L+NV  V+E  + G+ LFG IDTWLIWNMTGGV 
Sbjct  118  GGQDRFRPKVGLPLATYFSGPKITWILDNVPGVREKAEQGEVLFGNIDTWLIWNMTGGVN  177

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             G+H+TDVSNASRTMLMNL+TLDWD   L+
Sbjct  178  GGVHITDVSNASRTMLMNLETLDWDDDILD  207



>gb|EEH23527.1| glycerol kinase [Paracoccidioides brasiliensis Pb03]
Length=510

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 152/217 (70%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    + FVGSIDQGTTS+RF+I+  +   V SHQ+EF Q Y Q GW EHDP+EI++SV+
Sbjct  1    MGCANESFVGSIDQGTTSSRFLIFSAAGDVVASHQLEFRQIYSQPGWHEHDPLEIVESVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV    + GH++   +KAIGITNQRETTVVW + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVASFESQGHSI-ESIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQALVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L+  L  G     + CGLP+STY S  KLLW++ENV  VKEA + G   FGTIDTWL++
Sbjct  120  RLKSRL--GANELQDLCGLPLSTYPSVGKLLWMIENVRKVKEAYEKGVLAFGTIDTWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  + ++VTD SNASRTM MN++TL +D   +E
Sbjct  178  RLNGGTEREIYVTDPSNASRTMFMNIRTLQYDDQLIE  214



>ref|XP_007739070.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
 gb|EXJ75753.1| glycerol kinase [Cladophialophora psammophila CBS 110553]
Length=515

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSK  258
            + FVGSIDQGTTSTRF+I+ R+   + SHQ+EF Q YP  GW EHDP+EI+ SV+ C+  
Sbjct  10   ETFVGSIDQGTTSTRFLIFSRNGEVIASHQMEFKQIYPHPGWHEHDPLEIISSVEQCIDG  69

Query  259  AVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            AV      GH    + KA+GITNQRETTVVW+  +G PLYNAIVW D RT ++ RKL+  
Sbjct  70   AVKDLETQGHASANI-KAVGITNQRETTVVWNHETGEPLYNAIVWTDTRTQALIRKLKHR  128

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            L  G     E CGLP+STY S  KLLWLL+N   VKEA   G   FGTID WL++ + GG
Sbjct  129  L--GSDQLQELCGLPLSTYPSVGKLLWLLDNEPKVKEAYDKGILAFGTIDAWLVYKLNGG  186

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
              K + V+D +NASRTM MNLKTLD+D
Sbjct  187  PKKNVFVSDPTNASRTMFMNLKTLDYD  213



>ref|XP_002837355.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81546.1| unnamed protein product [Tuber melanosporum]
Length=560

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 149/214 (70%), Gaps = 3/214 (1%)
 Frame = +1

Query  58   RKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKS  237
            R  + E + F  +IDQGTTS+RF+I+D S  P   HQ+EF Q YP +GWVEHDP EIL S
Sbjct  41   RLKNGEREAFTAAIDQGTTSSRFLIFDGSGTPRAGHQVEFEQLYPHSGWVEHDPYEILNS  100

Query  238  VKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSI  417
            V  C+  A       G+ VG + KA+GITNQRETTVVW   +G PLYNAIVW D RT+ +
Sbjct  101  VNECIENATKMFFDQGYGVGDI-KALGITNQRETTVVWDTETGKPLYNAIVWPDTRTSKL  159

Query  418  CRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWL  597
              +L ++  GG     + CGLP+STY S++KL+W+L +V AV+ A+K     FGT+DTWL
Sbjct  160  VHELRRK--GGSEKLQQLCGLPLSTYPSSVKLMWMLRHVPAVQSALKKDRLSFGTVDTWL  217

Query  598  IWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            ++N+TGGV  GLHVTD +NASRTM  N+ TL++D
Sbjct  218  LYNLTGGVKNGLHVTDPTNASRTMFCNINTLEYD  251



>gb|KIW62746.1| glycerol kinase [Capronia semiimmersa]
Length=521

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 149/217 (69%), Gaps = 3/217 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    + F+GSIDQGTTS+RF+I++++  PV SHQ+EF Q YP  GW EHDP+EI+ SV+
Sbjct  10   MGSTSEHFIGSIDQGTTSSRFLIFNKAGEPVASHQLEFKQIYPHPGWHEHDPLEIVSSVE  69

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV++    GHN    +KAIGITNQRETTV+W+K +G PLYNAIVW D R  ++ R
Sbjct  70   QCIDGAVEQFENQGHNANS-IKAIGITNQRETTVLWNKETGEPLYNAIVWTDTRHQNLVR  128

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            KL+  L  G    ++  G+P+STY S  KLLWLLEN   VKEA   G   FGTID WL++
Sbjct  129  KLKHRL--GADQLIQLAGVPLSTYPSVGKLLWLLENEPKVKEAYDKGVLAFGTIDAWLVY  186

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             + GG  K + V+D SNASRTM MN+ TL +D   L+
Sbjct  187  KLNGGPRKNIFVSDPSNASRTMFMNIHTLKYDESLLD  223



>ref|XP_011436346.1| PREDICTED: glycerol kinase-like isoform X2 [Crassostrea gigas]
Length=516

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIY-DRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            +  VG+IDQGT+S+RF+I+  ++   +  HQ E  Q  P+ GWVE DP EIL+SV VC+ 
Sbjct  4    KTLVGAIDQGTSSSRFLIFCSKTGELITYHQTEIQQLLPKEGWVEEDPKEILQSVHVCIE  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAV+   A   +V  + K +GITNQRETT+VW K +G PLYNAIVW+D RT+S   KL  
Sbjct  64   KAVENLQALNLSVSDI-KCVGITNQRETTIVWDKLTGQPLYNAIVWLDTRTSSTVDKLIA  122

Query  436  ELP-GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            + P   + H    CGLPI+TYFSA+KL WL+ENVE V++A++    LFGT+D+WL+WN+T
Sbjct  123  KTPQKDKDHLRAYCGLPITTYFSAVKLRWLMENVEPVRKAIQENRCLFGTVDSWLLWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            GGV  G+H TDV+NASRTMLMN+ TL WD
Sbjct  183  GGVSGGVHATDVTNASRTMLMNIHTLRWD  211



>ref|XP_005091681.1| PREDICTED: putative glycerol kinase 3-like [Aplysia californica]
Length=553

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 152/214 (71%), Gaps = 3/214 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVS-HQIEFTQFYPQAGWVEHDPVEILKSV  240
            M+  +   VG++DQGT+STRF++++     VV+ HQ+E TQ +P+ GWVE DP+EIL SV
Sbjct  1    MAAAKPKLVGAVDQGTSSTRFLVFNADTSEVVTYHQVEITQKFPKEGWVEEDPMEILNSV  60

Query  241  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  420
            KVC+ KAVD     G     + KAIGITNQRETT+VW K++G PLYNAIVW+D RT +  
Sbjct  61   KVCIEKAVDNLQGLGFQPSDV-KAIGITNQRETTIVWDKNTGKPLYNAIVWLDLRTAATV  119

Query  421  RKLEKELPG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWL  597
             +L K+ PG  +      CGLP++TYFSA+K  WL +N   V+ AV  G  +FGT+D+WL
Sbjct  120  EQLIKKTPGRDKDALRPLCGLPLATYFSALKFRWLADNSIEVRRAVDEGRCMFGTVDSWL  179

Query  598  IWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            +WN+TG    G H+TDV+NASRTML+NL TLDWD
Sbjct  180  VWNLTGATQGGQHITDVTNASRTMLLNLTTLDWD  213



>gb|KFA61070.1| hypothetical protein S40285_06341 [Stachybotrys chlorohalonata 
IBT 40285]
Length=539

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 158/222 (71%), Gaps = 6/222 (3%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E    K++  FVGSIDQGTTSTRF+I++    PV  HQIEF   YP +GW E DP+E+L+
Sbjct  20   ETAEEKKQHWFVGSIDQGTTSTRFLIFNGLGDPVAKHQIEFKNIYPHSGWHEQDPLELLR  79

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            SV+ C+ KA +   A GH V   ++++GITNQRETTV+W K++G PLYNA+ W D RTT+
Sbjct  80   SVETCIEKATEDFCAQGHTVSE-IRSVGITNQRETTVLWDKNTGEPLYNAVAWPDTRTTA  138

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            + R+L+     G    ++ CGLP+STY S++KLLWLL+NV++VK A   G  +FGT+D+W
Sbjct  139  LVRELKTR--DGADKLLDLCGLPLSTYPSSVKLLWLLQNVDSVKAAYDEGRLVFGTVDSW  196

Query  595  LIWNMTGGVGKG---LHVTDVSNASRTMLMNLKTLDWDXPTL  711
            LI+ + GG+ +    +HVTD +NASRTM MNL+TLD+D   L
Sbjct  197  LIFRLNGGIWRQDGPIHVTDSTNASRTMFMNLQTLDYDDSLL  238



>ref|WP_020624849.1| glycerol kinase [Pseudonocardia sp. P2]
Length=505

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 148/210 (70%), Gaps = 8/210 (4%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVG++DQGTTS+RF+I+D     V  HQ+E  Q  PQAGWVEHDP+EI++    C+ +A+
Sbjct  4    FVGAVDQGTTSSRFMIFDHGGNEVGRHQLEHEQILPQAGWVEHDPIEIIERTNTCLQQAL  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             K      +    L A+G+TNQRETTVVW++ +G P YNAIVW D RT  I   L+++  
Sbjct  64   TKTGLTASD----LVALGVTNQRETTVVWNRRTGRPYYNAIVWQDTRTDRIATALDRD--  117

Query  445  GGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
             GR   +    GLP +TYFS  K+ W+LENV+ V+EA +NGDA+FG  DTW+IWN+TGG 
Sbjct  118  -GRGDVIRRKAGLPPATYFSGGKIQWILENVDGVREAAENGDAVFGNTDTWVIWNLTGGA  176

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
              GLHVTDV+NASRTMLM+L+TLDWD   L
Sbjct  177  NGGLHVTDVTNASRTMLMDLETLDWDDELL  206



>ref|XP_008327167.1| PREDICTED: glycerol kinase-like [Cynoglossus semilaevis]
Length=521

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 155/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+IDQGT+STRF++++ ++A+ +  HQ+E  QF+P+ GWVE DP EI++SV  C+ + 
Sbjct  4    LVGAIDQGTSSTRFLVFNAKTAKLICQHQVEIKQFFPREGWVEEDPEEIIRSVYECIDRT  63

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      +V  + KA+G+TNQRETT+VW K++G PLYNAIVW+D RT S   +L  + 
Sbjct  64   CEKLVQLDIDVSSI-KAVGVTNQRETTLVWDKTTGRPLYNAIVWLDLRTQSTVERLIDKA  122

Query  442  PGG-RTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PGG + H  +  GLPISTYFSA+KL W+L++V+ V+ AV +G A+FGT+D+W+IW +TGG
Sbjct  123  PGGDKNHLRDKTGLPISTYFSALKLRWILDHVDEVQRAVVSGRAMFGTVDSWIIWRLTGG  182

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDVSNASRTML N+ TLDWD
Sbjct  183  RSGGVHCTDVSNASRTMLFNIHTLDWD  209



>emb|CCT70018.1| probable GUT1-glycerol kinase [Fusarium fujikuroi IMI 58289]
Length=606

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 164/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  77   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPM  136

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  137  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  195

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+S+ R+L K  PG      +TCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  196  RTSSLVREL-KNKPGAE-KLQKTCGLPLSTYPSSVKLLWVLQNVESVRKAYNEGRLSFGT  253

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+N+ GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  254  VDSWLIYNLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  300



>ref|XP_011436344.1| PREDICTED: glycerol kinase-like isoform X1 [Crassostrea gigas]
Length=547

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIY-DRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            +  VG+IDQGT+S+RF+I+  ++   +  HQ E  Q  P+ GWVE DP EIL+SV VC+ 
Sbjct  4    KTLVGAIDQGTSSSRFLIFCSKTGELITYHQTEIQQLLPKEGWVEEDPKEILQSVHVCIE  63

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            KAV+   A   +V  + K +GITNQRETT+VW K +G PLYNAIVW+D RT+S   KL  
Sbjct  64   KAVENLQALNLSVSDI-KCVGITNQRETTIVWDKLTGQPLYNAIVWLDTRTSSTVDKLIA  122

Query  436  ELP-GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            + P   + H    CGLPI+TYFSA+KL WL+ENVE V++A++    LFGT+D+WL+WN+T
Sbjct  123  KTPQKDKDHLRAYCGLPITTYFSAVKLRWLMENVEPVRKAIQENRCLFGTVDSWLLWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            GGV  G+H TDV+NASRTMLMN+ TL WD
Sbjct  183  GGVSGGVHATDVTNASRTMLMNIHTLRWD  211



>gb|AIK22411.1| glycerol kinase, partial [Pimelobacter simplex]
Length=505

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 147/209 (70%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   VGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAVD  267
            VG+IDQGTTSTRF+++D +   V  HQ+E  Q  P+AGWVEH+PVEI +     V  A+ 
Sbjct  1    VGAIDQGTTSTRFMVFDHAGTEVARHQLEHQQLLPRAGWVEHNPVEIWERTSAVVQTALG  60

Query  268  KATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELPG  447
            KA     +    L AIGITNQRETT+VW + +G PLYNAIVW D RT +I   L+++  G
Sbjct  61   KARLGAED----LAAIGITNQRETTIVWHRRTGRPLYNAIVWQDTRTDAIAAALDRDGAG  116

Query  448  GRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GR   +    GLP +TYFS  KL W+LENV  V+EA + GDALFGT DTW++WN+TGG  
Sbjct  117  GRGDVIRHRAGLPPATYFSGGKLQWILENVPGVREAAERGDALFGTPDTWILWNLTGGTD  176

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
             G+HVTDV+NASRTMLM+L+TL+WD   L
Sbjct  177  GGVHVTDVTNASRTMLMDLETLNWDDELL  205



>ref|XP_005484433.1| PREDICTED: glycerol kinase isoform X2 [Zonotrichia albicollis]
Length=519

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSH-QIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+IDQGT+STRF++++     ++SH Q+E  Q +P+ GWVE DP EIL SV  CV + 
Sbjct  8    LVGAIDQGTSSTRFLVFNAGTAELLSHHQVELKQEFPKEGWVEQDPKEILDSVHECVERT  67

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + +AIG+TNQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  68   CEKMKELNIDIANI-RAIGVTNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  126

Query  442  PGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG    F+++  GLP+STYFSA+KL WLL+NVE +K+AV++G A+FGTID+WLIW +TGG
Sbjct  127  PGHNKSFLKSKTGLPLSTYFSAVKLRWLLDNVEEIKKAVEDGRAMFGTIDSWLIWCLTGG  186

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
            +  G+H TDV+NASRTML N+ +L+WD
Sbjct  187  INGGIHCTDVTNASRTMLFNIHSLEWD  213



>ref|XP_007290490.1| glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
 gb|EKD19364.1| glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
Length=579

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 149/213 (70%), Gaps = 3/213 (1%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            ++ ++GSIDQGTTSTRF+I++R   PV SHQ+EF Q+YPQ GW EHDP EI+ S++ C+ 
Sbjct  74   QEAYIGSIDQGTTSTRFLIFNREGEPVASHQVEFKQYYPQPGWHEHDPREIITSIETCIE  133

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
             AV+    +GH+V R +KA+GITNQRETTVVW   +G PLYNAIVW D RT ++ RKL+ 
Sbjct  134  GAVEAFEENGHSV-RSIKAVGITNQRETTVVWDNVTGDPLYNAIVWTDTRTQALIRKLKL  192

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
             L  G     + CGLP+STY S  KLLWL+EN   V +A   G   FGT+D W+++ + G
Sbjct  193  RL--GSDQLQDICGLPLSTYPSVGKLLWLIENEPKVADAYARGTLAFGTMDAWVVYRLNG  250

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G  K + VTD +NASR+M MNL TL +D   L+
Sbjct  251  GPKKNIFVTDPTNASRSMFMNLSTLKYDERLLD  283



>ref|XP_005484432.1| PREDICTED: glycerol kinase isoform X1 [Zonotrichia albicollis]
Length=525

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSH-QIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+IDQGT+STRF++++     ++SH Q+E  Q +P+ GWVE DP EIL SV  CV + 
Sbjct  8    LVGAIDQGTSSTRFLVFNAGTAELLSHHQVELKQEFPKEGWVEQDPKEILDSVHECVERT  67

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + +AIG+TNQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  68   CEKMKELNIDIANI-RAIGVTNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  126

Query  442  PGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG    F+++  GLP+STYFSA+KL WLL+NVE +K+AV++G A+FGTID+WLIW +TGG
Sbjct  127  PGHNKSFLKSKTGLPLSTYFSAVKLRWLLDNVEEIKKAVEDGRAMFGTIDSWLIWCLTGG  186

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
            +  G+H TDV+NASRTML N+ +L+WD
Sbjct  187  INGGIHCTDVTNASRTMLFNIHSLEWD  213



>gb|EGD95974.1| glycerol kinase [Trichophyton tonsurans CBS 112818]
Length=514

 Score =   239 bits (611),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 146/212 (69%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHRKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L+  L  G       CGLP+STY S  K+LWL+ENV  V+EA   G   FGTIDTWLI+
Sbjct  120  RLKSRL--GHKELQPICGLPLSTYPSVGKVLWLIENVPQVREAYDEGKLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD +NASRTM MNL+ +++D
Sbjct  178  KLNGGPKGGVFVTDPTNASRTMFMNLEKVEYD  209



>ref|XP_007289663.1| putative glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD19822.1| putative glycerol kinase [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=648

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 152/220 (69%), Gaps = 3/220 (1%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E    K++  F+GSID GTTS+RF+I++    PV SHQIEF   YP++GW EH+P E++ 
Sbjct  119  ETDEEKQKHWFIGSIDCGTTSSRFLIFNGEGNPVASHQIEFDNIYPESGWHEHNPQELVA  178

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            SV+ C+ KA  K   DG+   ++ KAIGITNQRETT+ W  ++G PLYNAIVW D RTTS
Sbjct  179  SVEECIDKATAKFQEDGYTTSQI-KAIGITNQRETTICWDTNTGEPLYNAIVWPDTRTTS  237

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            I R+L+K    G     + CGLP+STY S++KLLWL  NV+AVK A   G   FGT+DTW
Sbjct  238  IVRELKKRE--GADELQQLCGLPLSTYPSSVKLLWLCRNVDAVKNAYDEGRLSFGTVDTW  295

Query  595  LIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            LI+ + GG   G+HVTD SNASRTM MNL TL +D   L+
Sbjct  296  LIFKLNGGKEAGIHVTDSSNASRTMFMNLHTLQYDDKLLD  335



>gb|ENN76749.1| hypothetical protein YQE_06814, partial [Dendroctonus ponderosae]
Length=509

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 151/209 (72%), Gaps = 5/209 (2%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVV-SHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             +G+ID+GT+S RFI++      VV SHQ   +Q  PQ GWVE DP+EIL  V  C+ K 
Sbjct  4    LIGAIDEGTSSARFILFKAGTTEVVASHQQSLSQICPQEGWVEQDPMEILSVVNTCIEKT  63

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            +DK  + G +V  +  A+G+TNQRE+T+VW KS+G PLYN+IVW+D RT++   +L +++
Sbjct  64   IDKLISIGGSVNDI-AAVGVTNQRESTLVWEKSTGKPLYNSIVWLDVRTSTTVDQLLEKI  122

Query  442  PG---GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            P     + +    CGLPIS YFSA+KL WL++NV+ VK+A+   D LFGT+D+WLIWN+T
Sbjct  123  PNKTKNKNYLKPLCGLPISPYFSALKLRWLIDNVQNVKKAIAANDCLFGTVDSWLIWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            GGV  GLH+TDV+NASRTMLMN+ TL WD
Sbjct  183  GGVNNGLHLTDVTNASRTMLMNIDTLKWD  211



>gb|AEE61761.1| unknown [Dendroctonus ponderosae]
 gb|ERL90389.1| hypothetical protein D910_07738 [Dendroctonus ponderosae]
Length=509

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 151/209 (72%), Gaps = 5/209 (2%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVV-SHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             +G+ID+GT+S RFI++      VV SHQ   +Q  PQ GWVE DP+EIL  V  C+ K 
Sbjct  4    LIGAIDEGTSSARFILFKAGTTEVVASHQQSLSQICPQEGWVEQDPMEILSVVNTCIEKT  63

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            +DK  + G +V  +  A+G+TNQRE+T+VW KS+G PLYN+IVW+D RT++   +L +++
Sbjct  64   IDKLISIGGSVNDI-AAVGVTNQRESTLVWEKSTGKPLYNSIVWLDVRTSTTVDQLLEKI  122

Query  442  PG---GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            P     + +    CGLPIS YFSA+KL WL++NV+ VK+A+   D LFGT+D+WLIWN+T
Sbjct  123  PNKTKNKNYLKPLCGLPISPYFSALKLRWLIDNVQNVKKAIAANDCLFGTVDSWLIWNLT  182

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            GGV  GLH+TDV+NASRTMLMN+ TL WD
Sbjct  183  GGVNNGLHLTDVTNASRTMLMNIDTLKWD  211



>gb|EFX79590.1| hypothetical protein DAPPUDRAFT_319506 [Daphnia pulex]
Length=539

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 158/217 (73%), Gaps = 3/217 (1%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEIL  231
            +++M  +    +G+IDQGT+S+RF+++  + A  +  HQ+E  Q  PQ GWVE DP+E+L
Sbjct  9    KKEMVGKYGPLIGAIDQGTSSSRFLVFSAQRAELITYHQVEVNQLTPQEGWVESDPMELL  68

Query  232  KSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  411
            ++V  CV K V+   +   + G + KAIG+ NQRETT+VW K +G PLYNAI+W+DART 
Sbjct  69   QTVIDCVCKTVENLKSLDVDPGDI-KAIGVCNQRETTIVWDKLTGKPLYNAIIWLDARTK  127

Query  412  SICRKLEKELPGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTID  588
            S    +  ++ GG   F++  CGLPISTYFSA+KL WL++NV  V++A+     LFGT+D
Sbjct  128  STVESMLSKVQGGNKDFLKRHCGLPISTYFSALKLRWLIDNVAEVRDAIDENRCLFGTVD  187

Query  589  TWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            TWLIWN+TGGV  GLH+TDV+NASRTMLMNL+TL+WD
Sbjct  188  TWLIWNLTGGVKGGLHLTDVTNASRTMLMNLETLNWD  224



>gb|EGE01178.1| glycerol kinase [Trichophyton equinum CBS 127.97]
Length=514

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 146/212 (69%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHRKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L+  L  G       CGLP+STY S  K+LWL+ENV  V+EA   G   FGTIDTWLI+
Sbjct  120  RLKSRL--GHKELQPICGLPLSTYPSVGKVLWLIENVPKVREAYDEGKLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD +NASRTM MNL+ +++D
Sbjct  178  KLNGGPKGGVFVTDPTNASRTMFMNLEKVEYD  209



>ref|XP_003845263.1| similar to glycerol kinase [Leptosphaeria maculans JN3]
 emb|CBY01784.1| similar to glycerol kinase [Leptosphaeria maculans JN3]
Length=551

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 148/213 (69%), Gaps = 3/213 (1%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            +Q F+GSIDQGTTSTRFII+D    PV  HQIEF Q+YPQ+GW EHDP EI+ SV+ C+ 
Sbjct  35   KQFFIGSIDQGTTSTRFIIFDGVGDPVAQHQIEFKQYYPQSGWHEHDPKEIITSVEECID  94

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            +A +     GH+V  + KA+GITNQRETTVVW   +G PLYNAI W D RT  + R+L+ 
Sbjct  95   RATNIFLDQGHDVSDI-KAVGITNQRETTVVWDTKTGEPLYNAIAWPDTRTKGLVRELKN  153

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
                G    +  CGLP+STY S++KL W+L++VE  ++A   G   FGTIDTW+++N+ G
Sbjct  154  R--KGADELLNICGLPLSTYPSSVKLRWILDHVEPARKAYDEGRLSFGTIDTWILYNLNG  211

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G    +HVTD +NASRTM MNL T+ +D   LE
Sbjct  212  GKEADIHVTDATNASRTMFMNLHTVQYDDKLLE  244



>ref|WP_014445904.1| glycerol kinase [Actinoplanes missouriensis]
 dbj|BAL91016.1| putative glycerol kinase [Actinoplanes missouriensis 431]
Length=505

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 144/210 (69%), Gaps = 8/210 (4%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVG++DQGTTSTRF+I+D     V  HQ+E  Q  PQAGWVEH+P+EI +     V  A+
Sbjct  4    FVGAVDQGTTSTRFMIFDHGGNEVARHQLEHEQILPQAGWVEHNPIEIWERTVAVVRTAM  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             KA     +    L A+GITNQRETTVVW + +G P YNAIVW D RT  I   L+++  
Sbjct  64   QKANLSASD----LAAVGITNQRETTVVWDRRTGRPYYNAIVWQDTRTDRIASALDRD--  117

Query  445  GGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
             GR   +    GLP +TYFS  K+ W+LENV+ V+EA + GDA+FG  D+WLIWNMTGGV
Sbjct  118  -GRGDVIRRKAGLPPATYFSGGKIQWILENVDGVREAAERGDAIFGNTDSWLIWNMTGGV  176

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
              G HVTDV+NASRTMLMNL+TLDWD   L
Sbjct  177  DGGRHVTDVTNASRTMLMNLETLDWDDELL  206



>gb|EEH64510.1| glycerol kinase [Actinomyces coleocanis DSM 15436]
Length=535

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 154/214 (72%), Gaps = 8/214 (4%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E KM+  E+ +V SIDQGTTS+R I++D + + V   Q+E  Q +P+AGWVEH+PVEI +
Sbjct  25   ENKMT--EKKYVLSIDQGTTSSRAIVFDHAGKIVSVGQLEHEQIFPKAGWVEHNPVEIWE  82

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            +++  V +A+ KA  + H+    L A+GITNQRETTVVW K++G P+YNAIVW D RT  
Sbjct  83   NIREAVGQALSKAEINRHD----LAAVGITNQRETTVVWDKNTGEPVYNAIVWQDTRTAE  138

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            I R+L  E+  G   + E CGLP++TYFS  K+ W+L+NVE  +E  + GD LFG  DTW
Sbjct  139  IVRELAGEV--GNDKYKEICGLPLATYFSGPKIKWILDNVEGAREKAEAGDLLFGNTDTW  196

Query  595  LIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDW  696
             +WN+TGGV  G+H TDVSNASRTMLM+LKTL W
Sbjct  197  TLWNLTGGVNGGVHATDVSNASRTMLMDLKTLQW  230



>gb|KIV91759.1| glycerol kinase [Exophiala mesophila]
Length=512

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 146/212 (69%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M    +VFVGSIDQGTTS+RF+I+++   PV SHQ+EF Q YPQ GW EHDP+EI+ SV+
Sbjct  1    MGSTSEVFVGSIDQGTTSSRFLIFNKQGEPVASHQLEFKQIYPQPGWHEHDPLEIVSSVE  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV +    GHN+   +KAIGITNQRETTV+W + +G PLYNAIVW D RT ++ R
Sbjct  61   KCIDGAVAQFETQGHNINS-IKAIGITNQRETTVLWDQQTGEPLYNAIVWTDTRTQNMIR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            K++  L  G     E  GLP+STY S  KLLWLLEN   VK A   G   FGTID WL++
Sbjct  120  KIKHRL--GADLLNEISGLPLSTYPSVGKLLWLLENEPKVKTAYDKGVLAFGTIDAWLVY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG  + + V+D SNASRT+ MN+ TL +D
Sbjct  178  KLNGGPKRNIFVSDPSNASRTLFMNISTLQYD  209



>ref|WP_012851581.1| glycerol kinase [Thermomonospora curvata]
 gb|ACY96797.1| glycerol kinase [Thermomonospora curvata DSM 43183]
Length=505

 Score =   239 bits (609),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 149/210 (71%), Gaps = 8/210 (4%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVG++DQGTTSTRF+I+D     V  HQ+E  Q  P+AGWVEH+PVEI +  +  +  A+
Sbjct  4    FVGAVDQGTTSTRFMIFDHGGNEVARHQLEHEQILPRAGWVEHNPVEIWERTRTVIETAL  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
            +KA        R L A+GITNQRET VVW++ +G P YNAIVW D RT  I   LE++  
Sbjct  64   NKADL----TARDLAALGITNQRETAVVWNRRTGRPYYNAIVWQDTRTDRIAAALERD--  117

Query  445  GGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
             GR   +    GLP +TYFSA K+ W+LENV  V+EA + G+ALFGTIDTWL+WN+TGGV
Sbjct  118  -GRGEVIRRKAGLPPATYFSAGKVQWILENVPGVREAAEAGEALFGTIDTWLLWNLTGGV  176

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
              G+HVTDV+NASRTMLM+L+TL+WD   L
Sbjct  177  DGGVHVTDVTNASRTMLMDLETLEWDEELL  206



>ref|NP_001004077.1| glycerol kinase 2 [Rattus norvegicus]
 gb|AAH79449.1| Glycerol kinase 2 [Rattus norvegicus]
 gb|EDL99625.1| glucokinase activity, related sequence 2 [Rattus norvegicus]
Length=554

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 156/214 (73%), Gaps = 4/214 (2%)
 Frame = +1

Query  67   SKE--EQVFVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKS  237
            SKE  E+  VG++ QGT STRF++++ ++A  V SHQ+E TQ YP+ GWVE DP EIL+S
Sbjct  4    SKETPEEPLVGAVVQGTNSTRFLVFNPKTAELVGSHQVELTQEYPKEGWVEEDPKEILQS  63

Query  238  VKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSI  417
            V  C++K  +K T    +  ++ KAIG++NQRETTVVW K +G PLYNA+VW+D RT S 
Sbjct  64   VYECIAKTCEKLTEANIDTSKI-KAIGVSNQRETTVVWDKFTGEPLYNAVVWLDLRTQST  122

Query  418  CRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWL  597
               L K++PG         GLP+STYFSA+KL W+L+N+  +++AV+   ALFGTID+WL
Sbjct  123  VESLNKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNLRPIQKAVEEDRALFGTIDSWL  182

Query  598  IWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            IW MTGGV  G+H TDV+NASRTML N+ +L+WD
Sbjct  183  IWCMTGGVNGGIHCTDVTNASRTMLFNIHSLEWD  216



>ref|WP_012174815.1| glycerol kinase [Desulfococcus oleovorans]
 gb|ABW67199.1| glycerol kinase [Desulfococcus oleovorans Hxd3]
Length=505

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 152/213 (71%), Gaps = 6/213 (3%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            ++ +VG+IDQGTTSTRF+++D +   V SHQ+E  Q YP+ G+VEHDP+EI  +    ++
Sbjct  3    DKQYVGAIDQGTTSTRFVVFDTTGAMVASHQVEHRQIYPEPGFVEHDPMEIRANTAGIIA  62

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            +A+ K   +   +     A+GITNQRETTVVW++ +G PLYNAIVW D RT  +C  L++
Sbjct  63   EALKKGLIEPDQIA----AVGITNQRETTVVWNRHTGRPLYNAIVWQDTRTADMCTALKQ  118

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            E  G    F E  GLP ++YFS  K+ W+L+NVE  + A + GDALFG +DTWLIW +TG
Sbjct  119  E--GHEPLFKEKTGLPAASYFSGPKIRWILDNVEGARAAAEKGDALFGNMDTWLIWWLTG  176

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            G GKG+HVTDV+NASRTMLMNL+TL WD   L+
Sbjct  177  GPGKGVHVTDVTNASRTMLMNLETLAWDSELLK  209



>gb|ETE58690.1| Glycerol kinase [Ophiophagus hannah]
Length=292

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 153/217 (71%), Gaps = 12/217 (6%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSH-QIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+IDQGT STRF++++ +   ++SH Q+E  Q +P+ GWVE DP EIL+SV  CV + 
Sbjct  14   LVGAIDQGTNSTRFLVFNANTAELLSHHQVEIQQKFPKEGWVEQDPKEILQSVYECVERT  73

Query  262  VDKATA---DGHNVGR-------LLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTT  411
             +K      D  N+          LKA+G++NQRETTVVW K +G PLYNAIVW+D RT 
Sbjct  74   CEKLNQLNIDISNIKENDRMFVLFLKAVGVSNQRETTVVWDKETGEPLYNAIVWLDLRTQ  133

Query  412  SICRKLEKELPG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTID  588
            S   +L K +PG  ++ F    GLP+STYFSA+KL WLL+NV+ +++AV  G ALFGTID
Sbjct  134  STVERLLKRIPGKNKSFFKSRTGLPLSTYFSAVKLRWLLDNVKEIRQAVLEGRALFGTID  193

Query  589  TWLIWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            +WLIW++TGG   G+H TDV+NASRTML N+ +L+W+
Sbjct  194  SWLIWSLTGGKNGGIHCTDVTNASRTMLFNIHSLEWE  230



>gb|AIY17559.2| Glycerol kinase [Pimelobacter simplex]
Length=505

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 147/209 (70%), Gaps = 5/209 (2%)
 Frame = +1

Query  88   VGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAVD  267
            +G+IDQGTTSTRF+++D +   V  HQ+E  Q  P+AGWVEH+PVEI +     V  A+ 
Sbjct  1    MGAIDQGTTSTRFMVFDHAGTEVARHQLEHQQLLPRAGWVEHNPVEIWERTSAVVQTALG  60

Query  268  KATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELPG  447
            KA     +    L AIGITNQRETT+VW + +G PLYNAIVW D RT +I   L+++  G
Sbjct  61   KARLGAED----LAAIGITNQRETTIVWHRRTGRPLYNAIVWQDTRTDAIAAALDRDGAG  116

Query  448  GRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GR   +    GLP +TYFS  KL W+LENV  V+EA + GDALFGT DTW++WN+TGG  
Sbjct  117  GRGDVIRHRAGLPPATYFSGGKLQWILENVPGVREAAERGDALFGTPDTWILWNLTGGTD  176

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
             G+HVTDV+NASRTMLM+L+TL+WD   L
Sbjct  177  GGVHVTDVTNASRTMLMDLETLNWDDELL  205



>gb|EPE08983.1| glycerol kinase [Ophiostoma piceae UAMH 11346]
Length=628

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 157/225 (70%), Gaps = 14/225 (6%)
 Frame = +1

Query  40   TREEGERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDP  219
            T EE +RK       FVGSIDQGTTS+RFII+D   +PV SHQ+EF   YP +GW E DP
Sbjct  57   TEEERQRKW------FVGSIDQGTTSSRFIIFDGDGKPVASHQLEFENLYPNSGWHEQDP  110

Query  220  VEILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMD  399
            +E+L SV+ C+ K V K    GH+   L++++GITNQRETT+VW   +G PL NA+VW D
Sbjct  111  MELLASVETCIEKGVQKFIELGHD-KLLIRSVGITNQRETTLVWDTETGKPLNNAVVWPD  169

Query  400  ARTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFG  579
             RTT++ R+L+      +    + CGLP+STY S++KL WLLENV+AV+EA + G   FG
Sbjct  170  TRTTALVRELKARPDADK--LTDLCGLPLSTYPSSVKLKWLLENVDAVREASEAGRLAFG  227

Query  580  TIDTWLIWNMTGGV-----GKGLHVTDVSNASRTMLMNLKTLDWD  699
            T+D+WLI+ + GG      GKG+HVTD +NASRTM MNLKTL +D
Sbjct  228  TVDSWLIYKLNGGPTGGHDGKGVHVTDSTNASRTMFMNLKTLKYD  272



>gb|EXK30956.1| glycerol kinase [Fusarium oxysporum f. sp. melonis 26406]
Length=603

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  74   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFKNHYPNSGWHEHDPM  133

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  134  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  192

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+++ R+L K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  193  RTSALVREL-KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKAYDEGRLSFGT  250

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+ + GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  251  VDSWLIYKLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  297



>ref|NP_034424.1| glycerol kinase 2 [Mus musculus]
 sp|Q9WU65.1|GLPK2_MOUSE RecName: Full=Glycerol kinase 2; Short=GK 2; Short=Glycerokinase 
2; AltName: Full=ATP:glycerol 3-phosphotransferase 2; AltName: 
Full=Glycerol kinase, testis specific 2 [Mus musculus]
 gb|AAD24551.1|AF117734_1 glycerol kinase-like protein 2 [Mus musculus]
 gb|AAH61147.1| Glycerol kinase 2 [Mus musculus]
 gb|AAH50764.1| Glycerol kinase 2 [Mus musculus]
 gb|EDL20343.1| glycerol kinase 2 [Mus musculus]
Length=554

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 151/206 (73%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG++ QGT STRF++++ ++A  V SHQ+E TQ YP+ GWVE DP EILKSV  C++KA
Sbjct  12   LVGAVVQGTNSTRFLVFNSKTAELVCSHQVELTQEYPKEGWVEQDPKEILKSVYECIAKA  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K +G PLYNA+VW+D RT S    L K++
Sbjct  72   CEKLAEVNIDISNI-KAIGVSNQRETTVVWDKFTGDPLYNAVVWLDLRTQSTVETLTKKI  130

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            PG         GLP+STYFSA+KL W+L+N+  +++AV+ G A+FGTID+WLIW MTGGV
Sbjct  131  PGNSNFVKSKTGLPLSTYFSAVKLRWMLDNLRPIQKAVEEGRAMFGTIDSWLIWCMTGGV  190

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWD  699
              G+H TDV+NA RTML N+ +L+WD
Sbjct  191  NGGIHCTDVTNACRTMLFNIHSLEWD  216



>gb|EGU77732.1| hypothetical protein FOXB_11754 [Fusarium oxysporum Fo5176]
 gb|EXK98580.1| glycerol kinase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL88576.1| glycerol kinase [Fusarium oxysporum f. sp. conglutinans race 
2 54008]
 gb|EXM35247.1| glycerol kinase [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=606

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  77   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPM  136

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  137  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  195

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+++ R+L K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  196  RTSALVREL-KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKAYDEGRLSFGT  253

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+ + GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  254  VDSWLIYKLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  300



>gb|AFC46723.1| glycerol kinase [Mycobacterium intracellulare MOTT-02]
Length=310

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 143/206 (69%), Gaps = 8/206 (4%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FV +IDQGTTSTR +I+D     V  HQ+E  Q  PQAGWVEHDPVEI +     ++  +
Sbjct  7    FVAAIDQGTTSTRCMIFDHEGAEVARHQLEHEQILPQAGWVEHDPVEIWERTSSVLTSVL  66

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
            ++A     N+     A+GITNQRETT+VW++ +G P YNAIVW D RT  I   LE +  
Sbjct  67   NRANLAPKNIA----ALGITNQRETTLVWNRKTGRPYYNAIVWQDTRTDRIASALEAD--  120

Query  445  GGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
             GR   +    GLP +TYFS  KL W+LENV+ V++A + GDALFGT DTW++WN+TGG 
Sbjct  121  -GRGEVIRRKAGLPPATYFSGAKLRWILENVDGVRDAAERGDALFGTPDTWVLWNLTGGP  179

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWD  699
              G+HVTDV+NASRTMLMNL+TLDWD
Sbjct  180  RGGVHVTDVTNASRTMLMNLETLDWD  205



>ref|XP_007761772.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
 gb|EXJ54257.1| glycerol kinase [Cladophialophora yegresii CBS 114405]
Length=532

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 149/210 (71%), Gaps = 3/210 (1%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            K ++ FVG+ID GTTS+RF+I+DR   PV  HQIEF Q YP +GW EHDP E++ SV  C
Sbjct  4    KSDESFVGAIDNGTTSSRFLIFDRKGNPVAEHQIEFKQHYPHSGWHEHDPNELVSSVSTC  63

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            + +A DK T+ G+++  + KA+GITNQRETTVVW   +G PLYNAIVW D R+  I R+L
Sbjct  64   IDEASDKFTSQGYSLSNI-KAVGITNQRETTVVWDIKTGEPLYNAIVWTDTRSAHIVREL  122

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
            +++   G    +  CGLP+STY S+ KLLW+L +V+ VK+A + G   FGT+DTWL++ +
Sbjct  123  KQK--SGADELISLCGLPLSTYPSSTKLLWMLRHVDKVKQAYEEGRLAFGTVDTWLVYKL  180

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             GG  K + VTD +NASRTM MN+  L +D
Sbjct  181  NGGTDKNVFVTDATNASRTMWMNIHNLKYD  210



>ref|XP_003237179.1| glycerol kinase [Trichophyton rubrum CBS 118892]
 gb|EGD85630.1| glycerol kinase [Trichophyton rubrum CBS 118892]
 gb|EZF12739.1| glycerol kinase [Trichophyton rubrum MR850]
 gb|EZF39186.1| glycerol kinase [Trichophyton rubrum CBS 100081]
 gb|EZF50020.1| glycerol kinase [Trichophyton rubrum CBS 288.86]
 gb|EZF60605.1| glycerol kinase [Trichophyton rubrum CBS 289.86]
 gb|EZF81884.1| glycerol kinase [Trichophyton rubrum MR1448]
 gb|EZF92546.1| glycerol kinase [Trichophyton rubrum MR1459]
 gb|EZG03731.1| glycerol kinase [Trichophyton rubrum CBS 735.88]
 gb|EZG14156.1| glycerol kinase [Trichophyton rubrum CBS 202.88]
 gb|KDB31096.1| glycerol kinase [Trichophyton rubrum D6]
Length=514

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA   G   FGTIDTWLI+
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDEGRLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD SNASRTM MNL+ +++D
Sbjct  178  KLNGGAEGGVFVTDPSNASRTMFMNLEKVEYD  209



>gb|EZF71154.1| glycerol kinase [Trichophyton soudanense CBS 452.61]
Length=514

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA   G   FGTIDTWLI+
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDEGRLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD SNASRTM MNL+ +++D
Sbjct  178  KLNGGAEGGVFVTDPSNASRTMFMNLEKVEYD  209



>gb|EXM09636.1| glycerol kinase [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=606

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  77   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPM  136

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  137  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  195

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+++ R+L K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  196  RTSALVREL-KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKAYDEGRLSFGT  253

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+ + GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  254  VDSWLIYKLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  300



>gb|EXA40461.1| glycerol kinase [Fusarium oxysporum f. sp. pisi HDV247]
Length=602

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  73   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPM  132

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  133  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  191

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+++ R+L K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  192  RTSALVREL-KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKAYDEGRLSFGT  249

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+ + GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  250  VDSWLIYKLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  296



>gb|EWG39393.1| glycerol kinase [Fusarium verticillioides 7600]
Length=606

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  77   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPM  136

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  137  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  195

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+++ R+L K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  196  RTSALVREL-KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKAYDEGRLSFGT  253

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+ + GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  254  VDSWLIYKLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  300



>gb|EWZ39665.1| glycerol kinase [Fusarium oxysporum Fo47]
 gb|EWZ88239.1| glycerol kinase [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXL51213.1| glycerol kinase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=606

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  77   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPM  136

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  137  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  195

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+++ R+L K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  196  RTSALVREL-KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKAYDEGRLSFGT  253

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+ + GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  254  VDSWLIYKLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  300



>ref|XP_006442413.1| hypothetical protein CICLE_v10020202mg [Citrus clementina]
 gb|ESR55653.1| hypothetical protein CICLE_v10020202mg [Citrus clementina]
Length=435

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 3/155 (2%)
 Frame = +1

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            ++KA+DKATADGHNV   LKAIG+TNQRETTV+WSKS+G PLYNAIVWMDAR +S   ++
Sbjct  1    MAKALDKATADGHNVDTGLKAIGLTNQRETTVLWSKSTGCPLYNAIVWMDARNSS---EI  57

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
             + +  G+THF+E  GLPI T F+A+KLLW++ENV+ VKEA+K GDALFGTIDTWLIWN+
Sbjct  58   GEGIIWGKTHFLEAVGLPIRTCFTAVKLLWMMENVDVVKEAIKKGDALFGTIDTWLIWNL  117

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            TGGV  GLHVTDVSNASRTMLMNLKTLDWD PTLE
Sbjct  118  TGGVNGGLHVTDVSNASRTMLMNLKTLDWDKPTLE  152



>emb|CEJ02635.1| Putative Glycerol kinase [Rhizopus microsporus]
Length=492

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 148/210 (70%), Gaps = 3/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            ++G+IDQGTTSTRFII+D   + + S   EF Q YP+ GWVEHDP ++L SV  C   A+
Sbjct  4    YIGAIDQGTTSTRFIIFDEKGKHITSQHHEFEQIYPRPGWVEHDPYDLLDSVIRCADGAI  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             K    G+N+  L KA+GI NQRETT+VW + +G PLYNAIVW D RT S+ ++L K+  
Sbjct  64   RKFGLMGYNMSDL-KAVGICNQRETTLVWDRKTGEPLYNAIVWSDTRTDSLVKELLKKQQ  122

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
                +  E CGLPI  YFSA+KL WL+E V  VK+AV+   A+FGT+DTWLIWN+TGG+ 
Sbjct  123  --DLNVQELCGLPIHNYFSAVKLKWLIERVPKVKQAVEKRRAMFGTVDTWLIWNLTGGIQ  180

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             G ++TDV+NASRTM MNLKT  WD   L+
Sbjct  181  GGKYITDVTNASRTMFMNLKTCQWDPRLLD  210



>ref|XP_005303408.1| PREDICTED: glycerol kinase isoform X3 [Chrysemys picta bellii]
Length=532

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 156/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+IDQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  CV K 
Sbjct  12   LVGAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQKFPKEGWVEQDPKEILQSVYECVEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KA+G++NQRETTVVW K++G PLYNAIVW+D RT     +L K +
Sbjct  72   CEKLNQLNIDITNI-KAVGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQPTVERLLKII  130

Query  442  PGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  T F +T  GLP+STYFSA+KL WLL+NVE +++AV++G A+FGTID+WLIW++TGG
Sbjct  131  PGQNTSFFKTRTGLPLSTYFSAVKLRWLLDNVEEIRQAVRDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>gb|EWY88820.1| glycerol kinase [Fusarium oxysporum FOSC 3-a]
Length=606

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 163/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  49   EGERKMSKEEQV--FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPV  222
            EG  + ++E+Q   FVGS+DQGTTSTRF+I++    P+VSHQIEF   YP +GW EHDP+
Sbjct  77   EGIEETAEEKQKHWFVGSVDQGTTSTRFLIFNGHGEPIVSHQIEFENHYPNSGWHEHDPM  136

Query  223  EILKSVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDA  402
             +L+SV+ C+ KA +K    GH++   +++IGITNQRETT++W   +G PLYNA+VW D 
Sbjct  137  TLLESVETCIEKATEKFCEKGHHI-EDIRSIGITNQRETTILWDNITGEPLYNAVVWPDT  195

Query  403  RTTSICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGT  582
            RT+++ R+L K  PG      ETCGLP+STY S++KLLW+L+NVE+V++A   G   FGT
Sbjct  196  RTSALVREL-KNKPGAE-KLQETCGLPLSTYPSSVKLLWVLQNVESVRKAYDEGRLSFGT  253

Query  583  IDTWLIWNMTGGV---GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            +D+WLI+ + GG    G  + VTD +NASRTM MNLKTL +D   L+
Sbjct  254  VDSWLIYKLNGGQDREGGPIFVTDATNASRTMFMNLKTLQYDDELLK  300



>ref|XP_011487479.1| PREDICTED: glycerol kinase-like isoform X1 [Oryzias latipes]
Length=520

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVS-HQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            +  V ++DQGT+STR ++++     V+S HQ+E  Q +P+ GWVE DP EI++SV  C+ 
Sbjct  2    EALVAAVDQGTSSTRVLVFNAKTAEVISQHQVEIRQSFPKEGWVEEDPKEIMQSVHECIE  61

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            K  +K +    ++ R+ KA+G+TNQRETT+VW +++G PLYNAIVW+D RT S   +L K
Sbjct  62   KTCEKLSQLKVDISRV-KAVGVTNQRETTLVWDRATGEPLYNAIVWLDLRTQSTVERLIK  120

Query  436  ELPG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            + PG  + H     GLPISTYFSA+KL WLL+NV+ V+EAV+ G ALFGT+D+W+IWN+T
Sbjct  121  KAPGENKNHLKHLTGLPISTYFSAVKLRWLLDNVDEVREAVRTGRALFGTVDSWIIWNLT  180

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            GG   G+H TDVSNASRTML N+ +++WD
Sbjct  181  GGRSGGVHATDVSNASRTMLFNIHSMEWD  209



>ref|WP_040313060.1| glycerol kinase [Actinomyces coleocanis]
Length=508

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 150/207 (72%), Gaps = 6/207 (3%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ +V SIDQGTTS+R I++D + + V   Q+E  Q +P+AGWVEH+PVEI ++++  V 
Sbjct  3    EKKYVLSIDQGTTSSRAIVFDHAGKIVSVGQLEHEQIFPKAGWVEHNPVEIWENIREAVG  62

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            +A+ KA  + H+    L A+GITNQRETTVVW K++G P+YNAIVW D RT  I R+L  
Sbjct  63   QALSKAEINRHD----LAAVGITNQRETTVVWDKNTGEPVYNAIVWQDTRTAEIVRELAG  118

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            E+  G   + E CGLP++TYFS  K+ W+L+NVE  +E  + GD LFG  DTW +WN+TG
Sbjct  119  EV--GNDKYKEICGLPLATYFSGPKIKWILDNVEGAREKAEAGDLLFGNTDTWTLWNLTG  176

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDW  696
            GV  G+H TDVSNASRTMLM+LKTL W
Sbjct  177  GVNGGVHATDVSNASRTMLMDLKTLQW  203



>ref|XP_010569615.1| PREDICTED: glycerol kinase isoform X4 [Haliaeetus leucocephalus]
Length=526

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EILKSV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILKSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  + +F    GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW++TGG
Sbjct  131  PGKNKAYFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>sp|Q63060.1|GLPK_RAT RecName: Full=Glycerol kinase; Short=GK; Short=Glycerokinase; 
AltName: Full=ATP-stimulated glucocorticoid-receptor translocation 
promoter; Short=ASTP; AltName: Full=ATP:glycerol 3-phosphotransferase 
[Rattus norvegicus]
 dbj|BAA03677.1| ATP-stimulated glucocorticoid-receptor translocaton promoter 
[Rattus norvegicus]
Length=524

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG++DQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  C+ K 
Sbjct  12   LVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILQSVYECIEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K +G PLYNA+VW+D RT S   KL K +
Sbjct  72   CEKLGQLNIDISNI-KAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQSTVEKLSKRI  130

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            PG         GLP+STYFSA+KL WLL+NV+ V+EAV+   ALFGTID+WLIW++TGG+
Sbjct  131  PGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFGTIDSWLIWSLTGGI  190

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              G+H TDV+NASRTML N+ +L+WD    E
Sbjct  191  NGGVHCTDVTNASRTMLFNIHSLEWDKELCE  221



>ref|XP_004081419.1| PREDICTED: glycerol kinase-like isoform X2 [Oryzias latipes]
Length=519

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +1

Query  79   QVFVGSIDQGTTSTRFIIYDRSARPVVS-HQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            +  V ++DQGT+STR ++++     V+S HQ+E  Q +P+ GWVE DP EI++SV  C+ 
Sbjct  2    EALVAAVDQGTSSTRVLVFNAKTAEVISQHQVEIRQSFPKEGWVEEDPKEIMQSVHECIE  61

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
            K  +K +    ++ R+ KA+G+TNQRETT+VW +++G PLYNAIVW+D RT S   +L K
Sbjct  62   KTCEKLSQLKVDISRV-KAVGVTNQRETTLVWDRATGEPLYNAIVWLDLRTQSTVERLIK  120

Query  436  ELPG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMT  612
            + PG  + H     GLPISTYFSA+KL WLL+NV+ V+EAV+ G ALFGT+D+W+IWN+T
Sbjct  121  KAPGENKNHLKHLTGLPISTYFSAVKLRWLLDNVDEVREAVRTGRALFGTVDSWIIWNLT  180

Query  613  GGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            GG   G+H TDVSNASRTML N+ +++WD
Sbjct  181  GGRSGGVHATDVSNASRTMLFNIHSMEWD  209



>ref|XP_010569613.1| PREDICTED: glycerol kinase isoform X2 [Haliaeetus leucocephalus]
Length=539

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EILKSV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILKSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  + +F    GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW++TGG
Sbjct  131  PGKNKAYFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>gb|EZF71155.1| glycerol kinase [Trichophyton soudanense CBS 452.61]
Length=509

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA   G   FGTIDTWLI+
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDEGRLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD SNASRTM MNL+ +++D
Sbjct  178  KLNGGAEGGVFVTDPSNASRTMFMNLEKVEYD  209



>gb|EZF12740.1| glycerol kinase [Trichophyton rubrum MR850]
 gb|EZF39187.1| glycerol kinase [Trichophyton rubrum CBS 100081]
 gb|EZF50021.1| glycerol kinase [Trichophyton rubrum CBS 288.86]
 gb|EZF60606.1| glycerol kinase [Trichophyton rubrum CBS 289.86]
 gb|EZF81885.1| glycerol kinase [Trichophyton rubrum MR1448]
 gb|EZF92547.1| glycerol kinase [Trichophyton rubrum MR1459]
 gb|EZG03732.1| glycerol kinase [Trichophyton rubrum CBS 735.88]
 gb|EZG14157.1| glycerol kinase [Trichophyton rubrum CBS 202.88]
 gb|KDB31097.1| glycerol kinase [Trichophyton rubrum D6]
 gb|KFL60719.1| glycerol kinase [Trichophyton rubrum CBS 118892]
Length=509

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA   G   FGTIDTWLI+
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDEGRLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD SNASRTM MNL+ +++D
Sbjct  178  KLNGGAEGGVFVTDPSNASRTMFMNLEKVEYD  209



>gb|KDB23476.1| glycerol kinase [Trichophyton interdigitale MR816]
Length=514

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA   G   FGTIDTWLI+
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDEGRLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD SNASRTM MNL+ +++D
Sbjct  178  KLNGGPEGGVFVTDPSNASRTMFMNLRKVEYD  209



>ref|WP_022884044.1| glycerol kinase [Glaciibacter superstes]
Length=504

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 149/209 (71%), Gaps = 6/209 (3%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            +V +IDQGTTS+R II+D+S   V S Q+E  Q +P+AGWVEHDP EI  + +  + +A+
Sbjct  4    YVLAIDQGTTSSRAIIFDKSGSIVSSGQLEHEQIFPKAGWVEHDPKEIWDNTREVIGQAL  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             KA    HN+    KA+GITNQRET VVW K++G P+YNAIVW D RT SI  +L K+  
Sbjct  64   SKANITRHNI----KAVGITNQRETAVVWDKTTGEPVYNAIVWQDTRTQSIVDRLAKD--  117

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GG   F E  GLP++TYFS  K++W+LENVE  +E  + GD LFGT D+W++WN+TGG  
Sbjct  118  GGVERFKEKVGLPLATYFSGTKIVWILENVEGAREKAEAGDLLFGTTDSWVLWNLTGGTD  177

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
             G+HVTDV+NASRT+ M+L+TL WD   L
Sbjct  178  GGVHVTDVTNASRTLFMDLETLQWDDDIL  206



>ref|XP_005817108.1| PREDICTED: glycerol kinase-like, partial [Xiphophorus maculatus]
Length=312

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 151/207 (73%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
               +IDQGT+STRF++++ ++A+ +  HQ+E  Q +P+ GWVE DP EI+ +V  C+ K 
Sbjct  4    LAAAIDQGTSSTRFLVFNTKTAQLISHHQVELKQHFPKEGWVEADPREIMNTVHECLEKT  63

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
              K      +V R+ KA+G+TNQRETT+VW K +G PLYNAIVW+D RT S   +L  + 
Sbjct  64   CQKLAQLSVDVSRI-KAVGVTNQRETTLVWDKETGEPLYNAIVWLDLRTQSTVERLISKT  122

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  + H     GLPISTYFSA+KL WLL+NVEAV++AV +  ALFGT+D+W+IW++TGG
Sbjct  123  PGRSKNHLKHKTGLPISTYFSAVKLCWLLDNVEAVRQAVLSKRALFGTVDSWIIWSLTGG  182

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H+TDVSNASRT+L ++ +LDWD
Sbjct  183  RDGGVHITDVSNASRTLLFDIHSLDWD  209



>ref|NP_077357.2| glycerol kinase [Rattus norvegicus]
Length=524

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG++DQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  C+ K 
Sbjct  12   LVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILQSVYECIEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K +G PLYNA+VW+D RT S   KL K +
Sbjct  72   CEKLGQLNIDISNI-KAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQSTVEKLSKRI  130

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            PG         GLP+STYFSA+KL WLL+NV+ V+EAV+   ALFGTID+WLIW++TGG+
Sbjct  131  PGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFGTIDSWLIWSLTGGI  190

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              G+H TDV+NASRTML N+ +L+WD    E
Sbjct  191  NGGVHCTDVTNASRTMLFNIHSLEWDKELCE  221



>dbj|GAD93635.1| glycerol kinase, putative [Byssochlamys spectabilis No. 5]
Length=568

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 147/210 (70%), Gaps = 3/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVGSIDQGTTS+RF+I++R   PV SHQ+EF Q YP +GW EHDP+E++ SV+ C+S+A+
Sbjct  8    FVGSIDQGTTSSRFLIFNRDGEPVASHQVEFNQIYPHSGWHEHDPLELVTSVETCISEAM  67

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             +  A G + G  +K IGITNQRETT+VW   +G PLYNAIVW D R+ SI  KL+    
Sbjct  68   KEFEAAGFSRG-AIKGIGITNQRETTIVWDYETGEPLYNAIVWTDTRSQSIVHKLKNR--  124

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
             G     + CGLP+STY S+ KLLW+LENV  V+EA   G   FGT+DTWL++ + GG  
Sbjct  125  KGAAELQQICGLPLSTYSSSTKLLWMLENVPKVREAYDRGKLAFGTVDTWLVYRLNGGPR  184

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              + V+D +NASRTM MNL TL +D   L+
Sbjct  185  SNVFVSDPTNASRTMFMNLATLKYDDRLLD  214



>ref|XP_008299996.1| PREDICTED: glycerol kinase-like, partial [Stegastes partitus]
Length=226

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 148/207 (71%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             V +IDQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  C+ + 
Sbjct  17   LVAAIDQGTSSTRFLVFNSKTAELLSHHQVEIKQSFPKEGWVEEDPNEILQSVYECMERT  76

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K T    ++  + KAIG+TNQRETT+VW K +G PLYNAIVW+D RT S    L  + 
Sbjct  77   CEKLTQLNIDISNI-KAIGVTNQRETTLVWDKETGEPLYNAIVWLDLRTQSTVESLINKT  135

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  + H     GLPISTYFSA+KL WL++NV+ V EAV +  A+FGT+D+WLIW +TGG
Sbjct  136  PGRNKNHLKHKTGLPISTYFSAVKLRWLMDNVKEVHEAVVSHRAMFGTVDSWLIWCLTGG  195

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ T+DWD
Sbjct  196  KSGGVHCTDVTNASRTMLFNIHTMDWD  222



>ref|WP_025090897.1| glycerol kinase [Ochrobactrum intermedium]
Length=499

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 148/209 (71%), Gaps = 6/209 (3%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            F+GSIDQGTTS+RFII+DR    V S Q E  Q YP+AGWVEH+P+EI ++ +  ++ A+
Sbjct  4    FIGSIDQGTTSSRFIIFDRQGDIVASDQREHEQIYPKAGWVEHNPIEIWRNTQHVIAAAL  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             KA     ++     ++GITNQRETT++W + +G+PL+NA+VWMD RT  +  +  K+  
Sbjct  64   KKANLKASDIA----SVGITNQRETTLLWDRKTGVPLHNAVVWMDTRTDELVARYTKD--  117

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GG     E  GLPISTYFS +KL W+L++V   +E  + GDALFGTIDTWL+WN+TGG  
Sbjct  118  GGADRLREKTGLPISTYFSGLKLRWILDHVPGAREKAEAGDALFGTIDTWLVWNLTGGTD  177

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
             G+H+TDV+NASRT LM+L TL WD   L
Sbjct  178  GGIHITDVTNASRTQLMDLSTLKWDADIL  206



>ref|XP_005303406.1| PREDICTED: glycerol kinase isoform X1 [Chrysemys picta bellii]
Length=561

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 156/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+IDQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  CV K 
Sbjct  12   LVGAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQKFPKEGWVEQDPKEILQSVYECVEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KA+G++NQRETTVVW K++G PLYNAIVW+D RT     +L K +
Sbjct  72   CEKLNQLNIDITNI-KAVGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQPTVERLLKII  130

Query  442  PGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  T F +T  GLP+STYFSA+KL WLL+NVE +++AV++G A+FGTID+WLIW++TGG
Sbjct  131  PGQNTSFFKTRTGLPLSTYFSAVKLRWLLDNVEEIRQAVRDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>ref|WP_028473143.1| glycerol kinase [Nocardioides alkalitolerans]
Length=509

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 150/217 (69%), Gaps = 8/217 (4%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MS   + +VGSIDQGTTSTRF+I+D     V  HQ+E  Q  PQAGWVEH+PVEI +   
Sbjct  1    MSDPTEKYVGSIDQGTTSTRFMIFDHDGNEVARHQLEHEQLLPQAGWVEHNPVEIWERTS  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
              +  A+ KA     +    L A+GITNQRETTVVW+K +G P YNAIVW D RT  I  
Sbjct  61   SVIQTALGKARLTSDD----LVALGITNQRETTVVWNKRTGRPYYNAIVWQDTRTDRIAS  116

Query  424  KLEKELPGGRTHFV-ETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLI  600
             L+++   GR   + +  GLP +TYF+  K+ W+LENV+ V+EA + GDA+FGT D+WL+
Sbjct  117  ALDRD---GRGDVIRQKAGLPPATYFAGGKIQWILENVDGVREAAEAGDAIFGTTDSWLV  173

Query  601  WNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
            WN+TGG   G+HVTDV+NASRTMLM+L+TLDWD   L
Sbjct  174  WNLTGGRDGGVHVTDVTNASRTMLMDLETLDWDDELL  210



>ref|WP_015217632.1| glycerol kinase [Anabaena cylindrica]
 gb|AFZ61021.1| glycerol kinase [Anabaena cylindrica PCC 7122]
Length=497

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 146/210 (70%), Gaps = 6/210 (3%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            +V +IDQGTTSTRFII+D+  + V   Q E  Q YPQ GWVEHDP+EI    +  +  A+
Sbjct  4    YVAAIDQGTTSTRFIIFDKQGKIVSYAQKEHQQIYPQPGWVEHDPLEIWSCTQTVIKDAL  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
            +++      +     A+GITNQRET VVW+K +G P YNAIVW D RT  IC +L  +  
Sbjct  64   EQSNITVAEI----TAVGITNQRETIVVWNKHTGEPYYNAIVWQDTRTDYICNQLAAD--  117

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
            GG   F    GLP++TYFSA K+ WLLEN+  +K A KNGDALFGTIDT+LIW++TGG  
Sbjct  118  GGIDRFRAITGLPLATYFSAPKIKWLLENIPGLKAAAKNGDALFGTIDTFLIWHLTGGTA  177

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             GLH+TDV+NASRT+LMNL +LDW+   LE
Sbjct  178  GGLHITDVTNASRTLLMNLNSLDWEPDILE  207



>gb|KDB23477.1| glycerol kinase [Trichophyton interdigitale MR816]
Length=509

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 145/212 (68%), Gaps = 3/212 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            M+   + FVGSIDQGTTS+RF+I++     VVSHQ+EF+Q YPQ GW EHDP EI++SV 
Sbjct  1    MAVHGKSFVGSIDQGTTSSRFLIFNTDGEVVVSHQLEFSQIYPQPGWHEHDPNEIVESVV  60

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
             C+  AV      GH +  + KAIGITNQRETTVVW K +G PLYNAIVW D RT  + R
Sbjct  61   ACIDGAVADFETQGHKIDSI-KAIGITNQRETTVVWDKETGEPLYNAIVWTDTRTQGLVR  119

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
             L+  L  G       CGLP+STY S  K+LWL++NV  VKEA   G   FGTIDTWLI+
Sbjct  120  GLKNRL--GHQELQPICGLPLSTYPSVGKVLWLIDNVPKVKEAYDEGRLAFGTIDTWLIY  177

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
             + GG   G+ VTD SNASRTM MNL+ +++D
Sbjct  178  KLNGGPEGGVFVTDPSNASRTMFMNLRKVEYD  209



>ref|XP_001214980.1| glycerol kinase 2 [Aspergillus terreus NIH2624]
 gb|EAU33563.1| glycerol kinase 2 [Aspergillus terreus NIH2624]
Length=584

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 145/206 (70%), Gaps = 3/206 (1%)
 Frame = +1

Query  82   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
            +FVGSIDQGTTSTRF+I++    PV SHQ+EFTQ YP  GW EHDP+E+  SV  CV +A
Sbjct  1    MFVGSIDQGTTSTRFLIFNHEGEPVASHQVEFTQIYPNPGWHEHDPLELESSVYTCVEEA  60

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            V K  A G++    +K IGITNQRETTVVW   +G PLYNAIVW D R+ SI  +L+K  
Sbjct  61   VKKFEATGYSR-ETIKGIGITNQRETTVVWDHETGEPLYNAIVWTDTRSQSIVDELKKRP  119

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
                +   + CGLP+STY SA KLLW+LENV  VK+A + G   FGT+DTWL++ + GG 
Sbjct  120  EA--SQLQQLCGLPLSTYSSATKLLWMLENVPRVKDAYERGTLAFGTVDTWLVYRLNGGH  177

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWD  699
               + V+D +NASRTM MNL+TL +D
Sbjct  178  AANVFVSDATNASRTMFMNLETLQYD  203



>ref|XP_005303407.1| PREDICTED: glycerol kinase isoform X2 [Chrysemys picta bellii]
Length=555

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 156/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG+IDQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  CV K 
Sbjct  12   LVGAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQKFPKEGWVEQDPKEILQSVYECVEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KA+G++NQRETTVVW K++G PLYNAIVW+D RT     +L K +
Sbjct  72   CEKLNQLNIDITNI-KAVGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQPTVERLLKII  130

Query  442  PGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  T F +T  GLP+STYFSA+KL WLL+NVE +++AV++G A+FGTID+WLIW++TGG
Sbjct  131  PGQNTSFFKTRTGLPLSTYFSAVKLRWLLDNVEEIRQAVRDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>ref|XP_010569612.1| PREDICTED: glycerol kinase isoform X1 [Haliaeetus leucocephalus]
Length=552

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EILKSV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILKSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  + +F    GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW++TGG
Sbjct  131  PGKNKAYFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>ref|XP_416788.3| PREDICTED: glycerol kinase isoformX3 [Gallus gallus]
Length=526

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILRSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PGGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG    F +   GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW +TGG
Sbjct  131  PGNNKSFFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWCLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +LDWD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLDWD  217



>ref|XP_010569614.1| PREDICTED: glycerol kinase isoform X3 [Haliaeetus leucocephalus]
Length=558

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EILKSV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILKSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  + +F    GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW++TGG
Sbjct  131  PGKNKAYFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>emb|CEG63395.1| Putative Glycerol kinase [Rhizopus microsporus]
Length=512

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 148/210 (70%), Gaps = 3/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            ++G+IDQGTTSTRFII+D   + + S   EF Q YP+ GWVEHDP ++L SV  C   A+
Sbjct  4    YIGAIDQGTTSTRFIIFDEKGKHITSQHHEFEQIYPRPGWVEHDPYDLLDSVIRCADGAI  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             K    G+N+  L KA+GI NQRETT+VW + +G PLYNAIVW D RT S+ ++L K+  
Sbjct  64   RKFGLMGYNMSDL-KAVGICNQRETTLVWDRKTGEPLYNAIVWSDTRTDSLVKELLKKQQ  122

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
                +  E CGLPI  YFSA+KL WL+E V  VK+AV+   A+FGT+DTWLIWN+TGG+ 
Sbjct  123  D--LNVQELCGLPIHNYFSAVKLKWLIERVPKVKQAVEKRRAMFGTVDTWLIWNLTGGIQ  180

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             G ++TDV+NASRTM MNLKT  WD   L+
Sbjct  181  GGKYITDVTNASRTMFMNLKTCQWDPRLLD  210



>ref|XP_004934697.1| PREDICTED: glycerol kinase isoform X4 [Gallus gallus]
Length=537

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILRSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PGGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG    F +   GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW +TGG
Sbjct  131  PGNNKSFFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWCLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +LDWD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLDWD  217



>gb|EHK44930.1| hypothetical protein TRIATDRAFT_39628 [Trichoderma atroviride 
IMI 206040]
Length=511

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 150/210 (71%), Gaps = 3/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVG+IDQGTTS+RF+I+++    V +HQ+EF Q+YP  GW EHDP E++ SV++CV  AV
Sbjct  6    FVGAIDQGTTSSRFLIFNQKGEVVATHQLEFKQYYPHPGWHEHDPEELISSVEICVDGAV  65

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
            ++    GH   +++ A+GITNQRETTVVW K++G  L+NAIVW DAR+  + RKL+  + 
Sbjct  66   EEFEKQGHTREQIV-AVGITNQRETTVVWDKTTGKALHNAIVWTDARSQELVRKLKNRIG  124

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
             G       CGLP+STY S  KLLWLL NV+ VKEA + G   FGT+D+WL + + GG  
Sbjct  125  AG--ELTSRCGLPLSTYPSVSKLLWLLGNVQEVKEAYERGHLAFGTVDSWLAFKLNGGTA  182

Query  625  KGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            + +HVTD SNASRTM MNL+TL++D   ++
Sbjct  183  RNIHVTDPSNASRTMFMNLETLEYDAELID  212



>ref|WP_027359785.1| glycerol kinase [Desulforegula conservatrix]
Length=502

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 156/212 (74%), Gaps = 6/212 (3%)
 Frame = +1

Query  76   EQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVS  255
            E+ ++ +IDQGTTSTRF+I+DR++  + S Q+E  Q YP+ GWVEHDP EI++++   ++
Sbjct  2    EKKYIAAIDQGTTSTRFVIFDRNSNIISSSQMEHGQIYPRPGWVEHDPEEIIRNIITVMA  61

Query  256  KAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEK  435
             A+ K + +  ++     AIG+TNQRET V+W K++G PLYNAIVW D RT  +C+++ K
Sbjct  62   DALKKGSINPLSIA----AIGVTNQRETVVMWDKTTGKPLYNAIVWQDTRTGDLCKRIAK  117

Query  436  ELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTG  615
            +   G   F    GLPI+ YFS  K+ W+++NV++V +AV NG+AL GTID+W+IWN+TG
Sbjct  118  D--SGIDRFRIKTGLPIAPYFSGPKIRWMIDNVDSVIDAVSNGNALAGTIDSWIIWNLTG  175

Query  616  GVGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
            G   G+HVTDV+NASRT+LMNL+TLDWD   L
Sbjct  176  GANGGVHVTDVTNASRTLLMNLETLDWDPEML  207



>ref|XP_005144605.1| PREDICTED: glycerol kinase isoform X1 [Melopsittacus undulatus]
Length=552

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 154/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSH-QIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+STRF++++     ++SH Q+E  Q +P+ GWVE DP EIL SV  CV K 
Sbjct  12   LVGSIDQGTSSTRFLVFNAKTSELLSHHQVEIVQKFPKEGWVEQDPKEILSSVHECVEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT +   +L K++
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQATVDRLLKKI  130

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  ++ F    GLPISTYFSA+KL WLL+NVE +K+AV +G A+FGTID+WLIW++TGG
Sbjct  131  PGKNKSFFKFRTGLPISTYFSAVKLRWLLDNVEEIKQAVDDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>gb|KEY70743.1| hypothetical protein S7711_03239 [Stachybotrys chartarum IBT 
7711]
 gb|KFA50933.1| hypothetical protein S40293_02410 [Stachybotrys chartarum IBT 
40293]
Length=539

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 158/222 (71%), Gaps = 6/222 (3%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E    K++  FVGSIDQGTTSTRF+I++    P+  HQ+EF   YP +GW E DP+E+L+
Sbjct  20   ETAEEKKQHWFVGSIDQGTTSTRFLIFNGLGDPIAKHQMEFKNIYPHSGWHEQDPLELLR  79

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            SV+ C+ KA +   A GH V   ++++GITNQRETTV+W K++G PLYNA+ W D RTT+
Sbjct  80   SVETCIEKATEDFCAQGHTVSE-IRSVGITNQRETTVLWDKNTGEPLYNAVAWPDTRTTT  138

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            + R+L+     G    ++ CGLP+STY S++KLLWLL+NV++VK A   G  +FGT+D+W
Sbjct  139  LVRELKTR--DGADKLLDLCGLPLSTYPSSVKLLWLLQNVDSVKAAYDEGRLVFGTVDSW  196

Query  595  LIWNMTGGVGKG---LHVTDVSNASRTMLMNLKTLDWDXPTL  711
            LI+ + GG+ +    +HVTD +NASRTM MNL+TL++D   L
Sbjct  197  LIFRLNGGIWRQDGPIHVTDSTNASRTMFMNLQTLEYDDSLL  238



>gb|KFA76269.1| hypothetical protein S40288_03598 [Stachybotrys chartarum IBT 
40288]
Length=539

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 158/222 (71%), Gaps = 6/222 (3%)
 Frame = +1

Query  55   ERKMSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILK  234
            E    K++  FVGSIDQGTTSTRF+I++    P+  HQ+EF   YP +GW E DP+E+L+
Sbjct  20   ETAEEKKQHWFVGSIDQGTTSTRFLIFNGLGDPIAKHQMEFKNIYPHSGWHEQDPLELLR  79

Query  235  SVKVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTS  414
            SV+ C+ KA +   A GH V   ++++GITNQRETTV+W K++G PLYNA+ W D RTT+
Sbjct  80   SVETCIEKATEDFCAQGHTVSE-IRSVGITNQRETTVLWDKNTGEPLYNAVAWPDTRTTT  138

Query  415  ICRKLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTW  594
            + R+L+     G    ++ CGLP+STY S++KLLWLL+NV++VK A   G  +FGT+D+W
Sbjct  139  LVRELKTR--DGADKLLDLCGLPLSTYPSSVKLLWLLQNVDSVKAAYDEGRLVFGTVDSW  196

Query  595  LIWNMTGGVGKG---LHVTDVSNASRTMLMNLKTLDWDXPTL  711
            LI+ + GG+ +    +HVTD +NASRTM MNL+TL++D   L
Sbjct  197  LIFRLNGGIWRQDGPIHVTDSTNASRTMFMNLQTLEYDDSLL  238



>ref|XP_005144606.1| PREDICTED: glycerol kinase isoform X2 [Melopsittacus undulatus]
Length=560

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 154/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSH-QIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+STRF++++     ++SH Q+E  Q +P+ GWVE DP EIL SV  CV K 
Sbjct  12   LVGSIDQGTSSTRFLVFNAKTSELLSHHQVEIVQKFPKEGWVEQDPKEILSSVHECVEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT +   +L K++
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQATVDRLLKKI  130

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  ++ F    GLPISTYFSA+KL WLL+NVE +K+AV +G A+FGTID+WLIW++TGG
Sbjct  131  PGKNKSFFKFRTGLPISTYFSAVKLRWLLDNVEEIKQAVDDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>ref|XP_007084972.1| PREDICTED: glycerol kinase-like isoform X2 [Panthera tigris altaica]
Length=524

 Score =   237 bits (605),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 150/211 (71%), Gaps = 2/211 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG++DQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  C+ K 
Sbjct  12   LVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILQSVYECIEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K +G PLYNA+VW+D RT S    L K++
Sbjct  72   CEKLGQLNIDISNI-KAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQSTVENLSKKI  130

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            PG         GLP+STYFSA+KL WLL+NV  VKEAV+   ALFGTID WLIW++TGG 
Sbjct  131  PGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRTVKEAVEEDRALFGTIDAWLIWSLTGGT  190

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             +G+H TDV+NASRTML N+ +L+WD    E
Sbjct  191  NRGVHCTDVTNASRTMLFNIHSLEWDKELCE  221



>ref|XP_005144607.1| PREDICTED: glycerol kinase isoform X3 [Melopsittacus undulatus]
Length=558

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 154/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSH-QIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+STRF++++     ++SH Q+E  Q +P+ GWVE DP EIL SV  CV K 
Sbjct  12   LVGSIDQGTSSTRFLVFNAKTSELLSHHQVEIVQKFPKEGWVEQDPKEILSSVHECVEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT +   +L K++
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQATVDRLLKKI  130

Query  442  PG-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG  ++ F    GLPISTYFSA+KL WLL+NVE +K+AV +G A+FGTID+WLIW++TGG
Sbjct  131  PGKNKSFFKFRTGLPISTYFSAVKLRWLLDNVEEIKQAVDDGRAMFGTIDSWLIWSLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +L+WD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLEWD  217



>ref|XP_006679513.1| hypothetical protein BATDEDRAFT_30202 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80013.1| hypothetical protein BATDEDRAFT_30202 [Batrachochytrium dendrobatidis 
JAM81]
Length=468

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 149/210 (71%), Gaps = 2/210 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            ++GSIDQGT+STRF+++D +   + SHQ EF Q  PQAGWVEHD   I ++V  C+ K V
Sbjct  4    YIGSIDQGTSSTRFMVFDTAGHIIASHQTEFAQVLPQAGWVEHDLEVIYQTVVTCIQKTV  63

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
               +A G     + KAIGITNQRETT VW +  G PL++AIVW+D RT     +L    P
Sbjct  64   ADMSAMGLQPLDI-KAIGITNQRETTCVWDRLDGKPLHHAIVWLDTRTQDTVERLIAATP  122

Query  445  G-GRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
               + HF   CGLP+STYFSA+KL WLL+N++AV++A +    +FGTID+WLI+ +TGGV
Sbjct  123  SKSKHHFQSICGLPLSTYFSAVKLRWLLDNIKAVQDANQTDRLMFGTIDSWLIYRLTGGV  182

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
              G+HVTDV+NASRTML+NLK+LDWD   L
Sbjct  183  QGGIHVTDVTNASRTMLLNLKSLDWDDGML  212



>gb|KIW00193.1| glycerol kinase [Verruconis gallopava]
Length=566

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            F+G+IDQGTTS+RF+I+ +   PV  HQ+EF Q YP +GW EHDP+E++ SV  C+ +AV
Sbjct  65   FIGAIDQGTTSSRFLIFSKEGEPVAMHQMEFKQIYPNSGWHEHDPLELVSSVNACIDRAV  124

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
            +   A G+ + + +KA+GITNQRETTVVW K +G PLYNAIVW D R+ S+ R+L+    
Sbjct  125  ENFEAKGY-LRKQIKAVGITNQRETTVVWDKLTGEPLYNAIVWTDTRSASLVRELKART-  182

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
             G       CG+P+STY S  KLLW+LE+V  V+ A +NG   FGT+D+WL + + GG  
Sbjct  183  -GADKLQALCGIPLSTYPSCSKLLWMLEHVPKVRAAYQNGTLAFGTVDSWLAYRLNGGPA  241

Query  625  KGLHVTDVSNASRTMLMNLKTLDWD  699
            K +HV+D +NASRTM MNL+TLD+D
Sbjct  242  KNVHVSDPTNASRTMFMNLETLDYD  266



>ref|WP_039206505.1| glycerol kinase [Brevibacterium linens]
 gb|KHS54131.1| Glycerol kinase [Brevibacterium linens]
Length=510

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 155/212 (73%), Gaps = 8/212 (4%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVK  243
            MS+E+  F+ +IDQGTTS+R I+++   + V S Q+E  Q +P+AGWVEHDPVEI+K+  
Sbjct  1    MSQEK--FILAIDQGTTSSRAIVFNHDGQIVSSGQLEHEQIFPRAGWVEHDPVEIIKNTN  58

Query  244  VCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICR  423
              + +A+ +A  + H     L+ +GITNQRETTV+W+K++G P+YNAIVW DART  +C 
Sbjct  59   EAIGQALTRANINRHQ----LEGVGITNQRETTVIWNKNTGEPVYNAIVWQDARTQKVCD  114

Query  424  KLEKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIW  603
            +L  +   G   + +  GLP++TYF+  K  W+ +NV+ VKEA   GD LFGT+DTW+IW
Sbjct  115  ELAGDE--GPDKYKDRVGLPLATYFAGPKAKWIFDNVDGVKEAAAAGDLLFGTMDTWVIW  172

Query  604  NMTGGVGKGLHVTDVSNASRTMLMNLKTLDWD  699
            N+TGGV  G+HVTDV+NASRTMLMN+ TLDW+
Sbjct  173  NLTGGVNGGIHVTDVTNASRTMLMNIDTLDWN  204



>ref|XP_006257049.1| PREDICTED: glycerol kinase isoform X4 [Rattus norvegicus]
Length=559

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG++DQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  C+ K 
Sbjct  12   LVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILQSVYECIEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K +G PLYNA+VW+D RT S   KL K +
Sbjct  72   CEKLGQLNIDISNI-KAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQSTVEKLSKRI  130

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            PG         GLP+STYFSA+KL WLL+NV+ V+EAV+   ALFGTID+WLIW++TGG+
Sbjct  131  PGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFGTIDSWLIWSLTGGI  190

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              G+H TDV+NASRTML N+ +L+WD    E
Sbjct  191  NGGVHCTDVTNASRTMLFNIHSLEWDKELCE  221



>ref|WP_010231844.1| glycerol kinase [Pseudonocardia sp. P1]
Length=505

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 145/211 (69%), Gaps = 10/211 (5%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            FVG+IDQGTTS+RF+I+D S   V  HQ+E  Q  PQ GWVEH+PVEI++    C+  A+
Sbjct  4    FVGAIDQGTTSSRFMIFDHSGNEVGRHQLEHEQILPQPGWVEHNPVEIIERTNACLQSAL  63

Query  265  DKA--TADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKE  438
            +    TAD       L A+G+TNQRETTVVW++ +G P YNAIVW D RT  I   LE+E
Sbjct  64   NATNLTADD------LVALGVTNQRETTVVWNRRNGRPYYNAIVWQDTRTDRIATALERE  117

Query  439  LPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
              G         GLP +TYFS  K+ W+LENV+ V+EA + GDA+FG  DTW+IWN+TGG
Sbjct  118  GKGDVIR--RKAGLPPATYFSGGKIQWILENVDGVREAAEAGDAIFGNTDTWVIWNLTGG  175

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
               G HVTDV+NASRTMLMNL+TLDWD   L
Sbjct  176  PNGGRHVTDVTNASRTMLMNLETLDWDDELL  206



>ref|XP_006257050.1| PREDICTED: glycerol kinase isoform X6 [Rattus norvegicus]
Length=553

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VG++DQGT+STRF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  C+ K 
Sbjct  12   LVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILQSVYECIEKT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K +G PLYNA+VW+D RT S   KL K +
Sbjct  72   CEKLGQLNIDISNI-KAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQSTVEKLSKRI  130

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
            PG         GLP+STYFSA+KL WLL+NV+ V+EAV+   ALFGTID+WLIW++TGG+
Sbjct  131  PGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFGTIDSWLIWSLTGGI  190

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
              G+H TDV+NASRTML N+ +L+WD    E
Sbjct  191  NGGVHCTDVTNASRTMLFNIHSLEWDKELCE  221



>ref|XP_002108430.1| hypothetical protein TRIADDRAFT_20207 [Trichoplax adhaerens]
 gb|EDV29228.1| hypothetical protein TRIADDRAFT_20207 [Trichoplax adhaerens]
Length=515

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 156/219 (71%), Gaps = 3/219 (1%)
 Frame = +1

Query  64   MSKEEQVFVGSIDQGTTSTRFIIYDRSARPVVS-HQIEFTQFYPQAGWVEHDPVEILKSV  240
            M+  +   VG+IDQGT+S+RF+I+  +++ V+S  Q+E  Q +P+ GW E DPVEIL+SV
Sbjct  1    MASSKGPLVGAIDQGTSSSRFMIFPANSQEVISITQMEIKQMFPREGWCEEDPVEILESV  60

Query  241  KVCVSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSIC  420
            + C+S A DK      ++ ++ KAIGITNQRETT+VW K +G PLYNA+VW+D RT++  
Sbjct  61   QKCISDAADKCNELNIDLSQI-KAIGITNQRETTIVWDKFTGKPLYNAVVWLDTRTSTTV  119

Query  421  RKLEKELPGGRTHFVET-CGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWL  597
             KL  + P  +  +++  CGLPISTYFSA+KL WL++N E V++A+     +FGT+D WL
Sbjct  120  DKLVDKAPTKKADYLQKKCGLPISTYFSAVKLRWLIDNCEEVRKAIAEDRCMFGTVDCWL  179

Query  598  IWNMTGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
            IWN+TGG   G H TDVSNASRTMLMN+ T +WD    E
Sbjct  180  IWNLTGGPNGGRHYTDVSNASRTMLMNIATQEWDPELCE  218



>ref|XP_003640559.2| PREDICTED: glycerol kinase isoformX2 [Gallus gallus]
Length=561

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILRSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PGGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG    F +   GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW +TGG
Sbjct  131  PGNNKSFFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWCLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +LDWD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLDWD  217



>ref|WP_006215657.1| Glycerol kinase [Kocuria palustris]
 gb|EME35657.1| Glycerol kinase [Kocuria palustris PEL]
Length=510

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 149/205 (73%), Gaps = 6/205 (3%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKAV  264
            +V +IDQGTTSTR I++D +   V S Q E  Q +P+AGWVEHDPVEI K+ +  + +A+
Sbjct  6    YVMAIDQGTTSTRAILFDHNGAIVSSGQREHEQIFPRAGWVEHDPVEIWKNTREVIGEAL  65

Query  265  DKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKELP  444
             +A A  H+V     A+GITNQRETTVVW +S+G P+YNAIVW D RT  +C +L  +  
Sbjct  66   ARAEATRHDVA----AVGITNQRETTVVWDRSTGRPVYNAIVWQDTRTDRLCERLAGD--  119

Query  445  GGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGVG  624
             G   + E  GLP++TYF+  K+ W+LENV+  +EA +NGD +FGT+D+WL+WN+TGG  
Sbjct  120  AGADRYKERVGLPLATYFAGPKVAWILENVDGAREAAENGDLVFGTMDSWLVWNLTGGGA  179

Query  625  KGLHVTDVSNASRTMLMNLKTLDWD  699
             G HVTDV+NASRT+LMNL TLDW+
Sbjct  180  GGRHVTDVTNASRTILMNLDTLDWN  204



>ref|XP_003640558.2| PREDICTED: glycerol kinase isoformX1 [Gallus gallus]
Length=555

 Score =   238 bits (606),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   FVGSIDQGTTSTRFIIYD-RSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
             VGSIDQGT+S+RF++++ ++A  +  HQ+E  Q +P+ GWVE DP EIL+SV  CV + 
Sbjct  12   LVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEILRSVHECVERT  71

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
             +K      ++  + KAIG++NQRETTVVW K++G PLYNAIVW+D RT S   +L K +
Sbjct  72   CEKLQQLNIDITNI-KAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRI  130

Query  442  PGGRTHFVE-TCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGG  618
            PG    F +   GLP+STYFSA+KL WLL+NVE +++AV +G A+FGTID+WLIW +TGG
Sbjct  131  PGNNKSFFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTIDSWLIWCLTGG  190

Query  619  VGKGLHVTDVSNASRTMLMNLKTLDWD  699
               G+H TDV+NASRTML N+ +LDWD
Sbjct  191  KNGGVHCTDVTNASRTMLFNIHSLDWD  217



>ref|WP_018461519.1| hypothetical protein [Thermus oshimai]
Length=498

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 151/210 (72%), Gaps = 10/210 (5%)
 Frame = +1

Query  82   VFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVCVSKA  261
            +++G++DQGTTSTRF+++DR  R +  HQ+E  Q YP+ GWVEHDP+EI    +  +  A
Sbjct  1    MYIGALDQGTTSTRFMVFDRQGREIARHQLEHRQVYPRPGWVEHDPLEIWARTQEAIQGA  60

Query  262  VDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKLEKEL  441
            + KA   G   G LL AIGITNQRETT+VW+K++G P +NAIVW D RT +IC  L+ E 
Sbjct  61   LAKA---GVRPGELL-AIGITNQRETTLVWNKNTGEPYHNAIVWQDTRTDAICEALKAE-  115

Query  442  PGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNMTGGV  621
             G    F +  GLP+STYFS  KL W+L++V  V+EA + GDALFGT+DTWLIW +TG  
Sbjct  116  -GLEEVFRKKTGLPLSTYFSGPKLKWILDHVPGVREAAERGDALFGTVDTWLIWWLTG--  172

Query  622  GKGLHVTDVSNASRTMLMNLKTLDWDXPTL  711
              G HVTDV+NASRT+LMNLKTLDWD   L
Sbjct  173  --GRHVTDVTNASRTLLMNLKTLDWDEELL  200



>gb|EKV13298.1| Glycerol kinase, putative [Penicillium digitatum PHI26]
 gb|EKV19172.1| Glycerol kinase, putative [Penicillium digitatum Pd1]
Length=523

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 151/215 (70%), Gaps = 3/215 (1%)
 Frame = +1

Query  70   KEEQVFVGSIDQGTTSTRFIIYDRSARPVVSHQIEFTQFYPQAGWVEHDPVEILKSVKVC  249
            +  + FVGSIDQGTTSTRF+I++R+  PV SHQ+EF+Q YP  GW EHDP+EI+ SV+ C
Sbjct  2    QPPETFVGSIDQGTTSTRFLIFNRAGEPVASHQVEFSQIYPIPGWHEHDPLEIMISVETC  61

Query  250  VSKAVDKATADGHNVGRLLKAIGITNQRETTVVWSKSSGLPLYNAIVWMDARTTSICRKL  429
            + +AV    A G+N    +++IGITNQRETT+VW   +G PLYNAIVW D R+ SI  +L
Sbjct  62   IEEAVQNFEAQGYNRSS-IQSIGITNQRETTIVWDHKTGEPLYNAIVWTDTRSQSIVVEL  120

Query  430  EKELPGGRTHFVETCGLPISTYFSAMKLLWLLENVEAVKEAVKNGDALFGTIDTWLIWNM  609
             K+ PG        CGLP+STY SA KLLW+L +V  VK+A   G   FGT+D+WL++ +
Sbjct  121  -KQKPGA-AQIQTLCGLPLSTYSSATKLLWMLAHVPRVKDAFIRGTLAFGTVDSWLVYCL  178

Query  610  TGGVGKGLHVTDVSNASRTMLMNLKTLDWDXPTLE  714
             GGV   + V+D +NASRTM MNL+TL +D   LE
Sbjct  179  NGGVAANVFVSDSTNASRTMFMNLETLRYDETLLE  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395