BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041K06

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP20466.1|  unnamed protein product                              59.7    9e-09   Coffea canephora [robusta coffee]
gb|AAT46037.1|  At5g54075                                             55.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AES95847.2|  hypothetical protein MTR_5g030170                     57.8    2e-07   Medicago truncatula
ref|XP_003612889.1|  hypothetical protein MTR_5g030170                57.8    2e-07   
ref|XP_003629705.1|  hypothetical protein MTR_8g085620                59.7    3e-07   
gb|KJB22935.1|  hypothetical protein B456_004G074800                  54.3    2e-06   Gossypium raimondii
ref|XP_007161701.1|  hypothetical protein PHAVU_001G090900g           53.1    3e-06   Phaseolus vulgaris [French bean]
ref|XP_001779505.1|  predicted protein                                54.3    8e-06   
ref|XP_003601190.1|  hypothetical protein MTR_3g077010                51.2    1e-05   
ref|XP_003617924.1|  hypothetical protein MTR_5g097000                51.6    1e-05   
ref|XP_001780322.1|  predicted protein                                54.3    2e-05   
ref|XP_003597358.1|  Dolichol-phosphate mannosyltransferase           53.5    3e-05   
ref|XP_003638297.1|  hypothetical protein MTR_126s0006                53.5    4e-05   
emb|CAN65109.1|  hypothetical protein VITISV_030252                   53.5    5e-05   Vitis vinifera
gb|KEH27642.1|  hypothetical protein MTR_5g024973                     50.4    6e-05   Medicago truncatula
ref|XP_003629657.1|  hypothetical protein MTR_8g085130                49.3    1e-04   
ref|XP_003612435.1|  hypothetical protein MTR_5g024980                51.2    2e-04   



>emb|CDP20466.1| unnamed protein product [Coffea canephora]
Length=63

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  382  VTHALASWPYLIHQA*FPVSFELKDTEVQAYRTDPVQVWS  501
            V HAL    Y IHQ  FPVS ELKDTEV+AYRTDPVQV S
Sbjct  24   VNHALVKRSYFIHQTWFPVSLELKDTEVRAYRTDPVQVRS  63



>gb|AAT46037.1| At5g54075 [Arabidopsis thaliana]
 gb|AAT70480.1| At5g54075 [Arabidopsis thaliana]
Length=39

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  513  ETWSRPYLNRICSVGLYLCILEFKGDRKLSLVDE  412
              WSRPYLNRICS+G YLC L+F  DR L+LVDE
Sbjct  5    HHWSRPYLNRICSIGSYLCFLDFSRDRPLTLVDE  38



>gb|AES95847.2| hypothetical protein MTR_5g030170 [Medicago truncatula]
Length=151

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  52   EQKRESNAFAGSQTRVYCLEGNYPNRWTTNAS  147
            ++K +  AFAGS+TRVYCLEGNYPNRWTTNA+
Sbjct  119  QEKIKKIAFAGSRTRVYCLEGNYPNRWTTNAT  150


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  71   MRLPGVKPGSIAWKAIILTVGLQTLLVHRLMH  166
            +RLPGV+PGSIAWKAIILTVGLQTLLV R+ +
Sbjct  67   LRLPGVEPGSIAWKAIILTVGLQTLLVDRICY  98



>ref|XP_003612889.1| hypothetical protein MTR_5g030170 [Medicago truncatula]
Length=152

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  52   EQKRESNAFAGSQTRVYCLEGNYPNRWTTNAS  147
            ++K +  AFAGS+TRVYCLEGNYPNRWTTNA+
Sbjct  120  QEKIKKIAFAGSRTRVYCLEGNYPNRWTTNAT  151


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  71   MRLPGVKPGSIAWKAIILTVGLQTLLVHRLMH  166
            +RLPGV+PGSIAWKAIILTVGLQTLLV R+ +
Sbjct  68   LRLPGVEPGSIAWKAIILTVGLQTLLVDRICY  99



>ref|XP_003629705.1| hypothetical protein MTR_8g085620 [Medicago truncatula]
 gb|AET04181.1| lipase/lipooxygenase, PLAT/LH2 family protein, putative [Medicago 
truncatula]
Length=488

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  73   AFAGSQTRVYCLEGNYPNRWTTNASCS  153
            AFAGS+TRVYCLEGNYPNRWTTNA CS
Sbjct  4    AFAGSRTRVYCLEGNYPNRWTTNACCS  30



>gb|KJB22935.1| hypothetical protein B456_004G074800 [Gossypium raimondii]
Length=100

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -1

Query  510  TWSRPYLNRICSVGLYLCILEFKGDRKLSLVDEIWPRS*SVSNRTVP-SPGGAVEDR  343
             W+RPYLNRICS+G YLC L+FK DR  SLVDE  PR   +S  T P  P  A+ DR
Sbjct  10   VWARPYLNRICSIGSYLCFLKFKRDRIPSLVDE--PRLCDLSVITGPVMPLLALLDR  64



>ref|XP_007161701.1| hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris]
 gb|ESW33695.1| hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris]
Length=65

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  382  VTHALASWPYLIHQA*FPVSFELKDTEVQAYRTDPVQVWS  501
            + H L +  + IHQ   PVS ELKDTEV+AYRTDPVQV S
Sbjct  26   INHGLITGSWFIHQTSDPVSLELKDTEVRAYRTDPVQVRS  65



>ref|XP_001779505.1| predicted protein [Physcomitrella patens]
 gb|EDQ55681.1| predicted protein [Physcomitrella patens]
Length=188

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  44   SLLNKRGKVMRLPGVKPGSIAWKAIILTVGLQTLLVHRLMHHFKDPENV  190
            ++  K   ++RLPGV+PGSIAWKAIILTVGLQTL  + L    K+   V
Sbjct  126  AVQQKSSPLVRLPGVEPGSIAWKAIILTVGLQTLSAYNLRRLIKNSTRV  174



>ref|XP_003601190.1| hypothetical protein MTR_3g077010 [Medicago truncatula]
 gb|AES71441.1| hypothetical protein MTR_3g077010 [Medicago truncatula]
Length=50

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  71   MRLPGVKPGSIAWKAIILTVGLQTLL  148
            MRLPGV+PGSIAWKAIILTVGLQTL+
Sbjct  1    MRLPGVEPGSIAWKAIILTVGLQTLV  26



>ref|XP_003617924.1| hypothetical protein MTR_5g097000 [Medicago truncatula]
 gb|AET00883.1| transmembrane protein, putative [Medicago truncatula]
Length=60

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +2

Query  71   MRLPGVKPGSIAWKAIILTVGLQTL  145
            MRLPGV+PGSIAWKAIILTVGLQTL
Sbjct  1    MRLPGVEPGSIAWKAIILTVGLQTL  25



>ref|XP_001780322.1| predicted protein [Physcomitrella patens]
 gb|EDQ54881.1| predicted protein [Physcomitrella patens]
Length=382

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +1

Query  73   AFAGSQTRVYCLEGNYPNRWTTNA  144
            AFAGS+TRV+CLEGNYPNRWTTNA
Sbjct  30   AFAGSRTRVHCLEGNYPNRWTTNA  53



>ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula]
Length=271

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  71   MRLPGVKPGSIAWKAIILTVGLQTLLV  151
            MRLPGV+PGSIAWKAIILTVGLQTL++
Sbjct  1    MRLPGVEPGSIAWKAIILTVGLQTLII  27



>ref|XP_003638297.1| hypothetical protein MTR_126s0006 [Medicago truncatula]
Length=369

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -1

Query  150  TRSVCSPTVRIIAFQAIDPGLTPGKRI  70
            TR VCSPTVRIIAFQAIDPG TPGKRI
Sbjct  339  TRCVCSPTVRIIAFQAIDPGSTPGKRI  365



>emb|CAN65109.1| hypothetical protein VITISV_030252 [Vitis vinifera]
Length=635

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 7/41 (17%)
 Frame = +2

Query  41   PSLLN--KRGKV-----MRLPGVKPGSIAWKAIILTVGLQT  142
            PSL N  K GK+     MRLPGV+PGSIAWKAIILTVGLQT
Sbjct  593  PSLRNLGKDGKIFTLMKMRLPGVEPGSIAWKAIILTVGLQT  633



>gb|KEH27642.1| hypothetical protein MTR_5g024973 [Medicago truncatula]
Length=96

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  382  VTHALASWPYLIHQA*FPVSFELKDTEVQAYRTDPVQVWS  501
            V HAL +  + IHQ   PVS E+KDT V++YRTDPVQV S
Sbjct  28   VNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTDPVQVRS  67



>ref|XP_003629657.1| hypothetical protein MTR_8g085130 [Medicago truncatula]
 ref|XP_003629817.1| hypothetical protein MTR_8g087070 [Medicago truncatula]
Length=95

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  71   MRLPGVKPGSIAWKAIILTVGLQTL  145
            MRLPGV+P SIAWKAIILTVGLQTL
Sbjct  1    MRLPGVEPRSIAWKAIILTVGLQTL  25



>ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago truncatula]
Length=286

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  382  VTHALASWPYLIHQA*FPVSFELKDTEVQAYRTDPVQVWS  501
            V HAL +  + IHQ   PVS E+KDT V++YRTDPVQV S
Sbjct  28   VNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTDPVQVRS  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420