BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041J09

Length=789
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                424   2e-143   Nicotiana tomentosiformis
ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                423   6e-143   Nicotiana sylvestris
ref|XP_006341563.1|  PREDICTED: beta-glucosidase 44-like                419   4e-141   Solanum tuberosum [potatoes]
ref|NP_001234620.1|  beta-mannosidase enzyme precursor                  418   7e-141   
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                400   3e-134   Solanum tuberosum [potatoes]
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                400   5e-134   Nicotiana sylvestris
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                399   2e-133   Nicotiana tomentosiformis
ref|XP_011084444.1|  PREDICTED: beta-glucosidase 44-like                399   2e-133   Sesamum indicum [beniseed]
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     397   2e-132   Solanum lycopersicum
gb|EYU40222.1|  hypothetical protein MIMGU_mgv1a004735mg                396   3e-132   Erythranthe guttata [common monkey flower]
gb|KEH16705.1|  glycoside hydrolase family 1 protein                    381   2e-129   Medicago truncatula
ref|XP_003637785.1|  Beta-glucosidase                                   379   5e-129   
gb|KDO62884.1|  hypothetical protein CISIN_1g010049mg                   384   6e-129   Citrus sinensis [apfelsine]
gb|KDO62882.1|  hypothetical protein CISIN_1g010049mg                   383   8e-129   Citrus sinensis [apfelsine]
gb|KDO62881.1|  hypothetical protein CISIN_1g010049mg                   383   3e-128   Citrus sinensis [apfelsine]
ref|XP_006490742.1|  PREDICTED: beta-glucosidase 44-like                384   1e-127   Citrus sinensis [apfelsine]
ref|XP_003534146.1|  PREDICTED: beta-glucosidase 44                     384   1e-127   Glycine max [soybeans]
gb|ACU24532.1|  unknown                                                 384   1e-127   Glycine max [soybeans]
ref|XP_003528968.1|  PREDICTED: beta-glucosidase 44-like                384   2e-127   Glycine max [soybeans]
ref|XP_010243804.1|  PREDICTED: beta-glucosidase 44-like                384   2e-127   Nelumbo nucifera [Indian lotus]
gb|KCW83985.1|  hypothetical protein EUGRSUZ_B00859                     379   4e-127   Eucalyptus grandis [rose gum]
gb|KDO62878.1|  hypothetical protein CISIN_1g010049mg                   383   5e-127   Citrus sinensis [apfelsine]
ref|XP_008240180.1|  PREDICTED: beta-glucosidase 44-like                381   2e-126   Prunus mume [ume]
ref|XP_006451661.1|  hypothetical protein CICLE_v10008010mg             377   2e-126   
gb|KDP41124.1|  hypothetical protein JCGZ_03615                         381   2e-126   Jatropha curcas
gb|KEH16708.1|  glycoside hydrolase family 1 protein                    377   3e-126   Medicago truncatula
ref|XP_010032608.1|  PREDICTED: beta-glucosidase 44-like                379   1e-125   Eucalyptus grandis [rose gum]
ref|XP_007036679.1|  B-S glucosidase 44 isoform 1                       379   1e-125   Theobroma cacao [chocolate]
ref|XP_007036681.1|  B-S glucosidase 44 isoform 3                       379   2e-125   
gb|KCW83979.1|  hypothetical protein EUGRSUZ_B00859                     378   3e-125   Eucalyptus grandis [rose gum]
gb|KCW83978.1|  hypothetical protein EUGRSUZ_B00859                     378   3e-125   Eucalyptus grandis [rose gum]
ref|XP_004161840.1|  PREDICTED: beta-glucosidase 44-like                377   4e-125   
gb|KEH16706.1|  glycoside hydrolase family 1 protein                    378   4e-125   Medicago truncatula
ref|XP_007209912.1|  hypothetical protein PRUPE_ppa004380mg             377   4e-125   Prunus persica
ref|XP_010032621.1|  PREDICTED: beta-glucosidase 44-like                377   5e-125   Eucalyptus grandis [rose gum]
gb|KCW83981.1|  hypothetical protein EUGRSUZ_B00859                     377   5e-125   Eucalyptus grandis [rose gum]
gb|KCW83982.1|  hypothetical protein EUGRSUZ_B00859                     377   5e-125   Eucalyptus grandis [rose gum]
ref|XP_006451662.1|  hypothetical protein CICLE_v10008010mg             377   1e-124   Citrus clementina [clementine]
gb|KCW83975.1|  hypothetical protein EUGRSUZ_B00859                     377   1e-124   Eucalyptus grandis [rose gum]
ref|XP_008462973.1|  PREDICTED: beta-glucosidase 44-like                376   1e-124   Cucumis melo [Oriental melon]
ref|XP_004137494.1|  PREDICTED: beta-glucosidase 44-like                376   1e-124   Cucumis sativus [cucumbers]
gb|KEH16707.1|  glycoside hydrolase family 1 protein                    375   3e-124   Medicago truncatula
ref|XP_010032630.1|  PREDICTED: beta-glucosidase 44-like                375   5e-124   Eucalyptus grandis [rose gum]
ref|XP_007033096.1|  B-S glucosidase 44                                 374   7e-124   
gb|KCW83977.1|  hypothetical protein EUGRSUZ_B00859                     374   7e-124   Eucalyptus grandis [rose gum]
ref|XP_007152698.1|  hypothetical protein PHAVU_004G151800g             375   7e-124   Phaseolus vulgaris [French bean]
gb|EPS65829.1|  beta-mannosidase                                        373   9e-124   Genlisea aurea
gb|KCW83987.1|  hypothetical protein EUGRSUZ_B00860                     373   2e-123   Eucalyptus grandis [rose gum]
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     373   2e-123   Vitis vinifera
ref|XP_002533126.1|  beta-glucosidase, putative                         372   5e-123   Ricinus communis
ref|XP_006406654.1|  hypothetical protein EUTSA_v10020536mg             372   7e-123   Eutrema salsugineum [saltwater cress]
ref|NP_188436.1|  beta-glucosidase 44                                   371   2e-122   Arabidopsis thaliana [mouse-ear cress]
gb|ABK95221.1|  unknown                                                 364   2e-122   Populus trichocarpa [western balsam poplar]
ref|XP_010506331.1|  PREDICTED: beta-glucosidase 43-like isoform X2     363   2e-122   
ref|XP_004512738.1|  PREDICTED: beta-glucosidase 44-like                370   3e-122   Cicer arietinum [garbanzo]
emb|CAN74265.1|  hypothetical protein VITISV_040977                     370   3e-122   Vitis vinifera
ref|XP_011000474.1|  PREDICTED: beta-glucosidase 44-like                370   5e-122   Populus euphratica
ref|XP_010506324.1|  PREDICTED: beta-glucosidase 43-like isoform X1     363   5e-122   
ref|XP_009347765.1|  PREDICTED: beta-glucosidase 44-like                369   8e-122   Pyrus x bretschneideri [bai li]
ref|XP_010487722.1|  PREDICTED: beta-glucosidase 44-like                369   9e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                369   1e-121   Tarenaya hassleriana [spider flower]
ref|XP_008374823.1|  PREDICTED: beta-glucosidase 44-like                369   2e-121   Malus domestica [apple tree]
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                367   3e-121   
ref|XP_010097587.1|  Beta-glucosidase 44                                367   4e-121   Morus notabilis
ref|XP_004299545.1|  PREDICTED: beta-glucosidase 44-like                367   4e-121   Fragaria vesca subsp. vesca
ref|XP_002322085.1|  glycosyl hydrolase family 1 family protein         367   6e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                367   7e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010465882.1|  PREDICTED: beta-glucosidase 44                     367   9e-121   Camelina sativa [gold-of-pleasure]
gb|KFK39134.1|  beta-glucosidase 44                                     366   1e-120   Arabis alpina [alpine rockcress]
gb|AGV54748.1|  beta-glucosidase 44-like protein                        366   2e-120   Phaseolus vulgaris [French bean]
ref|XP_002883106.1|  beta-glucosidase                                   365   4e-120   Arabidopsis lyrata subsp. lyrata
ref|XP_006297463.1|  hypothetical protein CARUB_v10013483mg             364   9e-120   Capsella rubella
gb|KFK39133.1|  beta-glucosidase 44                                     363   2e-119   Arabis alpina [alpine rockcress]
ref|XP_009113531.1|  PREDICTED: beta-glucosidase 43                     363   2e-119   Brassica rapa
emb|CDY18494.1|  BnaA01g27010D                                          363   2e-119   Brassica napus [oilseed rape]
ref|XP_006832849.1|  hypothetical protein AMTR_s00095p00053110          362   3e-119   
ref|XP_002322086.2|  hypothetical protein POPTR_0015s04280g             362   4e-119   
ref|XP_006376723.1|  hypothetical protein POPTR_0012s04670g             361   2e-118   
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       360   2e-118   Gossypium arboreum [tree cotton]
gb|KJB08522.1|  hypothetical protein B456_001G086300                    360   3e-118   Gossypium raimondii
ref|XP_011039106.1|  PREDICTED: beta-glucosidase 44-like                360   3e-118   Populus euphratica
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     359   5e-118   Camelina sativa [gold-of-pleasure]
gb|KJB16858.1|  hypothetical protein B456_002G251200                    358   1e-117   Gossypium raimondii
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             358   2e-117   Selaginella moellendorffii
ref|XP_010686092.1|  PREDICTED: beta-glucosidase 44-like                358   2e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             357   3e-117   Selaginella moellendorffii
gb|KJB16855.1|  hypothetical protein B456_002G250900                    355   3e-116   Gossypium raimondii
ref|XP_008810053.1|  PREDICTED: beta-glucosidase 1-like                 355   3e-116   Phoenix dactylifera
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                355   7e-116   Vitis vinifera
ref|XP_006845279.1|  hypothetical protein AMTR_s00005p00266150          353   1e-115   
gb|ABR17739.1|  unknown                                                 353   2e-115   Picea sitchensis
ref|XP_010922562.1|  PREDICTED: beta-glucosidase 1-like                 352   5e-115   Elaeis guineensis
emb|CDO98378.1|  unnamed protein product                                350   5e-115   Coffea canephora [robusta coffee]
emb|CDX95557.1|  BnaC01g34490D                                          351   1e-114   
emb|CDX95558.1|  BnaC01g34500D                                          348   1e-113   
ref|XP_010906974.1|  PREDICTED: beta-glucosidase 1-like                 348   1e-113   Elaeis guineensis
gb|KJB34273.1|  hypothetical protein B456_006G057000                    347   2e-113   Gossypium raimondii
ref|XP_004163493.1|  PREDICTED: beta-glucosidase 44-like                347   3e-113   
ref|XP_004149144.1|  PREDICTED: beta-glucosidase 44-like                347   3e-113   Cucumis sativus [cucumbers]
ref|XP_007033088.1|  Beta-glucosidase 44                                347   4e-113   
ref|XP_010257808.1|  PREDICTED: beta-glucosidase 44-like isoform X5     345   5e-113   Nelumbo nucifera [Indian lotus]
ref|XP_010257753.1|  PREDICTED: beta-glucosidase 44-like isoform X4     345   7e-113   Nelumbo nucifera [Indian lotus]
ref|XP_009113523.1|  PREDICTED: beta-glucosidase 44                     346   8e-113   Brassica rapa
ref|XP_006644213.1|  PREDICTED: beta-glucosidase 1-like                 346   9e-113   Oryza brachyantha
ref|XP_009394432.1|  PREDICTED: beta-glucosidase 1-like                 346   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB16881.1|  hypothetical protein B456_002G252700                    346   1e-112   Gossypium raimondii
gb|KJB08521.1|  hypothetical protein B456_001G086200                    342   1e-112   Gossypium raimondii
ref|XP_010257596.1|  PREDICTED: beta-glucosidase 44-like isoform X3     345   2e-112   
ref|XP_008453769.1|  PREDICTED: beta-glucosidase 44-like                345   2e-112   Cucumis melo [Oriental melon]
ref|XP_010257433.1|  PREDICTED: beta-glucosidase 44-like isoform X1     345   3e-112   Nelumbo nucifera [Indian lotus]
ref|XP_010257514.1|  PREDICTED: beta-glucosidase 44-like isoform X2     345   3e-112   Nelumbo nucifera [Indian lotus]
ref|NP_001043156.1|  Os01g0508000                                       344   4e-112   
gb|EAY74244.1|  hypothetical protein OsI_02124                          344   5e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_006482391.1|  PREDICTED: beta-glucosidase 44-like                343   1e-111   
gb|KDO63131.1|  hypothetical protein CISIN_1g036937mg                   342   1e-111   Citrus sinensis [apfelsine]
gb|KDO63132.1|  hypothetical protein CISIN_1g046891mg                   343   1e-111   Citrus sinensis [apfelsine]
ref|XP_010314225.1|  PREDICTED: beta-glucosidase 44-like isoform X2     342   2e-111   Solanum lycopersicum
ref|XP_006431835.1|  hypothetical protein CICLE_v10004010mg             342   3e-111   Citrus clementina [clementine]
gb|ABC55717.1|  beta-mannosidase 2                                      342   3e-111   Oncidium hybrid cultivar
ref|XP_006430656.1|  hypothetical protein CICLE_v10013386mg             342   3e-111   Citrus clementina [clementine]
ref|XP_006430655.1|  hypothetical protein CICLE_v10013521mg             342   4e-111   Citrus clementina [clementine]
ref|XP_006482389.1|  PREDICTED: beta-glucosidase 44-like                342   4e-111   Citrus sinensis [apfelsine]
ref|XP_006430653.1|  hypothetical protein CICLE_v10013421mg             342   6e-111   
ref|XP_008792825.1|  PREDICTED: beta-glucosidase 1-like                 341   7e-111   Phoenix dactylifera
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                339   3e-110   Eucalyptus grandis [rose gum]
gb|ABC55718.1|  beta-mannosidase 1                                      338   5e-110   Oncidium hybrid cultivar
gb|ABC55716.1|  beta-mannosidase 3                                      338   6e-110   Oncidium hybrid cultivar
ref|XP_007048474.1|  Beta-glucosidase 44                                340   7e-110   
ref|XP_004140826.1|  PREDICTED: beta-glucosidase 44-like                338   1e-109   Cucumis sativus [cucumbers]
ref|XP_004157213.1|  PREDICTED: beta-glucosidase 44-like                338   1e-109   
ref|XP_006471035.1|  PREDICTED: beta-glucosidase 44-like                337   2e-109   
ref|XP_004299546.1|  PREDICTED: beta-glucosidase 44-like                337   3e-109   Fragaria vesca subsp. vesca
gb|KHN23728.1|  Beta-glucosidase 44                                     334   7e-109   Glycine soja [wild soybean]
ref|XP_008457084.1|  PREDICTED: beta-glucosidase 44-like                336   8e-109   Cucumis melo [Oriental melon]
ref|XP_006299658.1|  hypothetical protein CARUB_v10015846mg             335   1e-108   
ref|XP_008811965.1|  PREDICTED: beta-glucosidase 1-like isoform X1      334   3e-108   
ref|XP_008811966.1|  PREDICTED: beta-glucosidase 1-like isoform X2      335   4e-108   
ref|XP_006482390.1|  PREDICTED: beta-glucosidase 44-like                334   4e-108   
gb|AFW79802.1|  hypothetical protein ZEAMMB73_091278                    333   2e-107   
ref|XP_010916341.1|  PREDICTED: beta-glucosidase 1-like                 331   5e-107   Elaeis guineensis
ref|XP_002461141.1|  hypothetical protein SORBIDRAFT_02g041550          330   2e-106   Sorghum bicolor [broomcorn]
ref|XP_008655551.1|  PREDICTED: beta-glucosidase 1-like                 332   2e-106   Zea mays [maize]
ref|XP_006658055.1|  PREDICTED: beta-glucosidase 26-like                330   2e-106   Oryza brachyantha
ref|XP_004958541.1|  PREDICTED: beta-glucosidase 26-like                329   9e-106   Setaria italica
dbj|BAB02019.1|  beta-glucosidase                                       327   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562544.1|  PREDICTED: beta-glucosidase 26                     326   4e-105   
ref|NP_001148821.1|  LOC100282438 precursor                             326   6e-105   Zea mays [maize]
gb|ACL52625.1|  unknown                                                 326   6e-105   Zea mays [maize]
pdb|4JIE|A  Chain A, Structural Analysis And Insights Into Glycon...    324   2e-104   Oryza sativa Indica Group [Indian rice]
gb|ACF35791.1|  beta-mannosidase/beta-glucosidase                       323   2e-104   Oryza sativa Indica Group [Indian rice]
ref|NP_188435.2|  beta glucosidase 43                                   323   3e-104   Arabidopsis thaliana [mouse-ear cress]
sp|A3BMZ5.1|BGL26_ORYSJ  RecName: Full=Beta-glucosidase 26; Short...    323   5e-104   Oryza sativa Japonica Group [Japonica rice]
gb|KCW83983.1|  hypothetical protein EUGRSUZ_B00859                     321   7e-104   Eucalyptus grandis [rose gum]
emb|CDM80087.1|  unnamed protein product                                322   1e-103   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007036680.1|  B-S glucosidase 44 isoform 2                       320   4e-103   
gb|EMT23872.1|  Beta-glucosidase 44                                     321   1e-102   
tpg|DAA50880.1|  TPA: hypothetical protein ZEAMMB73_806821              309   7e-102   
gb|ACF07998.1|  beta-glucosidase                                        317   2e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004982054.1|  PREDICTED: beta-glucosidase 8-like                 318   2e-101   Setaria italica
ref|NP_001151026.1|  LOC100284659 precursor                             318   3e-101   Zea mays [maize]
gb|AAA87339.1|  beta-glucosidase                                        316   4e-101   Hordeum vulgare [barley]
ref|XP_006845278.1|  hypothetical protein AMTR_s00005p00265850          315   5e-101   
ref|XP_006845277.1|  hypothetical protein AMTR_s00005p00265710          315   5e-101   
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 317   9e-101   Oryza brachyantha
gb|KJB16854.1|  hypothetical protein B456_002G250800                    309   2e-100   Gossypium raimondii
tpg|DAA50882.1|  TPA: hypothetical protein ZEAMMB73_806821              310   2e-100   
gb|EMT08337.1|  Beta-glucosidase 44                                     314   2e-100   
gb|AEV76986.1|  beta-glucosidase 4                                      313   2e-100   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002464026.1|  hypothetical protein SORBIDRAFT_01g010825          315   3e-100   Sorghum bicolor [broomcorn]
gb|EEC76023.1|  hypothetical protein OsI_13187                          314   8e-100   Oryza sativa Indica Group [Indian rice]
ref|NP_001051014.1|  Os03g0703100                                       314   1e-99    
ref|XP_009394053.1|  PREDICTED: beta-glucosidase 26-like                310   8e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001142124.1|  uncharacterized protein LOC100274288 precursor     309   1e-98    Zea mays [maize]
gb|ACG44181.1|  non-cyanogenic beta-glucosidase precursor               308   2e-98    Zea mays [maize]
gb|EMS60983.1|  Beta-glucosidase 26                                     309   2e-98    Triticum urartu
ref|XP_008665263.1|  PREDICTED: beta-glucosidase 7-like                 308   4e-98    Zea mays [maize]
gb|ABF98425.1|  Glycosyl hydrolase family 1 protein, expressed          300   7e-98    Oryza sativa Japonica Group [Japonica rice]
emb|CBI33559.3|  unnamed protein product                                306   8e-98    Vitis vinifera
dbj|BAJ90056.1|  predicted protein                                      307   1e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004982055.1|  PREDICTED: beta-glucosidase 7-like isoform X1      307   1e-97    Setaria italica
ref|XP_004982056.1|  PREDICTED: beta-glucosidase 7-like isoform X2      306   1e-97    Setaria italica
ref|XP_003559510.1|  PREDICTED: beta-glucosidase 8-like                 308   3e-97    Brachypodium distachyon [annual false brome]
gb|ADP02192.1|  putative non-cyanogenic beta-glucosidase                305   4e-97    Triticum aestivum [Canadian hard winter wheat]
gb|ABF98426.1|  Glycosyl hydrolase family 1 protein, expressed          301   5e-97    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051013.1|  Os03g0703000                                       301   2e-95    
ref|XP_006651730.1|  PREDICTED: beta-glucosidase 7-like                 300   2e-95    
dbj|BAK08154.1|  predicted protein                                      293   3e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010237292.1|  PREDICTED: beta-glucosidase 38-like                300   3e-95    Brachypodium distachyon [annual false brome]
pdb|3SCN|A  Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant       300   4e-95    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCR|A  Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant       300   4e-95    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCV|A  Chain A, Crystal Structure Of Rice Bglu1 E386gS334A M...    300   4e-95    Oryza sativa Japonica Group [Japonica rice]
pdb|2RGL|A  Chain A, Rice Bglu1 Beta-Glucosidase, A Plant Exogluc...    300   4e-95    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCW|A  Chain A, Crystal Structure Of Rice Bglu1 E386gY341A M...    300   4e-95    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCP|A  Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant       299   5e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464027.1|  hypothetical protein SORBIDRAFT_01g010830          300   1e-94    Sorghum bicolor [broomcorn]
gb|AAA84906.3|  beta-glucosidase                                        299   1e-94    Oryza sativa Japonica Group [Japonica rice]
pdb|3F4V|A  Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Pl...    298   1e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003559509.1|  PREDICTED: beta-glucosidase 7-like isoform X1      298   2e-94    Brachypodium distachyon [annual false brome]
ref|XP_006832853.1|  hypothetical protein AMTR_s00095p00054570          285   4e-93    
emb|CDM83785.1|  unnamed protein product                                295   5e-93    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006664007.1|  PREDICTED: beta-glucosidase 38-like                295   5e-93    Oryza brachyantha
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             294   1e-92    Selaginella moellendorffii
ref|XP_003559508.1|  PREDICTED: beta-glucosidase 7-like                 293   3e-92    Brachypodium distachyon [annual false brome]
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             292   7e-92    
gb|EMS48652.1|  Beta-glucosidase 7                                      291   1e-91    Triticum urartu
gb|KCW52109.1|  hypothetical protein EUGRSUZ_J01543                     288   4e-91    Eucalyptus grandis [rose gum]
ref|XP_002438912.1|  hypothetical protein SORBIDRAFT_10g028060          288   8e-91    
gb|ADP02193.1|  Glyco_hydro_1 domain-containing protein                 291   1e-90    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001064347.1|  Os10g0323500                                       288   4e-90    
gb|AAK92581.1|AC074354_15  Putative beta-glucosidase                    288   4e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           287   6e-90    Elaeis guineensis
gb|EEC66726.1|  hypothetical protein OsI_33062                          286   1e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           286   1e-89    Elaeis guineensis
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                286   1e-89    Oryza brachyantha
gb|EEC69164.1|  hypothetical protein OsI_38122                          285   2e-89    Oryza sativa Indica Group [Indian rice]
gb|EMS63424.1|  Beta-glucosidase 38                                     285   3e-89    Triticum urartu
ref|XP_001753376.1|  predicted protein                                  285   4e-89    
ref|XP_004963948.1|  PREDICTED: beta-glucosidase 38-like                285   4e-89    Setaria italica
ref|NP_001066656.1|  Os12g0420100                                       284   8e-89    
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 283   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA44055.1|  TPA: hypothetical protein ZEAMMB73_095768              279   4e-88    
ref|XP_010109366.1|  Beta-glucosidase 40                                282   5e-88    Morus notabilis
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          281   2e-87    
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             280   3e-87    
gb|KJB80346.1|  hypothetical protein B456_013G093000                    276   3e-87    Gossypium raimondii
ref|XP_009406319.1|  PREDICTED: beta-glucosidase 6-like                 280   3e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008658980.1|  PREDICTED: uncharacterized protein LOC100502...    278   4e-87    Zea mays [maize]
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                279   7e-87    
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     279   7e-87    
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 280   8e-87    Setaria italica
ref|XP_007045908.1|  Beta glucosidase 40 isoform 2                      276   8e-87    
gb|AFW89226.1|  hypothetical protein ZEAMMB73_293984                    276   1e-86    
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     278   1e-86    Pyrus x bretschneideri [bai li]
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                278   2e-86    Citrus sinensis [apfelsine]
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             278   2e-86    Citrus clementina [clementine]
ref|XP_010446113.1|  PREDICTED: putative beta-glucosidase 41            272   3e-86    
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 278   3e-86    
ref|XP_009631811.1|  PREDICTED: beta-glucosidase 40                     277   3e-86    Nicotiana tomentosiformis
ref|XP_010066854.1|  PREDICTED: beta-glucosidase 40                     278   3e-86    Eucalyptus grandis [rose gum]
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 278   3e-86    Setaria italica
gb|AFW69221.1|  hypothetical protein ZEAMMB73_365784                    277   3e-86    
ref|XP_004985214.1|  PREDICTED: beta-glucosidase 6-like                 277   4e-86    
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         278   4e-86    
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    277   4e-86    Zea mays [maize]
ref|XP_008644990.1|  PREDICTED: beta-glucosidase 38-like                278   5e-86    
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     276   8e-86    Tarenaya hassleriana [spider flower]
ref|XP_009802933.1|  PREDICTED: beta-glucosidase 40-like                276   9e-86    Nicotiana sylvestris
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      276   1e-85    
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                276   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910032.1|  PREDICTED: beta-glucosidase 25 isoform X4          273   2e-85    Elaeis guineensis
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    275   2e-85    Oryza sativa Japonica Group [Japonica rice]
emb|CDX85027.1|  BnaC05g20280D                                          276   2e-85    
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     275   3e-85    Brassica rapa
gb|KJB80347.1|  hypothetical protein B456_013G093000                    275   3e-85    Gossypium raimondii
gb|EEC74750.1|  hypothetical protein OsI_10506                          275   3e-85    Oryza sativa Indica Group [Indian rice]
ref|NP_001049358.1|  Os03g0212800                                       275   3e-85    
gb|EEE58575.1|  hypothetical protein OsJ_09895                          275   4e-85    Oryza sativa Japonica Group [Japonica rice]
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    274   4e-85    Oryza sativa Japonica Group [Japonica rice]
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    274   4e-85    Oryza sativa Japonica Group [Japonica rice]
ref|NP_173978.1|  beta glucosidase 40                                   275   5e-85    Arabidopsis thaliana [mouse-ear cress]
gb|AAM61600.1|  beta-glucosidase, putative                              274   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339824.1|  PREDICTED: beta-glucosidase 40                     274   6e-85    
ref|XP_006365136.1|  PREDICTED: beta-glucosidase 40-like                274   6e-85    Solanum tuberosum [potatoes]
gb|KJB80349.1|  hypothetical protein B456_013G093100                    271   6e-85    Gossypium raimondii
ref|XP_009110017.1|  PREDICTED: beta-glucosidase 40-like                274   9e-85    Brassica rapa
ref|NP_001058388.1|  Os06g0683300                                       267   1e-84    
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                273   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_002893397.1|  hypothetical protein ARALYDRAFT_472753             273   2e-84    
ref|XP_010499028.1|  PREDICTED: beta-glucosidase 40                     273   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_002866052.1|  glycosyl hydrolase family 1 protein                273   3e-84    Arabidopsis lyrata subsp. lyrata
ref|XP_009417732.1|  PREDICTED: beta-glucosidase 22-like                273   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             272   3e-84    Phaseolus vulgaris [French bean]
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                272   4e-84    Glycine max [soybeans]
ref|XP_008643498.1|  PREDICTED: hypothetical protein isoform X2         272   4e-84    Zea mays [maize]
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          271   4e-84    Elaeis guineensis
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      272   4e-84    Brachypodium distachyon [annual false brome]
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          271   5e-84    Elaeis guineensis
gb|EYU28848.1|  hypothetical protein MIMGU_mgv1a004935mg                271   5e-84    Erythranthe guttata [common monkey flower]
ref|XP_003607794.1|  Beta-glucosidase                                   272   5e-84    Medicago truncatula
ref|NP_001268161.1|  beta-glucosidase precursor                         271   5e-84    
gb|KDO62879.1|  hypothetical protein CISIN_1g010049mg                   269   5e-84    
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          271   6e-84    
ref|XP_010482861.1|  PREDICTED: putative beta-glucosidase 41 isof...    272   7e-84    
gb|KJB80348.1|  hypothetical protein B456_013G093100                    271   7e-84    
ref|XP_008390041.1|  PREDICTED: beta-glucosidase 40-like                271   8e-84    
ref|XP_006415932.1|  hypothetical protein EUTSA_v10007404mg             271   8e-84    
ref|XP_010443033.1|  PREDICTED: putative beta-glucosidase 41            272   8e-84    
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                271   1e-83    
gb|AHC04401.1|  beta-glucosidase 1                                      271   1e-83    
ref|XP_010267846.1|  PREDICTED: putative beta-glucosidase 41 isof...    270   1e-83    
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40                     271   1e-83    
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             271   1e-83    
ref|XP_010521463.1|  PREDICTED: beta-glucosidase 40-like isoform X3     270   1e-83    
gb|KFK27066.1|  hypothetical protein AALP_AA8G330000                    271   2e-83    
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     270   2e-83    
ref|XP_010267845.1|  PREDICTED: putative beta-glucosidase 41 isof...    270   2e-83    
ref|XP_004228406.1|  PREDICTED: beta-glucosidase 40                     270   2e-83    
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           270   2e-83    
ref|XP_006656393.1|  PREDICTED: beta-glucosidase 25-like isoform X1     270   2e-83    
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     270   2e-83    
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     270   2e-83    
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    270   2e-83    
gb|KHN20526.1|  Beta-glucosidase 40                                     270   2e-83    
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    270   2e-83    
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      270   3e-83    
emb|CDY20561.1|  BnaC07g12280D                                          270   3e-83    
ref|XP_009382668.1|  PREDICTED: beta-glucosidase 32-like isoform X1     270   4e-83    
emb|CBI27264.3|  unnamed protein product                                271   4e-83    
gb|AEX13814.1|  beta-glucosidase                                        271   4e-83    
ref|XP_009382669.1|  PREDICTED: beta-glucosidase 32-like isoform X2     270   4e-83    
emb|CDY61627.1|  BnaA08g19770D                                          269   5e-83    
gb|AAK07429.1|AF321287_1  beta-glucosidase                              270   5e-83    
ref|XP_010448292.1|  PREDICTED: putative beta-glucosidase 41 isof...    270   6e-83    
ref|XP_010448300.1|  PREDICTED: putative beta-glucosidase 41 isof...    270   6e-83    
sp|Q0DA21.2|BGL25_ORYSJ  RecName: Full=Beta-glucosidase 25; Short...    269   6e-83    
dbj|BAO04176.1|  hypothetical protein                                   269   7e-83    
gb|EMS46293.1|  Beta-glucosidase 34                                     269   7e-83    
gb|KHN44611.1|  Beta-glucosidase 44                                     266   7e-83    
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                268   8e-83    
ref|XP_007211440.1|  hypothetical protein PRUPE_ppa007195mg             265   1e-82    
ref|XP_002512097.1|  beta-glucosidase, putative                         268   1e-82    
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     268   1e-82    
ref|XP_002437464.1|  hypothetical protein SORBIDRAFT_10g027600          268   1e-82    
gb|KGN47642.1|  hypothetical protein Csa_6G366400                       267   2e-82    
ref|XP_009119981.1|  PREDICTED: putative beta-glucosidase 41            268   2e-82    
emb|CDY64930.1|  BnaCnng45520D                                          268   2e-82    
ref|XP_004966274.1|  PREDICTED: beta-glucosidase 25-like                267   2e-82    
emb|CDY42461.1|  BnaA10g08370D                                          268   2e-82    
gb|AGS43007.1|  beta-D-glucoside glucohydrolase                         268   3e-82    
ref|XP_006851185.1|  hypothetical protein AMTR_s00043p00189470          267   3e-82    
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                268   3e-82    
ref|XP_010258106.1|  PREDICTED: beta-glucosidase 6                      267   3e-82    
ref|XP_010230716.1|  PREDICTED: beta-glucosidase 22-like isoform X6     264   3e-82    
ref|XP_004144181.1|  PREDICTED: beta-glucosidase 40-like                267   3e-82    
emb|CDP00417.1|  unnamed protein product                                268   3e-82    
ref|XP_006651165.1|  PREDICTED: beta-glucosidase 6-like                 267   3e-82    
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                268   3e-82    
ref|XP_007021152.1|  Beta glucosidase 41 isoform 3                      263   3e-82    
ref|NP_200268.3|  beta glucosidase 41                                   268   3e-82    
ref|XP_010230714.1|  PREDICTED: beta-glucosidase 22-like isoform X4     264   5e-82    
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             267   5e-82    
gb|KDP41287.1|  hypothetical protein JCGZ_15694                         266   7e-82    
ref|XP_008445464.1|  PREDICTED: beta-glucosidase 40                     266   7e-82    
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                266   9e-82    
ref|XP_003614037.1|  Beta-glucosidase                                   265   1e-81    
ref|XP_001771364.1|  predicted protein                                  265   1e-81    
ref|XP_010644313.1|  PREDICTED: putative beta-glucosidase 41            265   1e-81    
ref|XP_008801184.1|  PREDICTED: beta-glucosidase 31-like                266   1e-81    
ref|XP_010230713.1|  PREDICTED: putative beta-glucosidase 6 isofo...    264   1e-81    
dbj|BAJ98823.1|  predicted protein                                      265   1e-81    
ref|XP_007050911.1|  Beta glucosidase 11                                266   1e-81    
ref|XP_007207081.1|  hypothetical protein PRUPE_ppa024434mg             266   1e-81    
ref|XP_007045905.1|  Beta glucosidase 40                                266   1e-81    
gb|EMT21383.1|  Beta-glucosidase 6                                      265   2e-81    
ref|XP_007021151.1|  Beta glucosidase 41 isoform 2                      263   2e-81    
ref|XP_008228992.1|  PREDICTED: beta-glucosidase 12-like                265   3e-81    
ref|XP_001771505.1|  predicted protein                                  265   3e-81    
ref|XP_002316096.2|  hydroxyisourate hydrolase family protein           264   4e-81    
gb|KDO74406.1|  hypothetical protein CISIN_1g015181mg                   261   7e-81    
dbj|BAJ85274.1|  predicted protein                                      264   7e-81    
gb|EYU28850.1|  hypothetical protein MIMGU_mgv1a004939mg                262   7e-81    
gb|AII20122.1|  beta-glucosidase                                        263   7e-81    
gb|KGN57944.1|  hypothetical protein Csa_3G402970                       259   7e-81    
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                263   7e-81    
gb|ACD65509.2|  beta-glucosidase D4                                     264   8e-81    
ref|XP_010259578.1|  PREDICTED: beta-glucosidase 22-like                264   8e-81    
gb|KEH33183.1|  glycoside hydrolase family 1 protein                    259   8e-81    
emb|CBI27265.3|  unnamed protein product                                264   9e-81    
gb|EPS62836.1|  hypothetical protein M569_11950                         256   9e-81    
ref|XP_003565601.1|  PREDICTED: beta-glucosidase 10-like isoform X1     263   1e-80    
ref|XP_011048253.1|  PREDICTED: putative beta-glucosidase 41 isof...    261   1e-80    
gb|AES96995.2|  beta-glucosidase                                        263   1e-80    
emb|CBI20471.3|  unnamed protein product                                265   1e-80    
gb|ACD65511.1|  beta-glucosidase D7                                     263   1e-80    
ref|XP_006495386.1|  PREDICTED: beta-glucosidase 44-like                260   1e-80    
ref|XP_010044986.1|  PREDICTED: beta-glucosidase 13-like                263   2e-80    
ref|XP_007149078.1|  hypothetical protein PHAVU_005G039200g             258   2e-80    
ref|XP_008226796.1|  PREDICTED: putative beta-glucosidase 41 isof...    262   2e-80    
ref|XP_007150413.1|  hypothetical protein PHAVU_005G151400g             261   3e-80    
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    262   3e-80    
gb|KDP28153.1|  hypothetical protein JCGZ_13924                         262   3e-80    
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      262   3e-80    
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    261   4e-80    
gb|EYU28849.1|  hypothetical protein MIMGU_mgv1a004939mg                261   4e-80    
ref|XP_007219276.1|  hypothetical protein PRUPE_ppa018404mg             261   5e-80    
ref|XP_007220127.1|  hypothetical protein PRUPE_ppa020817mg             261   5e-80    
ref|XP_007133036.1|  hypothetical protein PHAVU_011G145900g             261   5e-80    
ref|XP_011095298.1|  PREDICTED: putative beta-glucosidase 41 isof...    261   6e-80    
ref|XP_007050908.1|  Beta glucosidase 11 isoform 1                      261   6e-80    
gb|AFU61920.1|  beta-glucosidase 1                                      264   6e-80    
gb|KDO67897.1|  hypothetical protein CISIN_1g0132981mg                  253   6e-80    
dbj|BAB09336.1|  beta-glucosidase                                       261   7e-80    
ref|XP_008241169.1|  PREDICTED: beta-glucosidase 12-like                261   7e-80    
ref|XP_006370585.1|  linamarase family protein                          261   7e-80    
gb|KHN44701.1|  Beta-glucosidase 11                                     261   8e-80    
ref|XP_007220683.1|  hypothetical protein PRUPE_ppa020067mg             261   8e-80    
gb|KDP39010.1|  hypothetical protein JCGZ_00767                         263   9e-80    
ref|XP_008454583.1|  PREDICTED: beta-glucosidase 25 isoform X2          261   1e-79    
gb|KHN33321.1|  Non-cyanogenic beta-glucosidase                         259   1e-79    
ref|XP_006855559.1|  hypothetical protein AMTR_s00057p00222890          261   1e-79    
ref|XP_010038208.1|  PREDICTED: beta-glucosidase 11                     261   1e-79    
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                261   1e-79    
gb|KDO67896.1|  hypothetical protein CISIN_1g0132981mg                  253   1e-79    
ref|XP_008454582.1|  PREDICTED: beta-glucosidase 25 isoform X1          261   1e-79    
ref|XP_010921681.1|  PREDICTED: beta-glucosidase 22-like                260   1e-79    
ref|XP_007205247.1|  hypothetical protein PRUPE_ppa006167mg             258   1e-79    
ref|XP_007206382.1|  hypothetical protein PRUPE_ppa017981mg             260   1e-79    
ref|XP_007208264.1|  hypothetical protein PRUPE_ppa015887mg             260   1e-79    
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                260   2e-79    
ref|XP_007206744.1|  hypothetical protein PRUPE_ppa025067mg             260   2e-79    
ref|XP_011075589.1|  PREDICTED: beta-glucosidase 6                      260   2e-79    
ref|XP_007208652.1|  hypothetical protein PRUPE_ppa020368mg             260   2e-79    
ref|XP_001769442.1|  predicted protein                                  259   2e-79    
ref|XP_004160275.1|  PREDICTED: putative beta-glucosidase 41-like       259   2e-79    
ref|XP_006475282.1|  PREDICTED: putative beta-glucosidase 41-like       259   3e-79    
ref|XP_003530289.2|  PREDICTED: beta-glucosidase 11-like                259   3e-79    
dbj|BAO04180.1|  hypothetical protein                                   259   3e-79    
ref|XP_007140265.1|  hypothetical protein PHAVU_008G097600g             260   3e-79    
dbj|BAG13451.1|  beta-glucosidase                                       260   4e-79    
ref|XP_009356955.1|  PREDICTED: beta-glucosidase 11-like isoform X2     259   4e-79    
gb|KEH33182.1|  glycoside hydrolase family 1 protein                    259   4e-79    
ref|XP_009356954.1|  PREDICTED: beta-glucosidase 11-like isoform X1     259   4e-79    
gb|EYU19188.1|  hypothetical protein MIMGU_mgv1a004736mg                259   4e-79    
ref|XP_004151969.1|  PREDICTED: putative beta-glucosidase 41-like       259   5e-79    
ref|NP_001063639.1|  Os09g0511700                                       251   5e-79    
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41            259   5e-79    
ref|XP_007221103.1|  hypothetical protein PRUPE_ppa017484mg             258   6e-79    
ref|XP_007207911.1|  hypothetical protein PRUPE_ppa019573mg             259   6e-79    
ref|XP_009417742.1|  PREDICTED: beta-glucosidase 22-like                259   6e-79    
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                259   6e-79    
ref|XP_008245651.1|  PREDICTED: beta-glucosidase 12-like                259   7e-79    
ref|XP_008229217.1|  PREDICTED: beta-glucosidase 12-like                258   8e-79    
ref|XP_008365874.1|  PREDICTED: putative beta-glucosidase 41            258   8e-79    
ref|XP_002992401.1|  hypothetical protein SELMODRAFT_135249             258   9e-79    
ref|XP_007203079.1|  hypothetical protein PRUPE_ppa023565mg             258   9e-79    
ref|XP_003597482.1|  Beta-glucosidase D4                                258   9e-79    
ref|XP_007203718.1|  hypothetical protein PRUPE_ppa019137mg             258   1e-78    
ref|XP_007131976.1|  hypothetical protein PHAVU_011G056300g             258   1e-78    
ref|NP_563666.1|  beta glucosidase 11                                   257   1e-78    
gb|ACN41025.1|  unknown                                                 258   1e-78    
ref|XP_006855558.1|  hypothetical protein AMTR_s00057p00221950          258   1e-78    
ref|NP_973745.1|  beta glucosidase 11                                   257   1e-78    
ref|XP_007149077.1|  hypothetical protein PHAVU_005G039200g             258   1e-78    
gb|EAZ28287.1|  hypothetical protein OsJ_12262                          255   1e-78    
ref|XP_006444315.1|  hypothetical protein CICLE_v10019719mg             254   1e-78    
emb|CAN72287.1|  hypothetical protein VITISV_036888                     256   1e-78    
ref|NP_849578.5|  beta glucosidase 11                                   257   2e-78    
ref|XP_002285582.1|  PREDICTED: beta-glucosidase 12-like                257   2e-78    
gb|KHN28382.1|  Putative beta-glucosidase 41                            257   2e-78    
gb|KDP28152.1|  hypothetical protein JCGZ_13923                         257   2e-78    
ref|XP_010062938.1|  PREDICTED: putative beta-glucosidase 41            257   2e-78    
ref|XP_003620196.1|  Beta-glucosidase D2                                258   2e-78    
ref|NP_001117217.1|  beta glucosidase 11                                257   2e-78    
gb|AES76414.2|  glycoside hydrolase family 1 protein                    257   2e-78    
ref|XP_010267075.1|  PREDICTED: beta-glucosidase 12-like isoform X3     254   2e-78    
ref|NP_973746.3|  beta glucosidase 11                                   257   3e-78    
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            257   3e-78    
gb|EEE55571.1|  hypothetical protein OsJ_03847                          256   3e-78    
ref|XP_007207988.1|  hypothetical protein PRUPE_ppa015161mg             257   3e-78    
gb|KEH30302.1|  glycoside hydrolase family 1 protein                    253   3e-78    
ref|XP_011007095.1|  PREDICTED: vicianin hydrolase-like                 257   3e-78    
gb|AAF02882.1|AC009525_16  Similar to beta-glucosidases                 256   3e-78    
ref|XP_007220362.1|  hypothetical protein PRUPE_ppa015970mg             257   3e-78    
gb|EEC71693.1|  hypothetical protein OsI_04188                          256   3e-78    
ref|XP_002512142.1|  beta-glucosidase, putative                         255   4e-78    
ref|XP_006844763.1|  hypothetical protein AMTR_s00016p00257720          256   4e-78    
ref|XP_002992609.1|  hypothetical protein SELMODRAFT_135673             256   4e-78    
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                257   4e-78    
gb|KDO87245.1|  hypothetical protein CISIN_1g046009mg                   253   4e-78    
gb|KDP28154.1|  hypothetical protein JCGZ_13925                         252   5e-78    
gb|KCW51256.1|  hypothetical protein EUGRSUZ_J00833                     256   5e-78    
dbj|BAO04179.1|  hypothetical protein                                   256   5e-78    
ref|XP_009769966.1|  PREDICTED: putative beta-glucosidase 41            256   5e-78    
ref|XP_003597509.1|  Beta-glucosidase D2                                256   6e-78    
gb|KEH30766.1|  glycoside hydrolase family 1 protein                    256   6e-78    
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     256   6e-78    
ref|XP_010031675.1|  PREDICTED: beta-glucosidase 11-like                256   6e-78    
gb|AES67732.2|  glycoside hydrolase family 1 protein                    256   6e-78    
emb|CDP19659.1|  unnamed protein product                                256   6e-78    
gb|KJB81862.1|  hypothetical protein B456_013G165100                    252   7e-78    
ref|XP_009364765.1|  PREDICTED: beta-glucosidase 13-like                256   7e-78    
ref|XP_002512144.1|  beta-glucosidase, putative                         252   7e-78    
sp|Q8RZL1.2|BGL03_ORYSJ  RecName: Full=Beta-glucosidase 3; Short=...    256   8e-78    
ref|XP_011461904.1|  PREDICTED: beta-glucosidase 12-like                256   8e-78    
ref|XP_007140261.1|  hypothetical protein PHAVU_008G097200g             256   8e-78    
tpg|DAA36950.1|  TPA: hypothetical protein ZEAMMB73_322711              248   9e-78    
ref|XP_010539264.1|  PREDICTED: putative beta-glucosidase 41 isof...    255   9e-78    
ref|XP_008461253.1|  PREDICTED: vicianin hydrolase-like                 256   9e-78    
ref|XP_009364758.1|  PREDICTED: beta-glucosidase 13-like                256   9e-78    
ref|XP_010092278.1|  Putative beta-glucosidase 41                       255   1e-77    
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     255   1e-77    
ref|XP_008229774.1|  PREDICTED: cyanogenic beta-glucosidase-like        252   1e-77    
gb|KEH30300.1|  glycoside hydrolase family 1 protein                    251   1e-77    
ref|XP_002273684.2|  PREDICTED: furcatin hydrolase                      255   1e-77    
gb|ABK60303.2|  glycosylhydrolase family 1                              249   1e-77    
ref|XP_001765414.1|  predicted protein                                  254   1e-77    
ref|XP_003566492.1|  PREDICTED: beta-glucosidase 22-like isoform X2     255   2e-77    
ref|XP_004295223.1|  PREDICTED: beta-glucosidase 12-like                255   2e-77    
ref|XP_002512137.1|  beta-glucosidase, putative                         251   2e-77    
ref|XP_007014814.1|  Beta-glucosidase 17 isoform 2                      255   2e-77    



>ref|XP_009600118.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=515

 Score =   424 bits (1091),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/237 (84%), Positives = 215/237 (91%), Gaps = 1/237 (0%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            +ST   ++S+++        FDTGGLSR SFPKGF+FGTATSAYQVEGAA  E GRGPSI
Sbjct  18   LSTVITVKSDINDVLPEKLSFDTGGLSRESFPKGFIFGTATSAYQVEGAASTE-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WDTFIK PG EPNNA GEV+VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN
Sbjct  77   WDTFIKRPGVEPNNANGEVAVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YML+RGITPYANLNHYDLPQALQDRYNGWL R VV+D+ADYAEFCFKT
Sbjct  137  WKGVAYYNRLIDYMLERGITPYANLNHYDLPQALQDRYNGWLSREVVKDYADYAEFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNWFSFNEPRVVAALGYD GFFAPGRCSKPFGNCTEG+SATEPYIV HNL+L
Sbjct  197  FGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLIL  253



>ref|XP_009757932.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=515

 Score =   423 bits (1088),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 216/237 (91%), Gaps = 1/237 (0%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            +ST   ++S+++  +     FDTGGLSR SFPKGF+FGTATSAYQVEGAA  + GRGPSI
Sbjct  18   LSTVITVKSDINDISPEKLSFDTGGLSRESFPKGFIFGTATSAYQVEGAASTD-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WDTFIK PG EPNNA GEV+VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN
Sbjct  77   WDTFIKRPGVEPNNANGEVAVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YML+RGITPYANLNHYDLPQALQDRYNGWL R VV+D+ADYAEFCFKT
Sbjct  137  WKGVAYYNRLIDYMLERGITPYANLNHYDLPQALQDRYNGWLSREVVKDYADYAEFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNWFSFNEPRVVAALGYD GFFAPGRCSKPFGNCTEG+SATEPYIV HNL+L
Sbjct  197  FGDRVKNWFSFNEPRVVAALGYDTGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLIL  253



>ref|XP_006341563.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=512

 Score =   419 bits (1076),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 213/237 (90%), Gaps = 4/237 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            + T      +VSPE T     DTGGLSR SFPKGF+FGTATSAYQVEG+A  E GRGPSI
Sbjct  18   VLTVHSENDDVSPENTI---LDTGGLSRESFPKGFIFGTATSAYQVEGSASTE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WDTF+K PG EPNNA GE++VDQYHRYKEDIDL+A LNFEAYRFSISWSRIFPNGTG+VN
Sbjct  74   WDTFLKIPGLEPNNANGEIAVDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGEVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YMLKRGITPYANLNHYDLPQALQDRYNGWL R VV+DFADYAEFCFKT
Sbjct  134  WKGVAYYNRLIDYMLKRGITPYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEG+SATEPYIV HNL+L
Sbjct  194  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLIL  250



>ref|NP_001234620.1| beta-mannosidase enzyme precursor [Solanum lycopersicum]
 gb|AAL37714.1|AF403444_1 beta-mannosidase enzyme [Solanum lycopersicum]
 gb|AAL37719.1|AF413204_1 beta-mannosidase [Solanum lycopersicum]
Length=514

 Score =   418 bits (1074),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 209/227 (92%), Gaps = 4/227 (2%)
 Frame = +1

Query  106  VSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGR  285
            VSPE T     DTGGLSR SFPKGF FGTATSAYQVEG+A  E GRGPSIWDTF+K PG 
Sbjct  30   VSPENTI---LDTGGLSRESFPKGFTFGTATSAYQVEGSASTE-GRGPSIWDTFLKIPGL  85

Query  286  EPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRL  465
            EPNNA GE++VDQYHRYKEDIDL+A LNFEAYRFSISWSRIFPNGTGKVNW+GVAYYNRL
Sbjct  86   EPNNANGEIAVDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRL  145

Query  466  INYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFS  645
            I+YMLKRGITPYANLNHYDLPQALQDRYNGWL R VV+DFADYAEFCFKTFGDRVKNWFS
Sbjct  146  IDYMLKRGITPYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKTFGDRVKNWFS  205

Query  646  FNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FNEPRVVAALGYDNGFFAPGRCSKPFGNCTEG+SATEPYIV HNL+L
Sbjct  206  FNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGDSATEPYIVAHNLIL  252



>ref|XP_006353826.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=502

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/238 (79%), Positives = 206/238 (87%), Gaps = 6/238 (3%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++T   IQS+        A FDTGGL+R SFPK FVFGT+TSAYQVEGAA K+ GRGPS+
Sbjct  13   LTTLMAIQSD-----NVTAVFDTGGLNRESFPKSFVFGTSTSAYQVEGAASKD-GRGPSV  66

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WDTFIK PGREPNNA+GEVS DQYH YKEDIDL+  LNF+AYRFSISWSRIFPNGTGK+N
Sbjct  67   WDTFIKLPGREPNNASGEVSADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKIN  126

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GV YYN+LINYMLK+GI PY NLNHYDLPQALQ+RY GWL R VV+DFADYAEFCFKT
Sbjct  127  WKGVTYYNKLINYMLKKGIAPYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKT  186

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            +GDRVKNWFSFNEPRVVA LGYD GFFAPGRCSK FGNCT G+SATEPYIV HNL+LS
Sbjct  187  YGDRVKNWFSFNEPRVVADLGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILS  244



>ref|XP_009799689.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=513

 Score =   400 bits (1029),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 210/239 (88%), Gaps = 5/239 (2%)
 Frame = +1

Query  76   ISTATEIQSE-VSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPS  252
            +ST T IQS+ V PETT    FDTGGLSR SFPK FVFGT+TSAYQVEGAA K+ GRGPS
Sbjct  18   LSTLTLIQSDNVLPETTV---FDTGGLSRDSFPKDFVFGTSTSAYQVEGAASKD-GRGPS  73

Query  253  IWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKV  432
            +WDTFIK PGREPNNA+GEVS DQYHRYKEDIDL+  LNF+AYRFSISWSRIFPNGTGK+
Sbjct  74   VWDTFIKKPGREPNNASGEVSADQYHRYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKI  133

Query  433  NWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFK  612
            NW+GVAYYNRLI+YMLK+GIT Y NLNHYDLPQALQD+Y GWL   VV+DFADYAEFCFK
Sbjct  134  NWKGVAYYNRLIDYMLKKGITSYVNLNHYDLPQALQDKYKGWLSHEVVKDFADYAEFCFK  193

Query  613  TFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             +GDRVKNWFSFNEPRVVA LGY+ G+FAPGRCSK FGNC  G+SATEPYIV HNL+LS
Sbjct  194  AYGDRVKNWFSFNEPRVVADLGYNTGYFAPGRCSKAFGNCISGDSATEPYIVAHNLILS  252



>ref|XP_009624185.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=513

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 210/239 (88%), Gaps = 5/239 (2%)
 Frame = +1

Query  76   ISTATEIQSE-VSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPS  252
            +ST   IQS+ V PET   A FDTGGLSR SFPKGFVFGT+TSAYQVEGAA K+ GRGPS
Sbjct  18   LSTLNLIQSDNVLPET---AVFDTGGLSRDSFPKGFVFGTSTSAYQVEGAASKD-GRGPS  73

Query  253  IWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKV  432
            +WD FIK PGREPNNA+GEVS DQYHRYKEDIDL+  LNF+AYRFSISWSRIFPNGTGK+
Sbjct  74   VWDIFIKKPGREPNNASGEVSADQYHRYKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKI  133

Query  433  NWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFK  612
            NW+GVAYYN+LI+Y LK+GITPY NLNHYDLPQALQD Y GWL   VV+DFADYAEFCFK
Sbjct  134  NWKGVAYYNKLIDYTLKKGITPYVNLNHYDLPQALQDNYKGWLSHEVVKDFADYAEFCFK  193

Query  613  TFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            T+GDRVKNWFSFNEPRVVA LGY+ G+FAPGRCSK FGNCT G+SATEPYIV HNL+LS
Sbjct  194  TYGDRVKNWFSFNEPRVVADLGYNTGYFAPGRCSKAFGNCTSGDSATEPYIVAHNLILS  252



>ref|XP_011084444.1| PREDICTED: beta-glucosidase 44-like [Sesamum indicum]
Length=502

 Score =   399 bits (1024),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/226 (85%), Positives = 201/226 (89%), Gaps = 1/226 (0%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
            S +       D GGLSR SFPK FVFGTA SAYQVEG A K  GRGPSIWDTFIK PGRE
Sbjct  16   SAQCDEAESVDLGGLSRRSFPKDFVFGTAASAYQVEGMASKG-GRGPSIWDTFIKQPGRE  74

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
            PNNA+GEVSVDQYH+YKEDIDL+A LNF+AYRFSISW RIFPNGTGKVN +GVAYYNRLI
Sbjct  75   PNNASGEVSVDQYHKYKEDIDLMAKLNFDAYRFSISWPRIFPNGTGKVNKKGVAYYNRLI  134

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NYMLK+GITPY NLNHYDLPQALQDRYNGWL R+VVEDFADYAEFCFKTFGDRVKNW +F
Sbjct  135  NYMLKKGITPYPNLNHYDLPQALQDRYNGWLGRQVVEDFADYAEFCFKTFGDRVKNWQTF  194

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            NEPRVVAALGYDNGFFAPGRCSK FGNCTEGNSATEPYIV HNL+L
Sbjct  195  NEPRVVAALGYDNGFFAPGRCSKAFGNCTEGNSATEPYIVAHNLIL  240



>ref|XP_004252272.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Solanum lycopersicum]
Length=526

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/234 (81%), Positives = 207/234 (88%), Gaps = 5/234 (2%)
 Frame = +1

Query  91   EIQSE-VSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTF  267
            +I+S+ V  ETT    FDTGGL+R SFPKGFVFGT+TSAYQVEGAA K+ GRGPS+WDTF
Sbjct  37   DIESDNVLAETTV---FDTGGLNRESFPKGFVFGTSTSAYQVEGAASKD-GRGPSVWDTF  92

Query  268  IKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGV  447
            IK PGREPNNA+GEVS DQYH YKEDIDL+  LNF+AYRFSISWSRIFPNGT K+NW+GV
Sbjct  93   IKQPGREPNNASGEVSADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPNGTEKINWKGV  152

Query  448  AYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDR  627
             YYN+LINYML RGITPY NLNHYDLPQALQ+RY GWL R VV+DFADYAEFCFKT+GDR
Sbjct  153  TYYNKLINYMLFRGITPYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDR  212

Query  628  VKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            VKNWFSFNEPRVVA LGYD GFFAPGRCSK FGNCT G+SATEPYIV HNL+LS
Sbjct  213  VKNWFSFNEPRVVADLGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILS  266



>gb|EYU40222.1| hypothetical protein MIMGU_mgv1a004735mg [Erythranthe guttata]
Length=512

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 207/238 (87%), Gaps = 3/238 (1%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            +S     + + SPET    G D GGLSR +FPK FVFGTA SAYQVEG A K+ GRGPSI
Sbjct  17   LSQCFTHEDDASPETAV--GLDLGGLSRRTFPKNFVFGTAASAYQVEGMASKD-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WDTFIK PG EPNNA+GEVSVDQYH+YK+D+DL+A LNF+AYRFSISWSRIFPNGTGKVN
Sbjct  74   WDTFIKTPGLEPNNASGEVSVDQYHKYKDDLDLMAKLNFDAYRFSISWSRIFPNGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
             +GVAYYNRLINYMLK+GITPY NLNHYDLPQALQDRY GWL R VV+DFADYAEFCFKT
Sbjct  134  KKGVAYYNRLINYMLKKGITPYPNLNHYDLPQALQDRYKGWLGREVVKDFADYAEFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK FGNCTEG+S+TEPY V HNL+LS
Sbjct  194  FGDRVKNWQTFNEPRVVAALGYDNGFFAPGRCSKAFGNCTEGDSSTEPYTVAHNLILS  251



>gb|KEH16705.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=314

 Score =   381 bits (979),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I   + ++    PET      DTGGLSR  FPKGFVFG ATSAYQVEG A KE GRGPSI
Sbjct  21   IVLVSSVKGVTVPETVH---LDTGGLSRDVFPKGFVFGVATSAYQVEGIASKE-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN TGEVSVDQYHRYKEDIDL+A LNF+ YRFSISWSRIFPNGTGKVN
Sbjct  77   WDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L++GITPYANL HYDLP AL+ +YNG L+R VV+DFADYA+FCFKT
Sbjct  137  WKGVAYYNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLNRNVVKDFADYADFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRV+AALGYD GFFAPGRCSK +GNCT GNS TEPYIV HNL+LS
Sbjct  197  FGDRVKNWMTFNEPRVIAALGYDTGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILS  254



>ref|XP_003637785.1| Beta-glucosidase [Medicago truncatula]
Length=282

 Score =   379 bits (974),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I   + ++    PET      DTGGLSR  FPKGFVFG ATSAYQVEG A KE GRGPSI
Sbjct  21   IVLVSSVKGVTVPETVH---LDTGGLSRDVFPKGFVFGVATSAYQVEGIASKE-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN TGEVSVDQYHRYKEDIDL+A LNF+ YRFSISWSRIFPNGTGKVN
Sbjct  77   WDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L++GITPYANL HYDLP AL+ +YNG L+R VV+DFADYA+FCFKT
Sbjct  137  WKGVAYYNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLNRNVVKDFADYADFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRV+AALGYD GFFAPGRCSK +GNCT GNS TEPYIV HNL+LS
Sbjct  197  FGDRVKNWMTFNEPRVIAALGYDTGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILS  254



>gb|KDO62884.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=411

 Score =   384 bits (986),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 200/227 (88%), Gaps = 4/227 (2%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
             PET     FDTGGLSR S P GFVFGTATSAYQVEG A K+ GRGPSIWD F K PG  
Sbjct  36   QPETVH---FDTGGLSRESLPNGFVFGTATSAYQVEGMAHKD-GRGPSIWDVFAKKPGIV  91

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNATG+VSVDQYHRYKED+D++ANLNF+AYRFSISWSRIFP GTGKVNW+GVAYYN+LI
Sbjct  92   ANNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLI  151

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NY+LKRGITPYANL HYDLP+AL+ +YNG L +RVV+DFADYA+FCFKTFGDRVKNW +F
Sbjct  152  NYLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTF  211

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV HNL+LS
Sbjct  212  NEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILS  258



>gb|KDO62882.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
 gb|KDO62883.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=405

 Score =   383 bits (984),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 200/227 (88%), Gaps = 4/227 (2%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
             PET     FDTGGLSR S P GFVFGTATSAYQVEG A K+ GRGPSIWD F K PG  
Sbjct  36   QPETVH---FDTGGLSRESLPNGFVFGTATSAYQVEGMAHKD-GRGPSIWDVFAKKPGIV  91

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNATG+VSVDQYHRYKED+D++ANLNF+AYRFSISWSRIFP GTGKVNW+GVAYYN+LI
Sbjct  92   ANNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLI  151

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NY+LKRGITPYANL HYDLP+AL+ +YNG L +RVV+DFADYA+FCFKTFGDRVKNW +F
Sbjct  152  NYLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTF  211

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV HNL+LS
Sbjct  212  NEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILS  258



>gb|KDO62881.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=430

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 200/227 (88%), Gaps = 4/227 (2%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
             PET     FDTGGLSR S P GFVFGTATSAYQVEG A K+ GRGPSIWD F K PG  
Sbjct  36   QPETVH---FDTGGLSRESLPNGFVFGTATSAYQVEGMAHKD-GRGPSIWDVFAKKPGIV  91

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNATG+VSVDQYHRYKED+D++ANLNF+AYRFSISWSRIFP GTGKVNW+GVAYYN+LI
Sbjct  92   ANNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLI  151

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NY+LKRGITPYANL HYDLP+AL+ +YNG L +RVV+DFADYA+FCFKTFGDRVKNW +F
Sbjct  152  NYLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTF  211

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV HNL+LS
Sbjct  212  NEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILS  258



>ref|XP_006490742.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=519

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 200/227 (88%), Gaps = 4/227 (2%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
             PET     FDTGGLSR S P GFVFGTATSAYQVEG A KE GRGPSIWD F K PG  
Sbjct  36   QPETVH---FDTGGLSRESLPNGFVFGTATSAYQVEGMAHKE-GRGPSIWDVFAKKPGIV  91

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNATG+VSVDQYHRYKED+D++ANLNF+AYRFSISWSRIFP GTGKVNW+GVAYYN+LI
Sbjct  92   ANNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLI  151

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NY+LKRGITPYANL HYDLP+AL+ +YNG L +RVV+DFADYA+FCFKTFGDRVKNW +F
Sbjct  152  NYLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTF  211

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV HNL+LS
Sbjct  212  NEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILS  258



>ref|XP_003534146.1| PREDICTED: beta-glucosidase 44 [Glycine max]
Length=506

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR +FPKGF+FGTATSAYQVEG A K+ GRGPSIWD FIK PG   NN TGEVS
Sbjct  29   FDTGGLSRDTFPKGFLFGTATSAYQVEGMAHKD-GRGPSIWDVFIKKPGIVANNGTGEVS  87

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKEDIDL+A+LNF+AYRFSISWSRIFPNGTG+VNW+GVAYYNRLINY+L++GIT
Sbjct  88   VDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLINYLLEKGIT  147

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL++RYNG L R+VV+DFADYAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  148  PYANLYHYDLPLALEERYNGLLSRQVVKDFADYAEFCFKTFGDRVKNWMTFNEPRVVAAL  207

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNGFFAPGRCSK +GNCT GNS TEPYIV HNL+LS
Sbjct  208  GYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILS  245



>gb|ACU24532.1| unknown [Glycine max]
Length=506

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR +FPKGF+FGTATSAYQVEG A K+ GRGPSIWD FIK PG   NN TGEVS
Sbjct  29   FDTGGLSRDTFPKGFLFGTATSAYQVEGMAHKD-GRGPSIWDVFIKKPGIVANNGTGEVS  87

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKEDIDL+A+LNF+AYRFSISWSRIFPNGTG+VNW+GVAYYNRLINY+L++GIT
Sbjct  88   VDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLINYLLEKGIT  147

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL++RYNG L R+VV+DFADYAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  148  PYANLYHYDLPLALEERYNGLLSRQVVKDFADYAEFCFKTFGDRVKNWMTFNEPRVVAAL  207

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNGFFAPGRCSK +GNCT GNS TEPYIV HNL+LS
Sbjct  208  GYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILS  245



>ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine max]
Length=515

 Score =   384 bits (985),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 201/226 (89%), Gaps = 4/226 (2%)
 Frame = +1

Query  112  PETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREP  291
            PET     FDTGGLSR +FPKGF+FGTATSAYQVEG A K+ GRGPSIWD FIK PG   
Sbjct  33   PETVR---FDTGGLSRETFPKGFLFGTATSAYQVEGMAHKD-GRGPSIWDLFIKKPGIVA  88

Query  292  NNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLIN  471
            NN TGEVSVDQYHRYKEDIDL+A+LNF+AYRFSISWSRIFPNGTG+VNW+GVAYYNRLIN
Sbjct  89   NNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLIN  148

Query  472  YMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFN  651
            Y+L++GITPYANL HYDLP AL++RYNG L R+VV DFADYAEFCFKTFGDRVKNW +FN
Sbjct  149  YLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVNDFADYAEFCFKTFGDRVKNWMTFN  208

Query  652  EPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            EPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV HNL+LS
Sbjct  209  EPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILS  254



>ref|XP_010243804.1| PREDICTED: beta-glucosidase 44-like [Nelumbo nucifera]
Length=518

 Score =   384 bits (985),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 204/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            +S A E   +  PET   A FDTGGLSR SFPKGFVFGTATSAYQVEG A KE GRGPSI
Sbjct  24   VSHAAETGPDAWPET---ARFDTGGLSRESFPKGFVFGTATSAYQVEGMASKE-GRGPSI  79

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F++ PG    NATGE+SVDQYHRYKED++L+ANLNF+AYRFSISWSRIFP+G GKVN
Sbjct  80   WDVFVRIPGIVAKNATGEMSVDQYHRYKEDVNLMANLNFDAYRFSISWSRIFPDGAGKVN  139

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP AL+ +YNG L R VV DFA++AEFCFKT
Sbjct  140  WKGVAYYNRLIDYLLAKGITPYANLYHYDLPLALEKKYNGLLSREVVNDFANFAEFCFKT  199

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSKP+GNCT GNS TEPYIV HNL+LS
Sbjct  200  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKPYGNCTAGNSGTEPYIVAHNLILS  257



>gb|KCW83985.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83986.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=386

 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 205/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>gb|KDO62878.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=519

 Score =   383 bits (983),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 200/227 (88%), Gaps = 4/227 (2%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
             PET     FDTGGLSR S P GFVFGTATSAYQVEG A K+ GRGPSIWD F K PG  
Sbjct  36   QPETVH---FDTGGLSRESLPNGFVFGTATSAYQVEGMAHKD-GRGPSIWDVFAKKPGIV  91

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNATG+VSVDQYHRYKED+D++ANLNF+AYRFSISWSRIFP GTGKVNW+GVAYYN+LI
Sbjct  92   ANNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLI  151

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NY+LKRGITPYANL HYDLP+AL+ +YNG L +RVV+DFADYA+FCFKTFGDRVKNW +F
Sbjct  152  NYLLKRGITPYANLYHYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTF  211

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV HNL+LS
Sbjct  212  NEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNLILS  258



>ref|XP_008240180.1| PREDICTED: beta-glucosidase 44-like [Prunus mume]
Length=513

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 204/238 (86%), Gaps = 2/238 (1%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I+ ATE  +E S         DTGGLSRASFPKGFVFGTATSAYQVEG A KE GRGPSI
Sbjct  17   IAHATE-HNEASVLDPESLNLDTGGLSRASFPKGFVFGTATSAYQVEGMAHKE-GRGPSI  74

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN TGEV+VDQYHRYK+D+DL+ANLNF+AYRFSISWSRIFP+GTGKVN
Sbjct  75   WDEFIKIPGIVANNGTGEVAVDQYHRYKQDVDLMANLNFDAYRFSISWSRIFPDGTGKVN  134

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLINY++KRGITPYANL HYDLP AL+ +Y G L+ +VV+DFADYAEFCFKT
Sbjct  135  WKGVAYYNRLINYLIKRGITPYANLYHYDLPLALEKKYLGLLNDKVVKDFADYAEFCFKT  194

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAP RCSK +GNCT GNS+TEPYI  H+L+LS
Sbjct  195  FGDRVKNWMTFNEPRVVAALGYDNGFFAPARCSKAYGNCTAGNSSTEPYIAAHHLILS  252



>ref|XP_006451661.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64901.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=405

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/227 (80%), Positives = 198/227 (87%), Gaps = 4/227 (2%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
             PET     FDTGGLSR S P GFVFGTATSAYQVEG A K+ GRGPSIWD F K PG  
Sbjct  36   QPETVH---FDTGGLSRESLPNGFVFGTATSAYQVEGMAHKD-GRGPSIWDVFAKKPGIV  91

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNATG+VSVDQYHRYKED+D++ANLNF+AYRFSISWSRIFP GTGKVNW+GVAYYN+LI
Sbjct  92   ANNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLI  151

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NY+LKRGITPYANL HYDLP+AL+ +Y G L +RVV+DFADYA+FCFKTFGDRVKNW +F
Sbjct  152  NYLLKRGITPYANLYHYDLPEALEKKYIGLLSKRVVKDFADYADFCFKTFGDRVKNWMTF  211

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV HN +LS
Sbjct  212  NEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNSILS  258



>gb|KDP41124.1| hypothetical protein JCGZ_03615 [Jatropha curcas]
Length=516

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 197/218 (90%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR SFP GF+FGTATSAYQVEG A K+ GRGPSIWD F+K PG   NNATGEVS
Sbjct  39   FDTGGLSRQSFPAGFLFGTATSAYQVEGMADKD-GRGPSIWDEFVKIPGIVANNATGEVS  97

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVNW+GVAYYNRLI+YMLK+GIT
Sbjct  98   VDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIDYMLKKGIT  157

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L R+VV+DFADYA+FCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  158  PYANLYHYDLPLALEKKYKGLLGRQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAAL  217

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNG+FAPGRCSK FGNCT GNSATEPYIV HNL+LS
Sbjct  218  GYDNGYFAPGRCSKAFGNCTAGNSATEPYIVAHNLILS  255



>gb|KEH16708.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=408

 Score =   377 bits (967),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 197/238 (83%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            +   + +     PET      DTGGLSR  FPKGFVFG ATSAYQVEG A KE GRGPSI
Sbjct  21   VVLVSSVNGVTVPETVH---LDTGGLSRDVFPKGFVFGVATSAYQVEGMASKE-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN TGEVSVDQYHRYKEDIDL+A LNF+ YRFSISWSRIFPNGTGKVN
Sbjct  77   WDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L++GITPYANL HYDLP AL+ +YNG L R VV+DFADYA+FCFKT
Sbjct  137  WKGVAYYNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLSRNVVKDFADYADFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPY V HNL+LS
Sbjct  197  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILS  254



>ref|XP_010032608.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 204/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V PETT    FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIPETTR---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLINY+L++GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNG FAP RCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>ref|XP_007036679.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
 gb|EOY21180.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
Length=513

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 201/230 (87%), Gaps = 4/230 (2%)
 Frame = +1

Query  100  SEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFP  279
            S+V PET      DTGGLSR SFPKGFVFGTATSAYQVEG A  + GRGPSIWD F+K P
Sbjct  27   SQVQPETVK---LDTGGLSRESFPKGFVFGTATSAYQVEGMASGD-GRGPSIWDVFVKIP  82

Query  280  GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYN  459
            G    NATGEVSVDQYHRYKED+DL+ANLNF+AYRFSISWSRIFP+GTGKVNW+GVAYYN
Sbjct  83   GIVAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYN  142

Query  460  RLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNW  639
            RLI+ +L+RGITPYANL HYDLP+AL+ RYNG L  +VV+DFAD+A+FCFKTFGDRVKNW
Sbjct  143  RLIDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFADFADFCFKTFGDRVKNW  202

Query  640  FSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+L+
Sbjct  203  MTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILA  252



>ref|XP_007036681.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
 gb|EOY21182.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
Length=532

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 201/230 (87%), Gaps = 4/230 (2%)
 Frame = +1

Query  100  SEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFP  279
            S+V PET      DTGGLSR SFPKGFVFGTATSAYQVEG A  + GRGPSIWD F+K P
Sbjct  27   SQVQPETVK---LDTGGLSRESFPKGFVFGTATSAYQVEGMASGD-GRGPSIWDVFVKIP  82

Query  280  GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYN  459
            G    NATGEVSVDQYHRYKED+DL+ANLNF+AYRFSISWSRIFP+GTGKVNW+GVAYYN
Sbjct  83   GIVAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYN  142

Query  460  RLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNW  639
            RLI+ +L+RGITPYANL HYDLP+AL+ RYNG L  +VV+DFAD+A+FCFKTFGDRVKNW
Sbjct  143  RLIDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFADFADFCFKTFGDRVKNW  202

Query  640  FSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+L+
Sbjct  203  MTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILA  252



>gb|KCW83979.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83980.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   378 bits (971),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 205/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>gb|KCW83978.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   378 bits (970),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 205/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=503

 Score =   377 bits (969),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 198/230 (86%), Gaps = 4/230 (2%)
 Frame = +1

Query  100  SEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFP  279
            + + PET     FDTGGLSR SFPKGF+FGTATSAYQVEG A KE GRGPSIWD FIK P
Sbjct  17   TAMHPETVH---FDTGGLSRDSFPKGFIFGTATSAYQVEGMADKE-GRGPSIWDVFIKKP  72

Query  280  GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYN  459
            G   NN TGE+SVDQYH+Y +DID++A LNF+AYRFSISWSRIFPNG GKVNW+GVAYYN
Sbjct  73   GIVANNGTGEISVDQYHKYPQDIDIMAKLNFDAYRFSISWSRIFPNGRGKVNWKGVAYYN  132

Query  460  RLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNW  639
            +LINY+LKRGITPYANL HYDLPQAL++ Y G L  RVV+DFADYAEFCFKTFGDRVKNW
Sbjct  133  KLINYLLKRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNW  192

Query  640  FSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYI  H+L+LS
Sbjct  193  MTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILS  242



>gb|KEH16706.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   378 bits (970),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I   + ++    PET      DTGGLSR  FPKGFVFG ATSAYQVEG A KE GRGPSI
Sbjct  21   IVLVSSVKGVTVPETVH---LDTGGLSRDVFPKGFVFGVATSAYQVEGIASKE-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN TGEVSVDQYHRYKEDIDL+A LNF+ YRFSISWSRIFPNGTGKVN
Sbjct  77   WDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L++GITPYANL HYDLP AL+ +YNG L+R VV+DFADYA+FCFKT
Sbjct  137  WKGVAYYNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLNRNVVKDFADYADFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRV+AALGYD GFFAPGRCSK +GNCT GNS TEPYIV HNL+LS
Sbjct  197  FGDRVKNWMTFNEPRVIAALGYDTGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILS  254



>ref|XP_007209912.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
 gb|EMJ11111.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
Length=513

 Score =   377 bits (969),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 202/238 (85%), Gaps = 2/238 (1%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I+ ATE  +E           DTGGLSRASFPKGFVFGTATSAYQVEG A KE GRGPSI
Sbjct  17   IAHATE-HNEAPVLDPESLNLDTGGLSRASFPKGFVFGTATSAYQVEGMAHKE-GRGPSI  74

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN TGEV+VDQYHRYK+D+DL+ANLNF+AYRFSISWSRIFP+GTGKVN
Sbjct  75   WDEFIKIPGIVANNGTGEVAVDQYHRYKQDVDLMANLNFDAYRFSISWSRIFPDGTGKVN  134

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLINY++KRGITPYANL HYDLP AL+ +Y G L+  VV+DFADYAEFCFKT
Sbjct  135  WKGVAYYNRLINYLIKRGITPYANLYHYDLPLALEKKYLGLLNDEVVKDFADYAEFCFKT  194

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAP RCSK +GNCT GNS+TEPYI  H+L+LS
Sbjct  195  FGDRVKNWMTFNEPRVVAALGYDNGFFAPARCSKAYGNCTAGNSSTEPYIAAHHLILS  252



>ref|XP_010032621.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
 gb|KCW83984.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   377 bits (969),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 205/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>gb|KCW83981.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   377 bits (969),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 205/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>gb|KCW83982.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=513

 Score =   377 bits (969),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 205/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>ref|XP_006451662.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64902.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=519

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/227 (80%), Positives = 198/227 (87%), Gaps = 4/227 (2%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
             PET     FDTGGLSR S P GFVFGTATSAYQVEG A K+ GRGPSIWD F K PG  
Sbjct  36   QPETVH---FDTGGLSRESLPNGFVFGTATSAYQVEGMAHKD-GRGPSIWDVFAKKPGIV  91

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNATG+VSVDQYHRYKED+D++ANLNF+AYRFSISWSRIFP GTGKVNW+GVAYYN+LI
Sbjct  92   ANNATGDVSVDQYHRYKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLI  151

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NY+LKRGITPYANL HYDLP+AL+ +Y G L +RVV+DFADYA+FCFKTFGDRVKNW +F
Sbjct  152  NYLLKRGITPYANLYHYDLPEALEKKYIGLLSKRVVKDFADYADFCFKTFGDRVKNWMTF  211

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV HN +LS
Sbjct  212  NEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHNSILS  258



>gb|KCW83975.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83976.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 204/238 (86%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLINY+L++GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNG FAP RCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>ref|XP_008462973.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=507

 Score =   376 bits (966),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 196/228 (86%), Gaps = 4/228 (2%)
 Frame = +1

Query  106  VSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGR  285
            V PET     FDTGGLSR SFPKGF+FGTATSAYQVEG A KE GRGPSIWD FIK PG 
Sbjct  23   VQPETVH---FDTGGLSRDSFPKGFIFGTATSAYQVEGMADKE-GRGPSIWDVFIKKPGI  78

Query  286  EPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRL  465
              NN TGE+SVDQYHRY +DID++A LNF+AYRFSISWSRIFPNG  KVNW+GVAYYN+L
Sbjct  79   VANNGTGEISVDQYHRYPQDIDIMAKLNFDAYRFSISWSRIFPNGRRKVNWKGVAYYNKL  138

Query  466  INYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFS  645
            INY+LKRGITPYANL HYDLPQAL++ Y G L  RVV+DFADYAEFCFKTFGDRVKNW +
Sbjct  139  INYLLKRGITPYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMT  198

Query  646  FNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FNEPRVVAALGYDNGFFAPGRCSK +GNC  GNS TEPYIV H+L+LS
Sbjct  199  FNEPRVVAALGYDNGFFAPGRCSKAYGNCRAGNSGTEPYIVAHHLILS  246



>ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN64162.1| hypothetical protein Csa_1G042700 [Cucumis sativus]
Length=503

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 193/218 (89%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR SFPKGF+FGTATSAYQVEG A KE GRGPSIWD FIK PG   NN TGE+S
Sbjct  26   FDTGGLSRDSFPKGFIFGTATSAYQVEGMADKE-GRGPSIWDVFIKKPGIVANNGTGEIS  84

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYH+Y +DID++A LNF+AYRFSISWSRIFPNG GKVNW+GVAYYN+LINY+LKRGIT
Sbjct  85   VDQYHKYPQDIDIMAKLNFDAYRFSISWSRIFPNGRGKVNWKGVAYYNKLINYLLKRGIT  144

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLPQAL++ Y G L  RVV+DFADYAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  145  PYANLYHYDLPQALEEEYKGLLSDRVVKDFADYAEFCFKTFGDRVKNWMTFNEPRVVAAL  204

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNGFFAPGRCSK +GNCT GNS TEPYI  H+L+LS
Sbjct  205  GYDNGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILS  242



>gb|KEH16707.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   375 bits (964),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 197/238 (83%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            +   + +     PET      DTGGLSR  FPKGFVFG ATSAYQVEG A KE GRGPSI
Sbjct  21   VVLVSSVNGVTVPETVH---LDTGGLSRDVFPKGFVFGVATSAYQVEGMASKE-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN TGEVSVDQYHRYKEDIDL+A LNF+ YRFSISWSRIFPNGTGKVN
Sbjct  77   WDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLIAKLNFDQYRFSISWSRIFPNGTGKVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L++GITPYANL HYDLP AL+ +YNG L R VV+DFADYA+FCFKT
Sbjct  137  WKGVAYYNRLIDYLLEKGITPYANLYHYDLPLALELKYNGLLSRNVVKDFADYADFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPY V HNL+LS
Sbjct  197  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILS  254



>ref|XP_010032630.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   375 bits (962),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 203/238 (85%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V PET     FDTG LSR++FPKGF++GTATSAYQVEG A KE GRGPSI
Sbjct  18   MTRSTMAEETVIPETMR---FDTGRLSRSAFPKGFIWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG   NNATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGTVANNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLINY+LK+GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCF+T
Sbjct  134  WKGVAYYNRLINYLLKKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFET  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNG FAPGRCS  +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSLAYGNCTAGNSGTEPYIVAHHLILS  251



>ref|XP_007033096.1| B-S glucosidase 44 [Theobroma cacao]
 gb|EOY04022.1| B-S glucosidase 44 [Theobroma cacao]
Length=514

 Score =   374 bits (961),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 201/238 (84%), Gaps = 1/238 (0%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I++A +  +E +  T   A  DTGGLSR SFPKGFVFGTATSAYQVEG A K+ GRGPSI
Sbjct  18   IASAADQHNEATVATAKAADLDTGGLSRESFPKGFVFGTATSAYQVEGMANKD-GRGPSI  76

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD ++K PG   NN T +V+VDQYH YKEDIDL+A  NF+AYRFSISWSRIFP GTG+VN
Sbjct  77   WDAYVKVPGHIANNDTADVAVDQYHHYKEDIDLMAKFNFDAYRFSISWSRIFPEGTGRVN  136

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y++K+GITPY NL HYDLP ALQ++YNGWL+R+ VED+A+YAEFCFKT
Sbjct  137  WKGVAYYNRLIDYLIKKGITPYGNLYHYDLPLALQEKYNGWLNRQAVEDYANYAEFCFKT  196

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNWF+FNEPR+VAALG+DNG   P RCSK FGNCT GNSATEPYIV HNL+LS
Sbjct  197  FGDRVKNWFTFNEPRIVAALGFDNGINPPSRCSKEFGNCTAGNSATEPYIVAHNLILS  254



>gb|KCW83977.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   374 bits (961),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 203/238 (85%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++ +T  +  V  ETT+   FDTGGLSR++FPKGFV+GTATSAYQVEG A KE GRGPSI
Sbjct  18   VARSTMAEETVIHETTS---FDTGGLSRSAFPKGFVWGTATSAYQVEGMADKE-GRGPSI  73

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  74   WDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVN  133

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L +GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCFKT
Sbjct  134  WKGVAYYNRLIDYLLSKGITPYANLYHYDLPEALEKKYQGLLSPNVVKDFADYADFCFKT  193

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNG FAP RCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  194  FGDRVKNWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPYIVAHHLILS  251



>ref|XP_007152698.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
 gb|ESW24692.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
Length=540

 Score =   375 bits (964),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I  A    + + PET     FDTGGLSR  FPKGF+ GTATSAYQVEG A ++ GRGPSI
Sbjct  46   IRCAAAADATLHPETVR---FDTGGLSREVFPKGFIIGTATSAYQVEGMAHQD-GRGPSI  101

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FI+ PG   NN TGEVSVDQYHRYK+DIDL++ LNF+AYRFSISWSRIFPNGTG VN
Sbjct  102  WDVFIQKPGIVANNGTGEVSVDQYHRYKDDIDLMSKLNFDAYRFSISWSRIFPNGTGNVN  161

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L++GITPYANL HYDLP AL++RYNG L R+VV+DFADYAEFCFKT
Sbjct  162  WKGVAYYNRLIDYLLEKGITPYANLYHYDLPLALEERYNGLLGRQVVKDFADYAEFCFKT  221

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPY V HNL+LS
Sbjct  222  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYTVAHNLILS  279



>gb|EPS65829.1| beta-mannosidase, partial [Genlisea aurea]
Length=472

 Score =   373 bits (957),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSR SF  GFVFGTA SAYQVEGAA ++ GRGPSIWDTFIK PG E NNATGEVS DQYH
Sbjct  1    LSRQSFRNGFVFGTAASAYQVEGAAHED-GRGPSIWDTFIKTPGIEANNATGEVSADQYH  59

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            +YKEDIDL+A LNF+AYRFS+SW RIFPNGTG VNW+GV YYNRLINYML++GITPY NL
Sbjct  60   KYKEDIDLMAKLNFDAYRFSVSWPRIFPNGTGGVNWKGVDYYNRLINYMLRKGITPYLNL  119

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
            NHYDLPQALQ RY GWL R+VV+DFADYAEFCF+TFGDRVKNW +FNEPRVVAALGYDNG
Sbjct  120  NHYDLPQALQHRYQGWLSRQVVKDFADYAEFCFETFGDRVKNWQTFNEPRVVAALGYDNG  179

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             FAPGRCSKPFGNCT GNSATEPYIV HNL+LS
Sbjct  180  IFAPGRCSKPFGNCTSGNSATEPYIVAHNLILS  212



>gb|KCW83987.1| hypothetical protein EUGRSUZ_B00860 [Eucalyptus grandis]
Length=490

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 199/231 (86%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   QSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKF  276
            +  V PET     FDTG LSR++FPKGF++GTATSAYQVEG A KE GRGPSIWD F+K 
Sbjct  3    EETVIPETMR---FDTGRLSRSAFPKGFIWGTATSAYQVEGMADKE-GRGPSIWDVFVKI  58

Query  277  PGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYY  456
            PG   NNATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWSRIFP+GTGKVNW+GVAYY
Sbjct  59   PGTVANNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAYY  118

Query  457  NRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKN  636
            NRLINY+LK+GITPYANL HYDLP+AL+ +Y G L   VV+DFADYA+FCF+TFGDRVKN
Sbjct  119  NRLINYLLKKGITPYANLYHYDLPEALEKKYKGLLSPNVVKDFADYADFCFETFGDRVKN  178

Query  637  WFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            W +FNEPRVVAALGYDNG FAPGRCS  +GNCT GNS TEPYIV H+L+LS
Sbjct  179  WMTFNEPRVVAALGYDNGIFAPGRCSLAYGNCTAGNSGTEPYIVAHHLILS  229



>ref|XP_002281407.1| PREDICTED: beta-glucosidase 44 [Vitis vinifera]
 emb|CBI15543.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 193/218 (89%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            F+T GLSR SFPKGFVFGTATSAYQVEG A K+ GRGPSIWD FI+ PG   NN TGEV+
Sbjct  32   FNTHGLSRESFPKGFVFGTATSAYQVEGMADKD-GRGPSIWDVFIRKPGIVANNGTGEVA  90

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKEDIDL+ +LNFEAYRFSISWSRIFP GTGKVNW+GVAYYNRLINY+LK+GIT
Sbjct  91   VDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWKGVAYYNRLINYLLKKGIT  150

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +YNG L  RVV+DFADYA+FCFK FGDRVKNW +FNEPRVVAAL
Sbjct  151  PYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFGDRVKNWMTFNEPRVVAAL  210

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNGFFAPGRCSK +GNCT GNS TEPYIV H+L+LS
Sbjct  211  GYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHHLILS  248



>ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis]
Length=517

 Score =   372 bits (956),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR SFP+GF+FGTATSAYQVEG A K+ GRGPSIWD F+K PG   +N+TGEVS
Sbjct  40   FDTGGLSRDSFPEGFLFGTATSAYQVEGMADKD-GRGPSIWDVFVKVPGIIADNSTGEVS  98

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYK+D+D++  LNF+AYRFSISWSRIFP GTGKVNW+GVAYY+RLI+YMLKRGIT
Sbjct  99   VDQYHRYKQDVDIMQKLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYHRLIDYMLKRGIT  158

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +YNG L+R+VV+DFADYA+FCFKTFGDRVKNW +FNEPRV+AAL
Sbjct  159  PYANLYHYDLPLALEKKYNGLLNRQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVIAAL  218

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNGFFAP RCSK FGNCT G+SATEPYI  HNL+LS
Sbjct  219  GYDNGFFAPARCSKAFGNCTAGDSATEPYIAAHNLILS  256



>ref|XP_006406654.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 ref|XP_006406658.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
 gb|ESQ48107.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 gb|ESQ48111.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
Length=512

 Score =   372 bits (955),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 195/218 (89%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR SFPKGF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG   NNAT E++
Sbjct  34   FDTGGLSRQSFPKGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGTIANNATAEIT  92

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+ NLNF+AYRFSISWSRIFP G GK+NW+GVAYYNRLI+Y+++RGIT
Sbjct  93   VDQYHRYKEDVDLMKNLNFDAYRFSISWSRIFPEGAGKINWKGVAYYNRLIDYLIQRGIT  152

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L R+VVEDFA+YAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  153  PYANLYHYDLPLALEKKYKGLLGRQVVEDFANYAEFCFKTFGDRVKNWMTFNEPRVVAAL  212

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNG FAPGRCSK +GNCT+GNSATEPYIV+H+L+L+
Sbjct  213  GYDNGIFAPGRCSKTYGNCTQGNSATEPYIVSHHLILA  250



>ref|NP_188436.1| beta-glucosidase 44 [Arabidopsis thaliana]
 sp|Q9LV33.1|BGL44_ARATH RecName: Full=Beta-glucosidase 44; Short=AtBGLU44; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02020.1| beta-glucosidase [Arabidopsis thaliana]
 gb|AAM61427.1| beta-glucosidase, putative [Arabidopsis thaliana]
 dbj|BAH19552.1| AT3G18080 [Arabidopsis thaliana]
 dbj|BAH19607.1| AT3G18080 [Arabidopsis thaliana]
 gb|AEE76044.1| beta-glucosidase 44 [Arabidopsis thaliana]
Length=512

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 200/234 (85%), Gaps = 4/234 (2%)
 Frame = +1

Query  88   TEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTF  267
            T  +S +S E        TGGLSR SFPKGFVFGTATSAYQVEG   ++ GRGPSIWD F
Sbjct  21   TSGESSLSAEKNK---LHTGGLSRQSFPKGFVFGTATSAYQVEGETHQD-GRGPSIWDAF  76

Query  268  IKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGV  447
            +K PG+   NAT E++VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP G+GKVNW+GV
Sbjct  77   VKIPGKIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGV  136

Query  448  AYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDR  627
            AYYNRLI+YM+++GITPYANL HYDLP AL+++Y G L R+VV+DFADYAEFC+KTFGDR
Sbjct  137  AYYNRLIDYMVQKGITPYANLYHYDLPLALENKYKGLLGRQVVKDFADYAEFCYKTFGDR  196

Query  628  VKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            VKNW +FNEPRVVAALGYDNG FAPGRCSK FGNCTEGNSATEPYIVTH+L+L+
Sbjct  197  VKNWMTFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILA  250



>gb|ABK95221.1| unknown [Populus trichocarpa]
Length=315

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 194/226 (86%), Gaps = 4/226 (2%)
 Frame = +1

Query  112  PETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREP  291
            PET +   F+T G  R SFPKGFVFGTATSAYQVEG A K+ GRGPSIWD F+K PG   
Sbjct  32   PETVS---FETAGGLRHSFPKGFVFGTATSAYQVEGMAEKD-GRGPSIWDEFVKIPGIVA  87

Query  292  NNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLIN  471
            NNATGEV+VDQYH YKED+D++  LNF+AYRFSISWSRIFP+GTGKVNW GVAYYNRLI+
Sbjct  88   NNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGTGKVNWLGVAYYNRLID  147

Query  472  YMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFN  651
            YM+++GITPYANL HYDLP AL+ +Y G L  +VV+DFADYA+FCFKTFGDRVKNW +FN
Sbjct  148  YMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADFCFKTFGDRVKNWMTFN  207

Query  652  EPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            EPRVVAALGYDNG FAPGRCSK FGNCT G+SATEPYIV H+L+LS
Sbjct  208  EPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLILS  253



>ref|XP_010506331.1| PREDICTED: beta-glucosidase 43-like isoform X2 [Camelina sativa]
Length=300

 Score =   363 bits (932),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 195/227 (86%), Gaps = 5/227 (2%)
 Frame = +1

Query  121  TAPAG----FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
            ++P+G     DTG L+R SFP GF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG+ 
Sbjct  23   SSPSGDGVPMDTGDLNRESFPGGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGKI  81

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNAT E++VDQYHRYKED+DL+ NLNF+AYRFSISWSRIFP GTGK+NW GVAYYNRLI
Sbjct  82   ANNATAELTVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLI  141

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            +Y++ +GI PYANL HYDLP AL+ +Y G L ++VVEDFADYAEFCFKTFGDRVKNW +F
Sbjct  142  DYLILKGIKPYANLYHYDLPLALEQKYQGLLSKQVVEDFADYAEFCFKTFGDRVKNWMTF  201

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNG FAPGRCSK FGNCT+GNSATEPYIV H+L+L+
Sbjct  202  NEPRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILA  248



>ref|XP_004512738.1| PREDICTED: beta-glucosidase 44-like [Cicer arietinum]
Length=512

 Score =   370 bits (951),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 193/225 (86%), Gaps = 1/225 (0%)
 Frame = +1

Query  115  ETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPN  294
            E      FDTGGLSR  FPKGFVFG ATSAYQVEG A K+ GRGPSIWD FI+ PG   N
Sbjct  29   EVHETVRFDTGGLSREVFPKGFVFGVATSAYQVEGMAHKD-GRGPSIWDVFIQKPGIVAN  87

Query  295  NATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINY  474
            N TG+VSVDQYHRYKEDIDL+A LNF+AYRFSISWSRIFPNGTGK+NW+GVAYYNRLI+Y
Sbjct  88   NGTGDVSVDQYHRYKEDIDLMAKLNFDAYRFSISWSRIFPNGTGKLNWKGVAYYNRLIDY  147

Query  475  MLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNE  654
            +L++GITPYANL HYDLP AL+ RY G L   VV+DFADYA+FCFKTFGDRVKNW +FNE
Sbjct  148  LLEKGITPYANLYHYDLPLALELRYKGLLSYDVVKDFADYADFCFKTFGDRVKNWMTFNE  207

Query  655  PRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            PRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV HNL+LS
Sbjct  208  PRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHNLILS  252



>emb|CAN74265.1| hypothetical protein VITISV_040977 [Vitis vinifera]
Length=506

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 192/218 (88%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            F+T GLSR SFPKG VFGTATSAYQVEG A K+ GRGPSIWD FI+ PG   NN TGEV+
Sbjct  31   FNTHGLSRESFPKGLVFGTATSAYQVEGMADKD-GRGPSIWDVFIRKPGIVANNGTGEVA  89

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKEDIDL+ +LNFEAYRFSISWSRIFP GTGKVNW+GVAYYNRLINY+LK+GIT
Sbjct  90   VDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWKGVAYYNRLINYLLKKGIT  149

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +YNG L  RVV+DFADYA+FCFK FGDRVKNW +FNEPRVVAAL
Sbjct  150  PYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFGDRVKNWMTFNEPRVVAAL  209

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNGFFAPGRCS+ +GNCT GNS TEPYIV H+L+LS
Sbjct  210  GYDNGFFAPGRCSREYGNCTAGNSGTEPYIVAHHLILS  247



>ref|XP_011000474.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   370 bits (949),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 200/239 (84%), Gaps = 5/239 (2%)
 Frame = +1

Query  76   ISTATEIQS-EVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPS  252
            IS A E+      PET +   F+T G  R  FPKGFVFGTATSAYQVEG A K+ GRGPS
Sbjct  19   ISHAAELNGPSKQPETIS---FETAGGLRQGFPKGFVFGTATSAYQVEGMADKD-GRGPS  74

Query  253  IWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKV  432
            IWD F+K PG   NNATGEVSVDQYHRYKED+D++  LNF+AYRFSISWSRIFP+G GKV
Sbjct  75   IWDAFVKIPGIVANNATGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKV  134

Query  433  NWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFK  612
            NW GVAYYNRLI+Y+++RGITPYANL HYDLP AL+ +YNG L ++VV+DFADYA+FCFK
Sbjct  135  NWNGVAYYNRLIDYLIERGITPYANLYHYDLPLALEKKYNGLLSKQVVKDFADYADFCFK  194

Query  613  TFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            TFGDRVKNW +FNEPRVVAALGYD GFFAPGRCSK FGNCT GNSATEPYIV H+L+LS
Sbjct  195  TFGDRVKNWMTFNEPRVVAALGYDTGFFAPGRCSKAFGNCTAGNSATEPYIVAHHLILS  253



>ref|XP_010506324.1| PREDICTED: beta-glucosidase 43-like isoform X1 [Camelina sativa]
Length=316

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 195/227 (86%), Gaps = 5/227 (2%)
 Frame = +1

Query  121  TAPAG----FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
            ++P+G     DTG L+R SFP GF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG+ 
Sbjct  23   SSPSGDGVPMDTGDLNRESFPGGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGKI  81

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNAT E++VDQYHRYKED+DL+ NLNF+AYRFSISWSRIFP GTGK+NW GVAYYNRLI
Sbjct  82   ANNATAELTVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLI  141

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            +Y++ +GI PYANL HYDLP AL+ +Y G L ++VVEDFADYAEFCFKTFGDRVKNW +F
Sbjct  142  DYLILKGIKPYANLYHYDLPLALEQKYQGLLSKQVVEDFADYAEFCFKTFGDRVKNWMTF  201

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNG FAPGRCSK FGNCT+GNSATEPYIV H+L+L+
Sbjct  202  NEPRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILA  248



>ref|XP_009347765.1| PREDICTED: beta-glucosidase 44-like [Pyrus x bretschneideri]
Length=513

 Score =   369 bits (948),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 197/230 (86%), Gaps = 4/230 (2%)
 Frame = +1

Query  100  SEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFP  279
            S + PE+      DTGGLSRASF KGFVFGTATSAYQVEG A K+ GRGPSIWD F+K P
Sbjct  27   SVLEPESVK---LDTGGLSRASFRKGFVFGTATSAYQVEGMANKD-GRGPSIWDAFVKIP  82

Query  280  GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYN  459
            G   NN T +V+VDQYHRYK+DIDL+A+LNF+AYRFSISWSRIFPNGTG VNW+GVAYYN
Sbjct  83   GIIANNGTADVAVDQYHRYKDDIDLMASLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYN  142

Query  460  RLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNW  639
            RLINY+LKRGITPYANL HYDLP AL+ +Y G L  +VV+DFADYA+FCFKTFGDRVKNW
Sbjct  143  RLINYLLKRGITPYANLYHYDLPLALEKKYLGLLSDKVVKDFADYADFCFKTFGDRVKNW  202

Query  640  FSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             +FNEPRV+AALGYDNGF APGRCSK FGNCT GNSATEPYI  H+L+LS
Sbjct  203  MTFNEPRVIAALGYDNGFHAPGRCSKAFGNCTAGNSATEPYIAAHHLILS  252



>ref|XP_010487722.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   369 bits (947),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 193/218 (89%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR SFPKGF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG    NAT E++
Sbjct  35   LDTGGLSRQSFPKGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGTIAKNATAEIT  93

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP+G+GKVNW+GVAYYNRLI+Y++++GIT
Sbjct  94   VDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPDGSGKVNWKGVAYYNRLIDYLVQKGIT  153

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L R+VV DFADYAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  154  PYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAAL  213

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNG FAPGRCSK FGNCTEGNSATEPYIVTH+L+L+
Sbjct  214  GYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILA  251



>ref|XP_010533966.1| PREDICTED: beta-glucosidase 44-like [Tarenaya hassleriana]
Length=514

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 195/224 (87%), Gaps = 1/224 (0%)
 Frame = +1

Query  118  TTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNN  297
            ++  A FDTGGLSR SFP GFVFGTATSAYQVEG   ++ GRGPSIWDTF+K PG   NN
Sbjct  30   SSGDAIFDTGGLSRRSFPSGFVFGTATSAYQVEGETYQD-GRGPSIWDTFVKIPGIVANN  88

Query  298  ATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYM  477
            AT  V+VDQYHRYKED+DL+A LNF+AYRFSISWSRIFP GTGKVNW+GVAYYN LI+Y+
Sbjct  89   ATANVTVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNSLIDYL  148

Query  478  LKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEP  657
            LK+GITPYANL HYDLP+AL+ RY G L ++VV DFADYAEFCFKTFGDRVKNW +FNEP
Sbjct  149  LKKGITPYANLYHYDLPEALEKRYKGLLGKQVVRDFADYAEFCFKTFGDRVKNWMTFNEP  208

Query  658  RVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            RVVAALGYDNGFFAPGRCSK FGNCT G+SATEPY V H+L+L+
Sbjct  209  RVVAALGYDNGFFAPGRCSKAFGNCTAGDSATEPYTVAHHLILA  252



>ref|XP_008374823.1| PREDICTED: beta-glucosidase 44-like [Malus domestica]
Length=513

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 196/230 (85%), Gaps = 4/230 (2%)
 Frame = +1

Query  100  SEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFP  279
            S + PE+      DTGGLSRASF K FVFGTATSAYQVEG A KE GRGPSIWD F+K P
Sbjct  27   SVLEPESVK---LDTGGLSRASFRKDFVFGTATSAYQVEGMANKE-GRGPSIWDAFVKIP  82

Query  280  GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYN  459
            G   NN T +V+VDQYHRYK+DIDL+A+LNF+AYRFSISWSRIFPNGTG VNW+GVAYYN
Sbjct  83   GIIANNGTADVAVDQYHRYKDDIDLMASLNFDAYRFSISWSRIFPNGTGNVNWKGVAYYN  142

Query  460  RLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNW  639
            RLINY+LKRGITPYANL HYDLP AL+ +Y G L  +VV+DFADYA+FCFKTFGDRVKNW
Sbjct  143  RLINYLLKRGITPYANLYHYDLPLALEKKYLGLLSDKVVKDFADYADFCFKTFGDRVKNW  202

Query  640  FSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             +FNEPRV+AALGYDNGF APGRCSK FGNCT GNSATEPYI  H+L+LS
Sbjct  203  MTFNEPRVIAALGYDNGFHAPGRCSKAFGNCTAGNSATEPYIAAHHLILS  252



>ref|XP_002883107.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59366.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 197/229 (86%), Gaps = 2/229 (1%)
 Frame = +1

Query  103  EVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPG  282
            E SP +     FDTGGLSR SFPKGF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG
Sbjct  25   ESSP-SVEKIKFDTGGLSRQSFPKGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPG  82

Query  283  REPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNR  462
                NAT E++VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP G+GKVNW+GVAYYNR
Sbjct  83   TIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNR  142

Query  463  LINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWF  642
            LI+Y++++GI+PYANL HYDLP AL+ +Y G L R+VV DFADYAEFCFKTFGDRVKNW 
Sbjct  143  LIDYLVQKGISPYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWM  202

Query  643  SFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            +FNEPRVVAALGYDNG FAPGRCSK FGNCTEGNSATEPYIV+H+L+L+
Sbjct  203  TFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILA  251



>ref|XP_010097587.1| Beta-glucosidase 44 [Morus notabilis]
 gb|EXB69119.1| Beta-glucosidase 44 [Morus notabilis]
Length=512

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 197/233 (85%), Gaps = 4/233 (2%)
 Frame = +1

Query  91   EIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFI  270
            E  S +SPE       DTGGLSRASFPKGFVFGTATSAYQVEG   ++ GRGPSIWD F+
Sbjct  24   EASSSLSPERL---DLDTGGLSRASFPKGFVFGTATSAYQVEGMTHQD-GRGPSIWDVFV  79

Query  271  KFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVA  450
            K PG   +N T EV+VDQYHRY+ED+D++  LNF+AYRFSISWSRIFP G GKVNW+GVA
Sbjct  80   KTPGIIADNGTAEVTVDQYHRYREDVDIMKKLNFDAYRFSISWSRIFPEGAGKVNWKGVA  139

Query  451  YYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRV  630
            YYNRLINYM+KRGITPYANL HYDLP+AL+++Y G L+ +VV+DFADYA+FCFKTFGDRV
Sbjct  140  YYNRLINYMIKRGITPYANLYHYDLPEALEEKYLGLLNDQVVKDFADYADFCFKTFGDRV  199

Query  631  KNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            KNW +FNEPRVVAALGYDNG  APGRCSK FGNCT GNSATEPYI  H+L+LS
Sbjct  200  KNWMTFNEPRVVAALGYDNGLHAPGRCSKEFGNCTAGNSATEPYIAAHHLILS  252



>ref|XP_004299545.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 180/240 (75%), Positives = 200/240 (83%), Gaps = 4/240 (2%)
 Frame = +1

Query  76   ISTATEIQ--SEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGP  249
            +S    IQ  +  +    AP     GGL RASFPKGFVFGTATSAYQVEG A KE GRGP
Sbjct  12   VSLVVVIQYVAGAAKHNGAPFPEAEGGL-RASFPKGFVFGTATSAYQVEGMANKE-GRGP  69

Query  250  SIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGK  429
            SIWDTF+K PG   NNATG+V+VDQYHRYKEDIDLLANLNF+AYRFSISWSRIFP GTGK
Sbjct  70   SIWDTFVKIPGIVANNATGDVTVDQYHRYKEDIDLLANLNFDAYRFSISWSRIFPEGTGK  129

Query  430  VNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCF  609
            VNW+GVAYYNRLI+Y+LKRGITPYANL HYDLP AL+ +Y G L  RVV+DFAD+A+FCF
Sbjct  130  VNWKGVAYYNRLIDYLLKRGITPYANLYHYDLPLALEKKYLGLLSDRVVKDFADFADFCF  189

Query  610  KTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            KT+GDRVKNW +FNEPRVVAALGYD GFFAPGRCSK +GNCT GNS TEPYI  H+L+LS
Sbjct  190  KTYGDRVKNWMTFNEPRVVAALGYDTGFFAPGRCSKAYGNCTAGNSGTEPYIAAHHLILS  249



>ref|XP_002322085.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEF06212.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=514

 Score =   367 bits (942),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 196/238 (82%), Gaps = 3/238 (1%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            IS A E+        T    F T G  R  FP+GFVFGTATSAYQVEG A K+ GRGPSI
Sbjct  19   ISHAAELNGPSKQSETI--SFGTAGGLRQGFPEGFVFGTATSAYQVEGMADKD-GRGPSI  75

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG   NNATGEVSVDQYHRYKED+D++  LNF+AYRFSISWSRIFP+G GKVN
Sbjct  76   WDAFVKIPGIVANNATGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKVN  135

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W GVAYYNRLI+YM++RGITPYANL HYDLP AL+ +YNG L  +VV+DFADYA+FCFKT
Sbjct  136  WNGVAYYNRLIDYMIERGITPYANLYHYDLPLALEKKYNGLLSNQVVKDFADYADFCFKT  195

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV H+L+LS
Sbjct  196  FGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHHLILS  253



>ref|XP_010506359.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   367 bits (942),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 192/218 (88%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR SFPKGF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG    NAT E++
Sbjct  35   LDTGGLSRQSFPKGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGTIAKNATAEIT  93

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP G+GKVNW+GVAYYNRLI+Y++++GIT
Sbjct  94   VDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDYLVQKGIT  153

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L R+VV DFADYAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  154  PYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAAL  213

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNG FAPGRCSK FGNCTEGNSATEPYIV+H+L+L+
Sbjct  214  GYDNGIFAPGRCSKAFGNCTEGNSATEPYIVSHHLILA  251



>ref|XP_010465882.1| PREDICTED: beta-glucosidase 44 [Camelina sativa]
Length=513

 Score =   367 bits (941),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 192/218 (88%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR SFPKGF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG    NAT E++
Sbjct  35   LDTGGLSRKSFPKGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGTIAKNATAEIT  93

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP G+GKVNW+GVAYYNRLI+Y++++GIT
Sbjct  94   VDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDYLVQKGIT  153

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L R+V+ DFADYAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  154  PYANLYHYDLPLALEKKYKGLLGRQVLNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAAL  213

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNG FAPGRCSK FGNCTEGNSATEPYIVTH+L+L+
Sbjct  214  GYDNGIFAPGRCSKAFGNCTEGNSATEPYIVTHHLILA  251



>gb|KFK39134.1| beta-glucosidase 44 [Arabis alpina]
Length=514

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/233 (74%), Positives = 198/233 (85%), Gaps = 8/233 (3%)
 Frame = +1

Query  103  EVSPETTAPAG----FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFI  270
            E SP   +PAG     DTGGLSR SFPKGF+FGTATSAYQVEG   ++ GRGPSIWD F+
Sbjct  24   ESSP---SPAGEKIKLDTGGLSRQSFPKGFLFGTATSAYQVEGETHQD-GRGPSIWDAFV  79

Query  271  KFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVA  450
            K PG    NAT E++VDQYHRYKED+DL+ NLNF+AYRFSISWSRIFP GTGK+NW+GVA
Sbjct  80   KIPGTIAKNATAELTVDQYHRYKEDVDLMKNLNFDAYRFSISWSRIFPEGTGKINWKGVA  139

Query  451  YYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRV  630
            YYNRLI+Y++++GITPYANL HYDLP AL+ +Y G L R VVEDFADYA+FCF  FGDRV
Sbjct  140  YYNRLIDYLIQKGITPYANLYHYDLPLALEKKYKGLLGREVVEDFADYAQFCFNLFGDRV  199

Query  631  KNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            KNW +FNEPRVV+ALGYDNG FAPGRCSK FGNCT+GNSATEPYIVTH+L+L+
Sbjct  200  KNWMTFNEPRVVSALGYDNGIFAPGRCSKAFGNCTQGNSATEPYIVTHHLILA  252



>gb|AGV54748.1| beta-glucosidase 44-like protein [Phaseolus vulgaris]
Length=518

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            I  A    + + PET     FDTGGLSR  FPKGF+ GTATSAYQVEG A ++ GRGPSI
Sbjct  24   IRCAAAADATLHPETVR---FDTGGLSREVFPKGFIIGTATSAYQVEGMAHQD-GRGPSI  79

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FI+ PG   NN TGEVSVDQYHRYK+DIDL++ LNF+AYRFSISWSRIFPNGTG VN
Sbjct  80   WDVFIQKPGIVANNGTGEVSVDQYHRYKDDIDLMSKLNFDAYRFSISWSRIFPNGTGNVN  139

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+Y+L++GITPYANL HYDLP AL++RYNG L R+VV+DFADYAEFCFKT
Sbjct  140  WKGVAYYNRLIDYLLEKGITPYANLYHYDLPLALEERYNGLLGRQVVKDFADYAEFCFKT  199

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FG+RVKNW +FNEPRVVAALGY  G FAPG+CSK +GNCT GNS TEPYIV HNL+LS
Sbjct  200  FGNRVKNWMTFNEPRVVAALGYKKGSFAPGKCSKEYGNCTTGNSGTEPYIVAHNLILS  257



>ref|XP_002883106.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59365.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 197/227 (87%), Gaps = 5/227 (2%)
 Frame = +1

Query  121  TAPAG----FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
            ++P+G     DTG L+R SFPKGF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG+ 
Sbjct  16   SSPSGDAVPLDTGDLNRQSFPKGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGKI  74

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNAT E++VDQYHRYKED+DL+ NLNF+AYRFSISWSRIFP G+GK+NW GVAYYNRLI
Sbjct  75   ANNATAEITVDQYHRYKEDVDLMENLNFDAYRFSISWSRIFPEGSGKINWNGVAYYNRLI  134

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            +Y++++GITPYANL HYDLP  L+ +Y G L ++VV+DFADYAEFCFKTFGDRVKNW +F
Sbjct  135  DYLIQKGITPYANLYHYDLPLVLERKYQGLLSKQVVDDFADYAEFCFKTFGDRVKNWMTF  194

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            NEPRVVAALGYDNG FAPGRCSK FGNCT+GNSATEPYIV H+L+L+
Sbjct  195  NEPRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILA  241



>ref|XP_006297463.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
 gb|EOA30361.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
Length=511

 Score =   364 bits (934),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = +1

Query  121  TAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNA  300
            ++P+  DTGGLSR SFP+GF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG    NA
Sbjct  28   SSPSRLDTGGLSRQSFPEGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGTIAKNA  86

Query  301  TGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYML  480
            T E++VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP GTGKVNW+GVAYYNRLI+Y++
Sbjct  87   TAEITVDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNRLIDYLV  146

Query  481  KRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPR  660
            ++GITPYANL HYDLP AL+ +Y G L R+VVEDFADYAEFCFKTFGDRVKNW +FNEPR
Sbjct  147  QKGITPYANLYHYDLPLALEKKYKGLLGRQVVEDFADYAEFCFKTFGDRVKNWMTFNEPR  206

Query  661  VVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVT  771
            VVAALGYDNG FAPGRCSK FGNCTEGNSATEPYIV+
Sbjct  207  VVAALGYDNGIFAPGRCSKAFGNCTEGNSATEPYIVS  243



>gb|KFK39133.1| beta-glucosidase 44 [Arabis alpina]
Length=497

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 195/230 (85%), Gaps = 3/230 (1%)
 Frame = +1

Query  100  SEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFP  279
            S   P  + P   DTGGLSR SFP+GF+FGTATSAYQVEG   ++ GRGPSIWD F+K P
Sbjct  9    SASPPRDSVP--LDTGGLSRKSFPEGFLFGTATSAYQVEGETYQD-GRGPSIWDAFVKIP  65

Query  280  GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYN  459
            G+  NNAT E++VDQYHRYKED+DL+ NLNF+AYRFSISWSRIFP GTGK+N +GVAYYN
Sbjct  66   GKIANNATAEITVDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINLKGVAYYN  125

Query  460  RLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNW  639
            RLI+Y++++GITPYANL HYDLP AL+ +Y G L ++VV DFADYAEFCFKTFGDRVKNW
Sbjct  126  RLIDYLIQKGITPYANLYHYDLPLALEQKYQGLLSKQVVVDFADYAEFCFKTFGDRVKNW  185

Query  640  FSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             +FNEPRVVAALGYDNG FAP RCSK FGNCTEGNSA EPYIV H+L+L+
Sbjct  186  MTFNEPRVVAALGYDNGIFAPARCSKAFGNCTEGNSAIEPYIVAHHLILA  235



>ref|XP_009113531.1| PREDICTED: beta-glucosidase 43 [Brassica rapa]
Length=498

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = +1

Query  124  APAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNAT  303
            +PAG  TG L+R SFP+GFVFGTATSAYQVEG   ++ GRGPSIWD F+K PG+  NNAT
Sbjct  17   SPAGDATGDLNRKSFPEGFVFGTATSAYQVEGETYQD-GRGPSIWDAFVKIPGKIANNAT  75

Query  304  GEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLK  483
             E++VDQYH YKED+DL+  LNF+AYRFSISWSRIFP+GTGK+NW GVAYYNRLI+Y+++
Sbjct  76   AELTVDQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQ  135

Query  484  RGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRV  663
            +GITPYANL HYDLP AL+ +Y G L R VVEDFADYAEFCFKTFGDRVKNW +FNEPRV
Sbjct  136  KGITPYANLYHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRV  195

Query  664  VAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            VAALGYDNG FAP RCSK FGNCTEGNSATEPYIV H+L+++
Sbjct  196  VAALGYDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLIVA  237



>emb|CDY18494.1| BnaA01g27010D [Brassica napus]
Length=524

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = +1

Query  124  APAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNAT  303
            +PAG  TG L+R SFP+GFVFGTATSAYQVEG   ++ GRGPSIWD F+K PG+  NNAT
Sbjct  43   SPAGDATGDLNRKSFPEGFVFGTATSAYQVEGETYQD-GRGPSIWDAFVKIPGKIANNAT  101

Query  304  GEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLK  483
             E++VDQYH YKED+DL+  LNF+AYRFSISWSRIFP+GTGK+NW GVAYYNRLI+Y+++
Sbjct  102  AELTVDQYHLYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQ  161

Query  484  RGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRV  663
            +GITPYANL HYDLP AL+ +Y G L R VVEDFADYAEFCFKTFGDRVKNW +FNEPRV
Sbjct  162  KGITPYANLYHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRV  221

Query  664  VAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            VAALGYDNG FAP RCSK FGNCTEGNSATEPYIV H+L+++
Sbjct  222  VAALGYDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLIVA  263



>ref|XP_006832849.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
 gb|ERM98127.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
Length=509

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 192/216 (89%), Gaps = 1/216 (0%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGLSR  FP GFVFGTATSAYQVEGAA K+ GRGPSIWD FI+ PG   +N+TGEVSVD
Sbjct  34   TGGLSREGFPPGFVFGTATSAYQVEGAADKD-GRGPSIWDVFIRKPGVVADNSTGEVSVD  92

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            +YHRYKED+D++A++N +AYRFSISWSRIFP G G+VN +GV YYNRLI+Y+L+RG+TPY
Sbjct  93   EYHRYKEDVDIMADMNMDAYRFSISWSRIFPEGVGRVNQKGVDYYNRLIDYLLERGVTPY  152

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP+AL++ YNG L+RRVV+DFADYAEFCFKTFGDRVKNW +FNEPRVVAALGY
Sbjct  153  ANLYHYDLPEALEESYNGLLNRRVVDDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGY  212

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            DNG FAPGRCS PFGNCT GNS TEPYIV HNL+LS
Sbjct  213  DNGIFAPGRCSAPFGNCTAGNSTTEPYIVAHNLILS  248



>ref|XP_002322086.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
 gb|EEF06213.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
Length=515

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 196/239 (82%), Gaps = 4/239 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            IS A E+        T    F T G  R  FP+GFVFGTATSAYQVEG A K+ GRGPSI
Sbjct  19   ISHAAELNGPSKQSETI--SFGTAGGLRQGFPEGFVFGTATSAYQVEGMADKD-GRGPSI  75

Query  256  WDTFIKFP-GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKV  432
            WD F+K P G   NNATGEVSVDQYHRYKED+D++  LNF+AYRFSISWSRIFP+G GKV
Sbjct  76   WDAFVKIPAGIVANNATGEVSVDQYHRYKEDVDIMKKLNFDAYRFSISWSRIFPDGAGKV  135

Query  433  NWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFK  612
            NW GVAYYNRLI+YM++RGITPYANL HYDLP AL+ +YNG L  +VV+DFADYA+FCFK
Sbjct  136  NWNGVAYYNRLIDYMIERGITPYANLYHYDLPLALEKKYNGLLSNQVVKDFADYADFCFK  195

Query  613  TFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            TFGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK FGNCT GNSATEPYIV H+L+LS
Sbjct  196  TFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAFGNCTVGNSATEPYIVAHHLILS  254



>ref|XP_006376723.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
 gb|ERP54520.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
Length=546

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 197/238 (83%), Gaps = 3/238 (1%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            IS A E  S  + E      F+T G  R SFPKGFVFGTATSAYQVEG A K+ GRGPSI
Sbjct  19   ISHAAE--SNGASEKPETVSFETAGGLRHSFPKGFVFGTATSAYQVEGMAEKD-GRGPSI  75

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG   NNATGEV+VDQYH YKED+D++  LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  76   WDEFVKIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGTGKVN  135

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W GVAYYNRLI+YM+++GITPYANL HYDLP AL+ +Y G L  +VV+DFADYA+FCFKT
Sbjct  136  WLGVAYYNRLIDYMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADFCFKT  195

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNG FAPGRCSK FGNCT G+SATEPYIV H+L+LS
Sbjct  196  FGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLILS  253



>gb|KHG12317.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=497

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 190/220 (86%), Gaps = 1/220 (0%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            A  DTGGLSR SFPKGFVFGTATSAYQVEG A K  GRGP IWD ++K PG   NN T +
Sbjct  20   AVMDTGGLSRDSFPKGFVFGTATSAYQVEGMANKG-GRGPCIWDVYVKQPGHIANNDTAD  78

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+VDQYH YKED+DLLAN NF+AYRFSISWSRIFP G G+VNW+GV YYNRLINY++K+G
Sbjct  79   VAVDQYHHYKEDVDLLANFNFDAYRFSISWSRIFPEGVGRVNWEGVDYYNRLINYLVKKG  138

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            ITPY NL HYDLPQALQ++YNG+L+R++VED+ADYAEFCFKTFGDRVKNWF+FNEPR+VA
Sbjct  139  ITPYGNLYHYDLPQALQEKYNGFLNRQIVEDYADYAEFCFKTFGDRVKNWFTFNEPRIVA  198

Query  670  ALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            ALG+DNG   P RCSK  GNCT+GNSA EPYIV HNL+LS
Sbjct  199  ALGFDNGINPPSRCSKEVGNCTDGNSAIEPYIVGHNLILS  238



>gb|KJB08522.1| hypothetical protein B456_001G086300 [Gossypium raimondii]
Length=497

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 190/220 (86%), Gaps = 1/220 (0%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            A  DTGGLSR SFPKGFVFGTATSAYQVEG A K  GRGP IWD ++K PG   NN T +
Sbjct  20   AVMDTGGLSRDSFPKGFVFGTATSAYQVEGMANKG-GRGPCIWDVYVKQPGHIANNDTAD  78

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+VDQYH YKED+DLLAN NF+AYRFSISWSRIFP G G+VNW+GV YYNRLINY++K+G
Sbjct  79   VAVDQYHHYKEDVDLLANFNFDAYRFSISWSRIFPEGVGRVNWEGVDYYNRLINYLVKKG  138

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            ITPY NL HYDLPQALQ++YNG+L+R++VED+ADYAEFCFKTFGDRVKNWF+FNEPR+VA
Sbjct  139  ITPYGNLYHYDLPQALQEKYNGFLNRQIVEDYADYAEFCFKTFGDRVKNWFTFNEPRIVA  198

Query  670  ALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            ALG+DNG   P RCSK  GNCT+GNSA EPYIV HNL+LS
Sbjct  199  ALGFDNGINPPSRCSKEVGNCTDGNSAIEPYIVGHNLILS  238



>ref|XP_011039106.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 196/238 (82%), Gaps = 3/238 (1%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            IS A E  S  + E     G +  G  R SFPKGFVFGTATSAYQVEG A K+ GRGPSI
Sbjct  19   ISHAAE--SNGASEKPETVGLEAAGGLRHSFPKGFVFGTATSAYQVEGMAEKD-GRGPSI  75

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F+K PG   NNATGEV+VDQYH YKED+D++  LNF+AYRFSISWSRIFP+GTGKVN
Sbjct  76   WDEFVKIPGIVANNATGEVAVDQYHHYKEDVDIMKMLNFDAYRFSISWSRIFPDGTGKVN  135

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W GVAYYNRLI+YM+++GITPYANL HYDLP AL+ +Y G L  +VV+DFADYA+FCFKT
Sbjct  136  WLGVAYYNRLIDYMIEKGITPYANLYHYDLPLALEKKYKGLLSYQVVKDFADYADFCFKT  195

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FGDRVKNW +FNEPRVVAALGYDNG FAPGRCSK FGNCT G+SATEPYIV H+L+LS
Sbjct  196  FGDRVKNWMTFNEPRVVAALGYDNGLFAPGRCSKAFGNCTAGDSATEPYIVAHHLILS  253



>ref|XP_010487721.1| PREDICTED: beta-glucosidase 43 [Camelina sativa]
Length=504

 Score =   359 bits (922),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DT  L+R SFP+GF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG+  NNAT E++
Sbjct  26   MDTSDLNRESFPEGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGKIANNATAELT  84

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+ NLNF+AYRFSISWSRIFP GTGK+NW GVAYYNRLI+Y++ +GI 
Sbjct  85   VDQYHRYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLIDYLILKGIK  144

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L ++VVEDF DYAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  145  PYANLYHYDLPLALEQKYQGLLSKQVVEDFVDYAEFCFKTFGDRVKNWMTFNEPRVVAAL  204

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNG FAPGRCSK FGNCT+GNSATEPYIV H+L+L+
Sbjct  205  GYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILA  242



>gb|KJB16858.1| hypothetical protein B456_002G251200 [Gossypium raimondii]
Length=504

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 191/218 (88%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR SFP+GF+FGTA SAYQVEG A ++ GRGPSIWD F+K PG   NN TGEVS
Sbjct  27   FDTGGLSRESFPEGFLFGTAASAYQVEGMASED-GRGPSIWDAFVKTPGHIANNETGEVS  85

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            +DQYHRYKED+DL+  LNF+AYRFSISWSRIFPNGTG+VNW+GV YYNRLI+Y+L++GIT
Sbjct  86   IDQYHRYKEDVDLMQMLNFDAYRFSISWSRIFPNGTGEVNWKGVDYYNRLIDYLLEKGIT  145

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            P+ANL HYDLP ALQ++Y G LDR+V++DFADYAEFCFKTFGDRVK W +FNEPRVVAAL
Sbjct  146  PHANLYHYDLPLALQEKYLGLLDRQVIQDFADYAEFCFKTFGDRVKTWMTFNEPRVVAAL  205

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+DNG   P RCSK FGNCT+GNSATEPYI  H+L+LS
Sbjct  206  GFDNGINPPNRCSKKFGNCTDGNSATEPYIAAHHLILS  243



>ref|XP_002990785.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
 gb|EFJ08058.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
Length=495

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 188/213 (88%), Gaps = 1/213 (0%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSRASFPKGF FGTATSAYQVEGAA K+YGRGPSIWD FI+ PGR   NATG+V+VD+YH
Sbjct  23   LSRASFPKGFTFGTATSAYQVEGAA-KKYGRGPSIWDVFIRTPGRVQENATGDVAVDEYH  81

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RYKEDIDL+A+LN +AYRFSISWSRIFP G G+VN  GVAYYNRLI+Y+L +GI PYANL
Sbjct  82   RYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYANL  141

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
            NHYDLP++L+  Y GWL R+VV+DF ++AEFCFKTFGDRVK W +FNEPRVVA LGYDNG
Sbjct  142  NHYDLPESLEKDYEGWLSRKVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDNG  201

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             FAPGRCS P+GNCTEGNSATEPYIV HNLLLS
Sbjct  202  QFAPGRCSAPYGNCTEGNSATEPYIVAHNLLLS  234



>ref|XP_010686092.1| PREDICTED: beta-glucosidase 44-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            F +GGLSR SFPKGFVFGTATSAYQVEG A K+ GRGPSIWD F+K PG   NNAT EVS
Sbjct  39   FHSGGLSRKSFPKGFVFGTATSAYQVEGMAHKD-GRGPSIWDEFVKKPGIIANNATAEVS  97

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+D++ANLN +AYRFSISWSRIFP G G+VNW+GVAYYNRLI+Y+++RGIT
Sbjct  98   VDQYHRYKEDVDIMANLNMDAYRFSISWSRIFPKGAGEVNWKGVAYYNRLIDYLIERGIT  157

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L  RVV+DF DYAEFCFKT+GDRVKNW +FNEPRV+AAL
Sbjct  158  PYANLYHYDLPLALERKYKGLLSPRVVKDFGDYAEFCFKTYGDRVKNWMTFNEPRVIAAL  217

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GY++GF APGRCSK +GNCTEGNS TEPYI  H+L+LS
Sbjct  218  GYNDGFHAPGRCSKEYGNCTEGNSGTEPYIAAHHLILS  255



>ref|XP_002974513.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
 gb|EFJ24735.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
Length=494

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 187/213 (88%), Gaps = 1/213 (0%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSRASFPKGF FGTATSAYQVEGAA K+YGRGPSIWD FI+ PGR   NATG+V+VD+YH
Sbjct  22   LSRASFPKGFTFGTATSAYQVEGAA-KKYGRGPSIWDVFIRTPGRVQENATGDVAVDEYH  80

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RYKEDIDL+A+LN +AYRFSISWSRIFP G G+VN  GVAYYNRLI+Y+L +GI PYANL
Sbjct  81   RYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYANL  140

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
            NHYDLP++L+  Y GWL R VV+DF ++AEFCFKTFGDRVK W +FNEPRVVA LGYDNG
Sbjct  141  NHYDLPESLEKDYEGWLSREVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDNG  200

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
             FAPGRCS P+GNCTEGNSATEPYIV HNLLLS
Sbjct  201  QFAPGRCSTPYGNCTEGNSATEPYIVAHNLLLS  233



>gb|KJB16855.1| hypothetical protein B456_002G250900 [Gossypium raimondii]
Length=504

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR SFP+GF+FGTA SAYQVEG A ++ GRGPSIWD F+K PG   NN TGEVS
Sbjct  27   FDTGGLSRESFPEGFLFGTAASAYQVEGMASED-GRGPSIWDAFVKTPGHIANNETGEVS  85

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            +DQYHRYKED+DL+  LNF+AYRFSISWSRIFPNGTG+VNW+GV YYNRLI+Y+L++GIT
Sbjct  86   IDQYHRYKEDVDLMQMLNFDAYRFSISWSRIFPNGTGEVNWKGVDYYNRLIDYLLEKGIT  145

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            P+ NL HYDLP ALQ++Y G LDR+V++DFADYAEFCFKTFGDRVK W +FNEPRVVAAL
Sbjct  146  PHVNLYHYDLPLALQEKYLGLLDRQVIQDFADYAEFCFKTFGDRVKTWMTFNEPRVVAAL  205

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+DNG   P RCSK FGNCT+GNSA EPYI  H+L+LS
Sbjct  206  GFDNGINPPNRCSKKFGNCTDGNSAIEPYIAAHHLILS  243



>ref|XP_008810053.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=509

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 194/228 (85%), Gaps = 6/228 (3%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
            + +T +   FDTGGLSR +FP GFVFGTA SAYQVEG A K+ GRGPSIWD F+K PG  
Sbjct  26   TTKTPSRVRFDTGGLSREAFPAGFVFGTAASAYQVEGMALKD-GRGPSIWDVFVKIPGEI  84

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNAT +VSVD+YHRYKED++++  +NF+AYRFSISWSRIFPNG GKVNW+GVAYYNRLI
Sbjct  85   ANNATADVSVDEYHRYKEDVEIMKKMNFDAYRFSISWSRIFPNGVGKVNWKGVAYYNRLI  144

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NYMLK+GITPYANL HYDLP+AL+ +YNGWL  ++VE +ADYA+FCFK FGDRVKNWF+F
Sbjct  145  NYMLKKGITPYANLYHYDLPEALEKQYNGWLSSKIVEAYADYADFCFKIFGDRVKNWFTF  204

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            NEPRVVAALGYD+G FAPGRC+    NC+  GNSATEPYIV HNL+LS
Sbjct  205  NEPRVVAALGYDDGKFAPGRCT----NCSAGGNSATEPYIVAHNLILS  248



>ref|XP_002272413.2| PREDICTED: beta-glucosidase 44-like [Vitis vinifera]
Length=552

 Score =   355 bits (911),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 191/231 (83%), Gaps = 2/231 (1%)
 Frame = +1

Query  100  SEVSPETTAPA-GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKF  276
            SE+ PE  A   G +TGGLSR SFPKGF+FGTA+SAYQVEG   K  GRGP IWD ++K 
Sbjct  60   SELGPEEWAEGLGLETGGLSRESFPKGFLFGTASSAYQVEGMTDKA-GRGPCIWDPYVKI  118

Query  277  PGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYY  456
            PG    N T +V+VDQYHRYKED+D++  LNF+AYRFSISWSRIFP GTGKVNW+GVAYY
Sbjct  119  PGNIAENGTADVAVDQYHRYKEDLDIMKILNFDAYRFSISWSRIFPEGTGKVNWEGVAYY  178

Query  457  NRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKN  636
            NRLINYMLK+GI PYANL HYDLP  LQ++YNG L RR+VEDFA+YAEFCFKTFGDRVK+
Sbjct  179  NRLINYMLKKGIIPYANLYHYDLPLVLQEKYNGLLSRRIVEDFANYAEFCFKTFGDRVKH  238

Query  637  WFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            W +FNEPRV+AALG+DNG   P RCSK FGNCT GNS+TEPYI  HN+LLS
Sbjct  239  WTTFNEPRVIAALGFDNGINPPSRCSKAFGNCTAGNSSTEPYIAAHNMLLS  289



>ref|XP_006845279.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
 gb|ERN06954.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
Length=482

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 190/220 (86%), Gaps = 5/220 (2%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGLSR  FP GFVFGTATSAYQVEGAA  E GRGPSIWD FI+ PG  PN ATGEVS D
Sbjct  3    TGGLSRERFPPGFVFGTATSAYQVEGAA-HEDGRGPSIWDVFIQQPGIIPNGATGEVSAD  61

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            +YHRYKED+D++A++N +AYRFSISWSRIFP G G+VN +GV YYNRLI+Y+L++GITPY
Sbjct  62   EYHRYKEDVDIMADMNMDAYRFSISWSRIFPEGAGRVNQKGVDYYNRLIDYLLEKGITPY  121

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLPQAL+D YNG L+RRVV+DFA YA+FCFKTFGDRVKNW +FNEPRV+AALGY
Sbjct  122  ANLYHYDLPQALEDSYNGLLNRRVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGY  181

Query  682  DNGFFAPGRCSKPFG----NCTEGNSATEPYIVTHNLLLS  789
            DNGF APGRCS PFG    NCT G+S+TEPYIV HNL+LS
Sbjct  182  DNGFHAPGRCSNPFGNDGMNCTAGDSSTEPYIVAHNLILS  221



>gb|ABR17739.1| unknown [Picea sitchensis]
Length=505

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/218 (77%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSRASFPKGFVFGTATSAYQVEGAA K  GRGPSIWDTFI  PG   NNAT +VS
Sbjct  30   IDTGGLSRASFPKGFVFGTATSAYQVEGAA-KTDGRGPSIWDTFILQPGIIANNATADVS  88

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VD+YHRYK D++L+  +N +AYRFSISWSRIFP G G++N++GV YYN LINY+LKRGIT
Sbjct  89   VDEYHRYKTDVELMVKMNMDAYRFSISWSRIFPKGAGQINYKGVQYYNNLINYLLKRGIT  148

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLPQ L+  Y G L+ +VV+D+A +AEFCFKTFGDRVK W +FNEPRVVAAL
Sbjct  149  PYANLYHYDLPQGLETAYGGLLNSKVVDDYAKFAEFCFKTFGDRVKYWMTFNEPRVVAAL  208

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYDNG FAPGRCS PFGNCT GNSATEPYIV HNLLLS
Sbjct  209  GYDNGIFAPGRCSAPFGNCTAGNSATEPYIVAHNLLLS  246



>ref|XP_010922562.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=509

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 194/228 (85%), Gaps = 6/228 (3%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
            + +T +   FDTGGLSR +FP GFVFGTA SAYQVEG A K+ GRGPSIWD F+K PG  
Sbjct  26   TAKTASRVRFDTGGLSREAFPAGFVFGTAASAYQVEGMALKD-GRGPSIWDVFVKIPGEI  84

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
             NNAT +VSVD+YHRYKED+D++  +NF+AYRFSISWSRIFPNG GKVNW+GV+YYNRLI
Sbjct  85   ANNATADVSVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPNGAGKVNWEGVSYYNRLI  144

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NYMLK+G+TPYANL HYDLP+AL+ +YNG L  +VVE +ADYA+FCFKTFGDRVKNWF+F
Sbjct  145  NYMLKKGVTPYANLYHYDLPEALEKQYNGLLSPKVVEAYADYADFCFKTFGDRVKNWFTF  204

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            NEPRVVAALGYD+G FAPGRC+    NC+  GNSATEPYIV HNL+LS
Sbjct  205  NEPRVVAALGYDDGTFAPGRCT----NCSAGGNSATEPYIVAHNLILS  248



>emb|CDO98378.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = +1

Query  238  GRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPN  417
            GRGPSIWDTFIK PGREPNNATGEV+VD+YHRYK+D+DL+  LNF+AYRFSISWSRIFPN
Sbjct  6    GRGPSIWDTFIKAPGREPNNATGEVTVDEYHRYKKDVDLMKRLNFDAYRFSISWSRIFPN  65

Query  418  GTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYA  597
            GTGKVNW+GVAYYNRLI+YM+K+GITPYANLNHYDLPQ LQDRYNGWL R V +DFADYA
Sbjct  66   GTGKVNWKGVAYYNRLIDYMIKQGITPYANLNHYDLPQELQDRYNGWLGREVAKDFADYA  125

Query  598  EFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHN  777
            EFCFKTFGDRVKNWF+FNEPRV+AALGYDNG+FAPGRCSK FGNCT GNSATEPYI  HN
Sbjct  126  EFCFKTFGDRVKNWFTFNEPRVIAALGYDNGYFAPGRCSKAFGNCTAGNSATEPYIAAHN  185

Query  778  LLL  786
            L+L
Sbjct  186  LIL  188



>emb|CDX95557.1| BnaC01g34490D [Brassica napus]
Length=514

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR SFPK F+FGTATSAYQVEG   ++ GRGPSIWD F+K PG    NAT E++
Sbjct  36   LDTGGLSRQSFPKDFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGTIAKNATAELT  94

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP GTGK+NW+GV YYNRLINY++++GIT
Sbjct  95   VDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLINYLIQKGIT  154

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G LDR+VV DFADYAEFCF  FGDRVKNW +FNEPRVVAAL
Sbjct  155  PYANLYHYDLPLALEKKYKGLLDRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPRVVAAL  214

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVT  771
            GYDNG FAPGRCSK +GNCT+GNS TEPYIV+
Sbjct  215  GYDNGIFAPGRCSKSYGNCTQGNSGTEPYIVS  246



>emb|CDX95558.1| BnaC01g34500D [Brassica napus]
Length=493

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            +G  +R SFP+GFVFGTATSAYQVEG   ++ GRGPSIWD F+K PG+  NNAT E++VD
Sbjct  19   SGDANRKSFPEGFVFGTATSAYQVEGETYQD-GRGPSIWDAFVKIPGKIANNATAELTVD  77

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYH YKED+DL+  LNF+AYRFSISWSRIFP G GK+NW GVAYYNRLI+Y++++GITPY
Sbjct  78   QYHLYKEDVDLMQTLNFDAYRFSISWSRIFPEGAGKINWNGVAYYNRLIDYLVQKGITPY  137

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP AL+ +Y G L R+ VEDFADYAEFCFKTFGDRVKNW +FNEPRVVAALGY
Sbjct  138  ANLYHYDLPLALEKKYKGLLGRQ-VEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGY  196

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            DNG FAP RCSK FGNCTEGNSATEPYIV H+L+L+
Sbjct  197  DNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLILA  232



>ref|XP_010906974.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=510

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 192/230 (83%), Gaps = 9/230 (4%)
 Frame = +1

Query  112  PETTAP---AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPG  282
            P T  P   A FDTGGLSRA+FP GFVFGTA SAYQVEG A K+ GRGP IWD F+K PG
Sbjct  25   PATAHPPSRARFDTGGLSRAAFPAGFVFGTAASAYQVEGMALKD-GRGPCIWDVFVKIPG  83

Query  283  REPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNR  462
               NNAT +VSVD+YHRYKED+D++  +NF+ YRFSISWSRIFPNG GKVNW+GVAYYNR
Sbjct  84   NIANNATADVSVDEYHRYKEDVDIMKKMNFDGYRFSISWSRIFPNGVGKVNWKGVAYYNR  143

Query  463  LINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWF  642
            LI+YMLK+GITPYANL HYDLPQAL+ +Y G L  ++VE +ADYA+FCFKTFGDRVKNWF
Sbjct  144  LIDYMLKQGITPYANLYHYDLPQALEVQYKGLLSAKIVEAYADYADFCFKTFGDRVKNWF  203

Query  643  SFNEPRVVAALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            +FNEPRVVAALGYD+G FAPGRC+    NC+  GNSATEPYIV HNL+LS
Sbjct  204  TFNEPRVVAALGYDDGMFAPGRCT----NCSAGGNSATEPYIVAHNLILS  249



>gb|KJB34273.1| hypothetical protein B456_006G057000 [Gossypium raimondii]
 gb|KJB34274.1| hypothetical protein B456_006G057000 [Gossypium raimondii]
Length=506

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 187/232 (81%), Gaps = 1/232 (0%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            ++    I    + E      FDTGGLSR +FPKGF+FGTA SA+QVEG    + GRGPSI
Sbjct  9    VALIICIHGAAATEQPETVKFDTGGLSREAFPKGFLFGTAASAFQVEGMTHGD-GRGPSI  67

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD FIK PG   NN T +V+VDQYHRYKED+DL++ LNF+AYRFSISW+RIFP+GTGKVN
Sbjct  68   WDVFIKTPGIVANNGTADVTVDQYHRYKEDVDLMSKLNFDAYRFSISWTRIFPDGTGKVN  127

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GV YYN LINY+LKRGI PY NLNHYD P+AL+ +Y GWL  + V+DFAD+A+FCFKT
Sbjct  128  WKGVEYYNNLINYLLKRGIIPYVNLNHYDFPEALEKKYMGWLSYQSVKDFADFADFCFKT  187

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVT  771
            +GDRVK W +FNEPRVVAALGYDNGFFAPGRCSKP+G CT GNS TEPYIVT
Sbjct  188  YGDRVKQWTTFNEPRVVAALGYDNGFFAPGRCSKPYGYCTAGNSGTEPYIVT  239



>ref|XP_004163493.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=506

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSRA+FP+GFVFGTATSAYQVEG A K+ GRG SIWD F+K PG+  +NATG+V+
Sbjct  31   FDTGGLSRAAFPEGFVFGTATSAYQVEGMADKD-GRGQSIWDPFVKLPGKIVDNATGDVA  89

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKEDID +  LNF+AYRFSISW RIFPNGTG+VNW+GVAYYNRLI+YM+++GIT
Sbjct  90   VDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQGIT  149

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP ALQ+RY G LD+++V DF +YAEFCF+ FGDRVKNW +FNEPRV+A +
Sbjct  150  PYANLYHYDLPLALQERYRGLLDKQIVIDFTNYAEFCFEEFGDRVKNWMTFNEPRVIADV  209

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+++G   P RCSK +GNCT+GNS TEPYIV HN++LS
Sbjct  210  GFNSGIMPPSRCSKEYGNCTDGNSGTEPYIVAHNIILS  247



>ref|XP_004149144.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN53236.1| hypothetical protein Csa_4G031070 [Cucumis sativus]
Length=506

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSRA+FP+GFVFGTATSAYQVEG A K+ GRG SIWD F+K PG+  +NATG+V+
Sbjct  31   FDTGGLSRAAFPEGFVFGTATSAYQVEGMADKD-GRGQSIWDPFVKLPGKIVDNATGDVA  89

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKEDID +  LNF+AYRFSISW RIFPNGTG+VNW+GVAYYNRLI+YM+++GIT
Sbjct  90   VDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQGIT  149

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP ALQ+RY G LD+++V DF +YAEFCF+ FGDRVKNW +FNEPRV+A +
Sbjct  150  PYANLYHYDLPLALQERYRGLLDKQIVIDFTNYAEFCFEEFGDRVKNWMTFNEPRVIADV  209

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+++G   P RCSK +GNCT+GNS TEPYIV HN++LS
Sbjct  210  GFNSGIMPPSRCSKEYGNCTDGNSGTEPYIVAHNIILS  247



>ref|XP_007033088.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOY04014.1| Beta-glucosidase 44 [Theobroma cacao]
Length=511

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR  FP+GFVFGTATSAYQVEG A KE GRG SIWD F+  PG   +NATGEVS
Sbjct  34   LDTGGLSREIFPEGFVFGTATSAYQVEGMASKE-GRGRSIWDVFVNIPGNIVDNATGEVS  92

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYH YKED++L+  LNF+AYRFSISW RIFPNGTGKVNW+GVAYYNRLIN +L++GIT
Sbjct  93   VDQYHHYKEDVNLMHMLNFDAYRFSISWPRIFPNGTGKVNWKGVAYYNRLINALLEKGIT  152

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP ALQ++Y G L  +VV+DFADYA+FCFK FGDRVKNW +FNEPRV+AAL
Sbjct  153  PYANLYHYDLPLALQEKYGGLLGDQVVKDFADYADFCFKAFGDRVKNWMTFNEPRVIAAL  212

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+DNG   P RCSKPFGNCT G+SATEPYI  HNL+LS
Sbjct  213  GFDNGINPPCRCSKPFGNCTAGDSATEPYIAAHNLILS  250



>ref|XP_010257808.1| PREDICTED: beta-glucosidase 44-like isoform X5 [Nelumbo nucifera]
Length=469

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            + + +E   +  PET     FDTGGLSR SFPKGFVFG ATSAYQVEG A K+ GRGPSI
Sbjct  40   VVSVSETGLDARPETVR---FDTGGLSRESFPKGFVFGAATSAYQVEGMASKD-GRGPSI  95

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F++ PG   +NAT EV+ DQYHRYKED+D++ANLNF+AYRFSISWSRIFP+G GKVN
Sbjct  96   WDAFLRIPGIVASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVN  155

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YML +GITP+A + HYDLP AL+ +Y G L R+VV+D+ ++AEFCFKT
Sbjct  156  WKGVAYYNRLIDYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKT  215

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNW + NEP VV+  GY NG  APGRCSK +GNCT GNSATEPYI  HN++L
Sbjct  216  FGDRVKNWMTLNEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMIL  272



>ref|XP_010257753.1| PREDICTED: beta-glucosidase 44-like isoform X4 [Nelumbo nucifera]
Length=474

 Score =   345 bits (885),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            + + +E   +  PET     FDTGGLSR SFPKGFVFG ATSAYQVEG A K+ GRGPSI
Sbjct  40   VVSVSETGLDARPETVR---FDTGGLSRESFPKGFVFGAATSAYQVEGMASKD-GRGPSI  95

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F++ PG   +NAT EV+ DQYHRYKED+D++ANLNF+AYRFSISWSRIFP+G GKVN
Sbjct  96   WDAFLRIPGIVASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVN  155

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YML +GITP+A + HYDLP AL+ +Y G L R+VV+D+ ++AEFCFKT
Sbjct  156  WKGVAYYNRLIDYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKT  215

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNW + NEP VV+  GY NG  APGRCSK +GNCT GNSATEPYI  HN++L
Sbjct  216  FGDRVKNWMTLNEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMIL  272



>ref|XP_009113523.1| PREDICTED: beta-glucosidase 44 [Brassica rapa]
 emb|CDY18495.1| BnaA01g27000D [Brassica napus]
Length=514

 Score =   346 bits (888),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR SFPK F+FGTATSAYQVEG   ++ GRGPSIWD F+K PG    NAT E++
Sbjct  36   LDTGGLSRQSFPKDFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGTIAKNATAELT  94

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+DL+  LNF+AYRFSISWSRIFP GTGK+NW+GV YYNRLI+Y++++GIT
Sbjct  95   VDQYHRYKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLIDYLIQKGIT  154

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP AL+ +Y G L R+VV DFADYAEFCF  FGDRVKNW +FNEPRVVAAL
Sbjct  155  PYANLYHYDLPLALEKKYKGLLGRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPRVVAAL  214

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVT  771
            GYDNG FAPGRCSK +GNCT+GNS TEPYIV+
Sbjct  215  GYDNGIFAPGRCSKSYGNCTQGNSGTEPYIVS  246



>ref|XP_006644213.1| PREDICTED: beta-glucosidase 1-like [Oryza brachyantha]
Length=511

 Score =   346 bits (887),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 185/216 (86%), Gaps = 5/216 (2%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGLSR SFP GFVFGTA SAYQVEG A K+ GRGPSIWD F+K PG   NNAT +V+VD
Sbjct  41   TGGLSRRSFPAGFVFGTAASAYQVEGMALKD-GRGPSIWDAFVKIPGEIANNATADVTVD  99

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            +YHRYKED+D++  + F+AYRFSISWSRIFP GTGKVNW+GVAYYNRLINYMLK GITPY
Sbjct  100  EYHRYKEDVDIMKRMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPY  159

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP+AL+ +Y G L+R++VE FADYAEFCFKTFGDRVKNW +FNEPRVVAALGY
Sbjct  160  ANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGY  219

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            D+G FAPGRC+K    C  GNSATEPYIV H+L+LS
Sbjct  220  DDGAFAPGRCTK----CKAGNSATEPYIVAHHLILS  251



>ref|XP_009394432.1| PREDICTED: beta-glucosidase 1-like [Musa acuminata subsp. malaccensis]
Length=511

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 186/218 (85%), Gaps = 5/218 (2%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR +FP GF FGTA SAYQVEG A ++ GRGPSIWD F+K PG   NNAT +VS
Sbjct  36   LDTGGLSRGAFPAGFTFGTAASAYQVEGMALQD-GRGPSIWDAFVKIPGEIANNATADVS  94

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VD+YHRYKED+D++  +NF+AYRFSISWSRIFP G G+VNW+GVAYYNRLINYML RGIT
Sbjct  95   VDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPEGEGRVNWKGVAYYNRLINYMLLRGIT  154

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP+AL+ +YNG L RR+V+ +A+YAEFCFKTFGDRVKNW +FNEPRVVAAL
Sbjct  155  PYANLYHYDLPEALEKKYNGLLSRRIVDAYANYAEFCFKTFGDRVKNWMTFNEPRVVAAL  214

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            GYD+G FAPGRC+    NC+ GNSATEPYIV HN++LS
Sbjct  215  GYDDGKFAPGRCT----NCSAGNSATEPYIVAHNMILS  248



>gb|KJB16881.1| hypothetical protein B456_002G252700 [Gossypium raimondii]
Length=512

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 190/225 (84%), Gaps = 8/225 (4%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPG-------REPN  294
            FDTGGLSR SFP+GF+FGTA SAYQVEG A ++ GRGPSIWD ++K P           N
Sbjct  28   FDTGGLSRDSFPEGFLFGTAASAYQVEGMASED-GRGPSIWDAYVKIPDVIWLETRHIAN  86

Query  295  NATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINY  474
            N TGEVS+DQYHRYKED+D++  LNF+AYRFSISWSRIFPNGTG+VNW+GV YYNRLI+Y
Sbjct  87   NDTGEVSIDQYHRYKEDVDMMQTLNFDAYRFSISWSRIFPNGTGEVNWKGVDYYNRLIDY  146

Query  475  MLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNE  654
            +L++GITP+ANL HYDLP ALQ++Y G LDR+V++DFADYAEFCFKTFGDRVK W +FNE
Sbjct  147  LLEKGITPHANLYHYDLPLALQEKYLGLLDRQVIQDFADYAEFCFKTFGDRVKTWMTFNE  206

Query  655  PRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            PRVVAALG+DNG   P RCSK FGNCT+GNS+TEPYI  H+L+LS
Sbjct  207  PRVVAALGFDNGINPPNRCSKQFGNCTDGNSSTEPYIAAHHLILS  251



>gb|KJB08521.1| hypothetical protein B456_001G086200 [Gossypium raimondii]
Length=406

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            A  DTGGLSR SFP GFVFGT+TSAYQVEG A K  GRGPSIWD ++K PG   NN T +
Sbjct  20   AVMDTGGLSRESFPMGFVFGTSTSAYQVEGMANKG-GRGPSIWDVYVKQPGHIANNDTAD  78

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+ DQYH YKED+DLLA  NF+AYRFSISWSRIFP G GKVNW GVAYYNR+INY++K+G
Sbjct  79   VADDQYHHYKEDVDLLAKFNFDAYRFSISWSRIFPEGVGKVNWAGVAYYNRMINYLVKKG  138

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            ITPY NL H DLP ALQ++YNG+L+ + VED+ DYAEFCFKTFGDRVKNWF+FNEPR+VA
Sbjct  139  ITPYGNLYHSDLPLALQEKYNGFLNHQFVEDYVDYAEFCFKTFGDRVKNWFTFNEPRIVA  198

Query  670  ALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            ALG+DNG   P RCSK  GNC  GNSA EPYIV HNL+LS
Sbjct  199  ALGFDNGVIPPLRCSKEVGNCNTGNSAIEPYIVGHNLILS  238



>ref|XP_010257596.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
 ref|XP_010257682.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
Length=518

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            + + +E   +  PET     FDTGGLSR SFPKGFVFG ATSAYQVEG A K+ GRGPSI
Sbjct  19   VVSVSETGLDARPETVR---FDTGGLSRESFPKGFVFGAATSAYQVEGMASKD-GRGPSI  74

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F++ PG   +NAT EV+ DQYHRYKED+D++ANLNF+AYRFSISWSRIFP+G GKVN
Sbjct  75   WDAFLRIPGIVASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVN  134

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YML +GITP+A + HYDLP AL+ +Y G L R+VV+D+ ++AEFCFKT
Sbjct  135  WKGVAYYNRLIDYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKT  194

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNW + NEP VV+  GY NG  APGRCSK +GNCT GNSATEPYI  HN++L
Sbjct  195  FGDRVKNWMTLNEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMIL  251



>ref|XP_008453769.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=506

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSRA+FP+GFVFGTATSAYQVEG A K+ GRG SIWD F+K PG+   NATG+V+
Sbjct  31   FDTGGLSRAAFPEGFVFGTATSAYQVEGMADKD-GRGQSIWDPFVKLPGKIAGNATGDVA  89

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKEDID +  LNF+AYRFSISW RIFPNGTG+VNW+GVAYYNRLI+YM+++GIT
Sbjct  90   VDQYHRYKEDIDNMKKLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIQQGIT  149

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP ALQ+RY G LD+++V DF  YAEFCF+ FGDRVKNW +FNEPRV+A +
Sbjct  150  PYANLYHYDLPLALQERYGGLLDKQIVADFTSYAEFCFEEFGDRVKNWMTFNEPRVIADV  209

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+++G   P RCSK +GNCT GNS TEPYIV HN++LS
Sbjct  210  GFNSGIMPPSRCSKEYGNCTNGNSGTEPYIVAHNIILS  247



>ref|XP_010257433.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Nelumbo nucifera]
Length=539

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            + + +E   +  PET     FDTGGLSR SFPKGFVFG ATSAYQVEG A K+ GRGPSI
Sbjct  40   VVSVSETGLDARPETVR---FDTGGLSRESFPKGFVFGAATSAYQVEGMASKD-GRGPSI  95

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F++ PG   +NAT EV+ DQYHRYKED+D++ANLNF+AYRFSISWSRIFP+G GKVN
Sbjct  96   WDAFLRIPGIVASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVN  155

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YML +GITP+A + HYDLP AL+ +Y G L R+VV+D+ ++AEFCFKT
Sbjct  156  WKGVAYYNRLIDYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKT  215

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNW + NEP VV+  GY NG  APGRCSK +GNCT GNSATEPYI  HN++L
Sbjct  216  FGDRVKNWMTLNEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMIL  272



>ref|XP_010257514.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Nelumbo nucifera]
Length=534

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = +1

Query  76   ISTATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSI  255
            + + +E   +  PET     FDTGGLSR SFPKGFVFG ATSAYQVEG A K+ GRGPSI
Sbjct  40   VVSVSETGLDARPETVR---FDTGGLSRESFPKGFVFGAATSAYQVEGMASKD-GRGPSI  95

Query  256  WDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVN  435
            WD F++ PG   +NAT EV+ DQYHRYKED+D++ANLNF+AYRFSISWSRIFP+G GKVN
Sbjct  96   WDAFLRIPGIVASNATAEVAADQYHRYKEDVDIMANLNFDAYRFSISWSRIFPDGAGKVN  155

Query  436  WQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKT  615
            W+GVAYYNRLI+YML +GITP+A + HYDLP AL+ +Y G L R+VV+D+ ++AEFCFKT
Sbjct  156  WKGVAYYNRLIDYMLAKGITPFATIYHYDLPLALEQKYKGLLSRKVVKDYTNFAEFCFKT  215

Query  616  FGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLL  786
            FGDRVKNW + NEP VV+  GY NG  APGRCSK +GNCT GNSATEPYI  HN++L
Sbjct  216  FGDRVKNWMTLNEPAVVSTSGYGNGGSAPGRCSKAYGNCTAGNSATEPYIAAHNMIL  272



>ref|NP_001043156.1| Os01g0508000 [Oryza sativa Japonica Group]
 sp|Q5QMT0.1|BGL01_ORYSJ RecName: Full=Beta-glucosidase 1; Short=Os1bglu1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD73293.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF05070.1| Os01g0508000 [Oryza sativa Japonica Group]
Length=516

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 187/216 (87%), Gaps = 5/216 (2%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGLSR SFP GFVFGTA SAYQVEG A K+ GRGPSIWD F+K PG   NNAT +V+VD
Sbjct  46   TGGLSRRSFPAGFVFGTAASAYQVEGMALKD-GRGPSIWDAFVKTPGEIANNATADVTVD  104

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            +YHRYKED++++ ++ F+AYRFSISWSRIFP GTGKVNW+GVAYYNRLINYMLK GITPY
Sbjct  105  EYHRYKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPY  164

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP+AL+ +Y G L+R++VE FADYAEFCFKTFGDRVKNW +FNEPRVVAALGY
Sbjct  165  ANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGY  224

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            D+G FAPGRC+K    CT GNSATEPYIV H+L+LS
Sbjct  225  DDGNFAPGRCTK----CTAGNSATEPYIVAHHLILS  256



>gb|EAY74244.1| hypothetical protein OsI_02124 [Oryza sativa Indica Group]
Length=516

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 187/216 (87%), Gaps = 5/216 (2%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGLSR SFP GFVFGTA SAYQVEG A K+ GRGPSIWD F+K PG   NNAT +V+VD
Sbjct  46   TGGLSRRSFPAGFVFGTAASAYQVEGMALKD-GRGPSIWDAFVKTPGEIANNATADVTVD  104

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            +YHRYKED++++ ++ F+AYRFSISWSRIFP GTGKVNW+GVAYYNRLINYMLK GITPY
Sbjct  105  EYHRYKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPY  164

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP+AL+ +Y G L+R++VE FADYAEFCFKTFGDRVKNW +FNEPRVVAALGY
Sbjct  165  ANLYHYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGY  224

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            D+G FAPGRC+K    CT GNSATEPYIV H+L+LS
Sbjct  225  DDGNFAPGRCTK----CTAGNSATEPYIVAHHLILS  256



>ref|XP_006482391.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 184/219 (84%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDT GL+R SFP GFVFGTATSAYQVEG A K+ GRGP IWD ++  PG   NNAT +V
Sbjct  43   GFDTAGLTRKSFPDGFVFGTATSAYQVEGMANKD-GRGPCIWDVYVHTPGNIANNATADV  101

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+  LNF+AYRFSISWSRIFP G G+VNW+GVAYYNRLI+YML++GI
Sbjct  102  TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P AL +RY G L R+VV+D+AD+AEFCFKTFGDRVKNW++FNEPRV+AA
Sbjct  162  TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCTEG+S TEPY   HN++LS
Sbjct  222  LGFDSGINPPSRCSKEVNNCTEGDSGTEPYTAAHNMILS  260



>gb|KDO63131.1| hypothetical protein CISIN_1g036937mg, partial [Citrus sinensis]
Length=497

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDTGGLSR SFP+GFVFGTATSAYQVEG A K+ GRGP IWD +   PG   NNAT +V
Sbjct  20   GFDTGGLSRKSFPEGFVFGTATSAYQVEGMADKD-GRGPCIWDVYAHTPGHIANNATADV  78

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+ NLNF+AYRFSISWSRIFP GTG VN +GV YYNRLI+YML++GI
Sbjct  79   TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  138

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P ALQ++Y G LD +VV+D+ADYA+FCFKTFGDRVKNW++FNEPRV+AA
Sbjct  139  TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  198

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCT+GNS TEPYI  HN++LS
Sbjct  199  LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILS  237



>gb|KDO63132.1| hypothetical protein CISIN_1g046891mg [Citrus sinensis]
Length=520

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 184/219 (84%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDT GL+R SFP GFVFGTATSAYQVEG A K+ GRGP IWD ++  PG   NNAT +V
Sbjct  43   GFDTAGLTRKSFPDGFVFGTATSAYQVEGMANKD-GRGPCIWDVYVHTPGNIANNATADV  101

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+  LNF+AYRFSISWSRIFP G G+VNW+GVAYYNRLI+YML++GI
Sbjct  102  TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P AL +RY G L R+VV+D+AD+AEFCFKTFGDRVKNW++FNEPRV+AA
Sbjct  162  TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCTEG+S TEPY   HN++LS
Sbjct  222  LGFDSGINPPSRCSKEVNNCTEGDSGTEPYTAAHNMILS  260



>ref|XP_010314225.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Solanum lycopersicum]
Length=502

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 186/234 (79%), Gaps = 29/234 (12%)
 Frame = +1

Query  91   EIQSE-VSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTF  267
            +I+S+ V  ETT    FDTGGL+R SFPKGFVFGT+TSAYQVEGAA K+ GRGPS+WDTF
Sbjct  37   DIESDNVLAETTV---FDTGGLNRESFPKGFVFGTSTSAYQVEGAASKD-GRGPSVWDTF  92

Query  268  IKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGV  447
            IK PGREPNNA+GEVS DQYH YKEDIDL+  LNF+AYRFSISWSRIFP+          
Sbjct  93   IKQPGREPNNASGEVSADQYHHYKEDIDLMVKLNFDAYRFSISWSRIFPS----------  142

Query  448  AYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDR  627
                          ITPY NLNHYDLPQALQ+RY GWL R VV+DFADYAEFCFKT+GDR
Sbjct  143  --------------ITPYVNLNHYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDR  188

Query  628  VKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            VKNWFSFNEPRVVA LGYD GFFAPGRCSK FGNCT G+SATEPYIV HNL+LS
Sbjct  189  VKNWFSFNEPRVVADLGYDTGFFAPGRCSKAFGNCTAGDSATEPYIVAHNLILS  242



>ref|XP_006431835.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
 gb|ESR45075.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
Length=506

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P G DT G+SR SFP+GF+FGTATSAYQVEG   K+ GRGP IWD ++K  G   NNAT 
Sbjct  28   PDGLDTAGMSRKSFPEGFIFGTATSAYQVEGMTDKD-GRGPCIWDPYVK-AGNIANNATA  85

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +++VDQYH YKEDID++A LNF+AYRFSISWSRIFPNGTG+VN  GVAYYNRLI+YMLK+
Sbjct  86   DLTVDQYHHYKEDIDIMAKLNFDAYRFSISWSRIFPNGTGEVNPLGVAYYNRLIDYMLKK  145

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP ALQD+YNG L   +V+D+ADYA+FCFKTFGDRVKNWF+FNEPRV+
Sbjct  146  GITPYANLYHYDLPLALQDKYNGLLSCDIVKDYADYADFCFKTFGDRVKNWFTFNEPRVI  205

Query  667  AALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            AALG+DNG   P RCSK  GNCT GNSATEPYI  HN++LS
Sbjct  206  AALGFDNGINPPSRCSKGMGNCTAGNSATEPYIAAHNMILS  246



>gb|ABC55717.1| beta-mannosidase 2 [Oncidium hybrid cultivar]
Length=501

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 187/230 (81%), Gaps = 7/230 (3%)
 Frame = +1

Query  109  SPETTAPAG---FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFP  279
             P   AP      D GGL+R +FP GF FGTA SAYQVEG A K+ GRGPSIWD FIK P
Sbjct  16   QPVAAAPVAGSRTDAGGLNRDNFPVGFTFGTAASAYQVEGMALKD-GRGPSIWDEFIKIP  74

Query  280  GREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYN  459
            G   NNAT  V+VD+YHRYK DID++ N+NF+AYRFSISWSRIFPNG+GKVNW+GVAYYN
Sbjct  75   GEIKNNATAAVTVDEYHRYKVDIDIMKNMNFDAYRFSISWSRIFPNGSGKVNWKGVAYYN  134

Query  460  RLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNW  639
            RLI+YML++GITP+ANL HYDLP+AL+  YNG L R VV+D+ADYAEFCFKTFGDRVKNW
Sbjct  135  RLIDYMLQQGITPFANLYHYDLPEALEKSYNGLLSRNVVKDYADYAEFCFKTFGDRVKNW  194

Query  640  FSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            F+FNEPRVVAALGYDNG FAPGRC+   G    GNS TEPYIV HNL+LS
Sbjct  195  FTFNEPRVVAALGYDNGIFAPGRCT---GCTAGGNSTTEPYIVAHNLILS  241



>ref|XP_006430656.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
 gb|ESR43896.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
Length=520

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 184/219 (84%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDT GL+R SFP GFVFGTATSAYQVEG A K+ GRGP IWD ++  PG   NNAT +V
Sbjct  43   GFDTAGLTRKSFPDGFVFGTATSAYQVEGMANKD-GRGPCIWDVYVHTPGNIANNATADV  101

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+  LNF+AYRFSISWSRIFP G G+VNW+GVAYYNRLI+YML++GI
Sbjct  102  TVDQYHRYKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGI  161

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P AL +RY G L R+VV+D+AD+AEFCFKTFGDRVKNW++FNEPRV+AA
Sbjct  162  TPYANLYHYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCTEG+S TEPY   HN++LS
Sbjct  222  LGFDSGTNPPSRCSKEVNNCTEGDSGTEPYTAAHNMILS  260



>ref|XP_006430655.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
 gb|ESR43895.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
Length=520

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDTGGLSR SFP+GFVFGTATSAYQVEG A K+ GRGP IWD +   PG   NNAT +V
Sbjct  43   GFDTGGLSRKSFPEGFVFGTATSAYQVEGMADKD-GRGPCIWDVYAHTPGHIANNATADV  101

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+ NLNF+AYRFSISWSRIFP GTG VN +GV YYNRLI+YML++GI
Sbjct  102  TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P ALQ++Y G LD +VV+D+ADYA+FCFKTFGDRVKNW++FNEPRV+AA
Sbjct  162  TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCT+GNS TEPYI  HN++L+
Sbjct  222  LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILA  260



>ref|XP_006482389.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDTGGLSR SFP+GFVFGTATSAYQVEG A K+ GRGP IWD +   PG   NNAT +V
Sbjct  43   GFDTGGLSRKSFPEGFVFGTATSAYQVEGMADKD-GRGPCIWDVYAHTPGHIANNATADV  101

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+ NLNF+AYRFSISWSRIFP GTG VN +GV YYNRLI+YML++GI
Sbjct  102  TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P ALQ++Y G LD +VV+D+ADYA+FCFKTFGDRVKNW++FNEPRV+AA
Sbjct  162  TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  221

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCT+GNS TEPYI  HN++L+
Sbjct  222  LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILA  260



>ref|XP_006430653.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
 gb|ESR43893.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
Length=528

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDTGGLSR SFP+GFVFGTATSAYQVEG A K+ GRGP IWD +   PG   NNAT +V
Sbjct  51   GFDTGGLSRKSFPEGFVFGTATSAYQVEGMADKD-GRGPCIWDVYAHTPGHIANNATADV  109

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+ NLNF+AYRFSISWSRIFP GTG VN +GV YYNRLI+YML++GI
Sbjct  110  TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  169

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P ALQ++Y G LD +VV+D+ADYA+FCFKTFGDRVKNW++FNEPRV+AA
Sbjct  170  TPYANLYHYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAA  229

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCT+GNS TEPYI  HN++L+
Sbjct  230  LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILA  268



>ref|XP_008792825.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=512

 Score =   341 bits (875),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 188/221 (85%), Gaps = 6/221 (3%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            A  DTGGL RA+FP GFVFGTA SAYQVEG A K+ GRGPSIWD F+K PG   NNAT +
Sbjct  36   ARLDTGGLGRAAFPAGFVFGTAASAYQVEGMALKD-GRGPSIWDAFVKIPGEIANNATAD  94

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            +SVD+YHRYKED+D++  +NF+ YRFSISWSRIFPNG G+VNW+GVAYYNRLI+YMLK+G
Sbjct  95   ISVDEYHRYKEDVDIMKKMNFDGYRFSISWSRIFPNGVGRVNWKGVAYYNRLIDYMLKQG  154

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            +TPYANL HYDLP+AL+ +YNG L  ++VE +AD+A+FCFKTFGDRVKNWF+FNEPRVVA
Sbjct  155  VTPYANLYHYDLPEALEVQYNGLLSPKIVEAYADFADFCFKTFGDRVKNWFTFNEPRVVA  214

Query  670  ALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            ALGYD G FAPGRC+    NC+  GNSATEPYIV HNL+LS
Sbjct  215  ALGYDEGKFAPGRCT----NCSAGGNSATEPYIVAHNLILS  251



>ref|XP_010034459.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=507

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/235 (69%), Positives = 191/235 (81%), Gaps = 9/235 (4%)
 Frame = +1

Query  85   ATEIQSEVSPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDT  264
            +++++SEV         FD GGLSRASFPKGF+FGTATSAYQVEG A  + GRGPSIWD 
Sbjct  23   SSDVKSEVK--------FDMGGLSRASFPKGFLFGTATSAYQVEGMASGD-GRGPSIWDA  73

Query  265  FIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQG  444
            F++ PG      +GE++VDQYH+YKEDIDL+  LNF+AYRFSISWSRIFPNGTG VNW+G
Sbjct  74   FVQVPGNIKELDSGEMAVDQYHKYKEDIDLMHKLNFDAYRFSISWSRIFPNGTGYVNWRG  133

Query  445  VAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGD  624
            V YYNRLI+ ++ +GITPYANL HYD+P ALQ RY G L   VV+DFADYAEFCFKTFGD
Sbjct  134  VNYYNRLIDALIAKGITPYANLYHYDMPLALQLRYEGLLSINVVKDFADYAEFCFKTFGD  193

Query  625  RVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            RVKNW +FNEPRV+AALG+D+G   P RCSKP+GNCT GNSATEPYI  H+L+LS
Sbjct  194  RVKNWMTFNEPRVIAALGFDSGSNPPNRCSKPYGNCTAGNSATEPYIAAHHLILS  248



>gb|ABC55718.1| beta-mannosidase 1 [Oncidium hybrid cultivar]
Length=491

 Score =   338 bits (867),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            D GGL+R  FP GF FGTA SAYQVEG A K+ GRGPSIWD F+K PG   NNAT  V+V
Sbjct  19   DAGGLNRDKFPVGFTFGTAASAYQVEGMALKD-GRGPSIWDDFVKIPGEIKNNATAAVTV  77

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYK DI+++ N+NF+AYRFSISWSRIFPNG+GKVNW+GVAYYNRLI+YML++GITP
Sbjct  78   DEYHRYKVDINIMKNMNFDAYRFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQGITP  137

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            +ANL HYDLP AL+  YNG L R VV+D+ADYAEFCFKTFGDRVKNWF+FNEPRVVAALG
Sbjct  138  FANLYHYDLPDALEKSYNGLLSRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVAALG  197

Query  679  YDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            YDNG FAPGRC+   G    GNS TEPYIV HNL+LS
Sbjct  198  YDNGIFAPGRCT---GCTAGGNSTTEPYIVAHNLILS  231



>gb|ABC55716.1| beta-mannosidase 3 [Oncidium hybrid cultivar]
Length=491

 Score =   338 bits (867),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            D GGL+R  FP GF FGTA SAYQVEG A K+ GRGPSIWD F+K PG   NNAT  V+V
Sbjct  19   DAGGLNRDKFPVGFTFGTAASAYQVEGMALKD-GRGPSIWDDFVKIPGEIKNNATAAVTV  77

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYK DI+++ N+NF+AYRFSISWSRIFPNG+GKVNW+GVAYYNRLI+YML++GITP
Sbjct  78   DEYHRYKVDINIMKNMNFDAYRFSISWSRIFPNGSGKVNWKGVAYYNRLIDYMLQQGITP  137

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            +ANL HYDLP AL+  YNG L R VV+D+ADYAEFCFKTFGDRVKNWF+FNEPRVVAALG
Sbjct  138  FANLYHYDLPDALEKSYNGLLSRNVVKDYADYAEFCFKTFGDRVKNWFTFNEPRVVAALG  197

Query  679  YDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            YDNG FAPGRC+   G    GNS TEPYIV HNL+LS
Sbjct  198  YDNGIFAPGRCT---GCTAGGNSTTEPYIVAHNLILS  231



>ref|XP_007048474.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOX92631.1| Beta-glucosidase 44 [Theobroma cacao]
Length=562

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 189/262 (72%), Gaps = 45/262 (17%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTGGLSR SFP+GFVFGTA SAYQVEG A KE GRGPSIWD F+K PG   NNATGEVS
Sbjct  41   LDTGGLSRDSFPEGFVFGTAASAYQVEGMASKE-GRGPSIWDVFVKVPGNIVNNATGEVS  99

Query  316  VDQYHRYK--------------------------------------------EDIDLLAN  363
            VDQYHRYK                                            ED+DL+  
Sbjct  100  VDQYHRYKKSQAIRSSLVYGLSPCYVSLISASHESWDNSKDSKTICHSSCLQEDVDLMHK  159

Query  364  LNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQD  543
            LNF+AYRFSISWSRIFPNGTGKVN +GVAYYNRLI+ ML++GITPYANL HYDLP ALQ+
Sbjct  160  LNFDAYRFSISWSRIFPNGTGKVNRKGVAYYNRLIDSMLEKGITPYANLYHYDLPLALQE  219

Query  544  RYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPF  723
            +Y G L  +VV+DFADYA+FCFKTFGDRVKNW +FNEPRVVAALG+DNG   P RCSKPF
Sbjct  220  KYGGLLGDQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGFDNGINPPNRCSKPF  279

Query  724  GNCTEGNSATEPYIVTHNLLLS  789
            GNCT GNSATEPYI  HNL+LS
Sbjct  280  GNCTAGNSATEPYIAAHNLILS  301



>ref|XP_004140826.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN57432.1| hypothetical protein Csa_3G185120 [Cucumis sativus]
Length=515

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR +FPK F+FGTATSAYQVEG A K+ GRG SIWD +++ PG    NATGEV+
Sbjct  39   FDTGGLSRNAFPKEFIFGTATSAYQVEGMADKD-GRGQSIWDPYVQIPGNIAGNATGEVA  97

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYH+YKED+D++  LNF+AYRFSISWSRIFPNGTG+VNW+GVAYYNRLI+YM+ +GIT
Sbjct  98   VDQYHKYKEDVDIMKRLNFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLIDYMVDQGIT  157

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP  LQ+RY G L  ++V+DFA YAEFCF+ FGDRVKNW +FNEPRV+AAL
Sbjct  158  PYANLYHYDLPLTLQERYGGLLGMQIVKDFAKYAEFCFEHFGDRVKNWMTFNEPRVIAAL  217

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+DNG   P RCSK +GNCT GNS TEPYI  H+++LS
Sbjct  218  GFDNGINPPSRCSKEYGNCTNGNSGTEPYIAAHHIILS  255



>ref|XP_004157213.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=515

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            FDTGGLSR +FPK F+FGTATSAYQVEG A K+ GRG SIWD +++ PG    NATGEV+
Sbjct  39   FDTGGLSRNAFPKEFIFGTATSAYQVEGMADKD-GRGQSIWDPYVQIPGNIAGNATGEVA  97

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYH+YKED+D++  LNF+AYRFSISWSRIFPNGTG+VNW+GVAYYNRLI+YM+ +GIT
Sbjct  98   VDQYHKYKEDVDIMKRLNFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLIDYMVDQGIT  157

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP  LQ+RY G L  ++V+DFA YAEFCF+ FGDRVKNW +FNEPRV+AAL
Sbjct  158  PYANLYHYDLPLTLQERYGGLLGMQIVKDFAKYAEFCFEHFGDRVKNWMTFNEPRVIAAL  217

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+DNG   P RCSK +GNCT GNS TEPYI  H+++LS
Sbjct  218  GFDNGINPPSRCSKEYGNCTNGNSGTEPYIAAHHIILS  255



>ref|XP_006471035.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=507

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P G DT G+SR SFP+GF+FGTATSAYQVEG   K+ GRGP IWD ++K      +NAT 
Sbjct  28   PDGLDTAGMSRKSFPEGFIFGTATSAYQVEGMTDKD-GRGPCIWDPYVKAGRNIASNATA  86

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +++VDQYH YKEDID++A LNF+AYRFSISWSRIFPNGTG+VN  GVAYYNRLI+YML++
Sbjct  87   DLTVDQYHHYKEDIDIMAKLNFDAYRFSISWSRIFPNGTGEVNPLGVAYYNRLIDYMLEK  146

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP ALQD+YNG L   +V+D+ADYA+FCFKTFGDRVKNWF+FNEPRV+
Sbjct  147  GITPYANLYHYDLPLALQDKYNGLLSCDIVKDYADYADFCFKTFGDRVKNWFTFNEPRVI  206

Query  667  AALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            AALG+DNG   P RCSK  GNCT GNS+TEPYI  HN++LS
Sbjct  207  AALGFDNGINPPSRCSKGMGNCTAGNSSTEPYIAAHNMILS  247



>ref|XP_004299546.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=513

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 183/222 (82%), Gaps = 2/222 (1%)
 Frame = +1

Query  124  APAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNAT  303
            AP     GGL R  FPKGFVFGTATSAYQVEG A KE GRGPSIWD F+K PG   NN T
Sbjct  31   APFPEAEGGL-RTGFPKGFVFGTATSAYQVEGMANKE-GRGPSIWDAFVKIPGNIANNDT  88

Query  304  GEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLK  483
             +V+ D+YHRYKEDID++ +LNF+ YRFSISWSRIFP+GTGKVN +GVAYYNRLINY+L+
Sbjct  89   ADVTADEYHRYKEDIDIMQDLNFDVYRFSISWSRIFPDGTGKVNLKGVAYYNRLINYLLE  148

Query  484  RGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRV  663
            RGITPYANL+HYDLP AL+  Y G+L  RVV+DFADYAEFCFKT+GDRVK W +FNEPRV
Sbjct  149  RGITPYANLHHYDLPLALEQEYLGFLSDRVVKDFADYAEFCFKTYGDRVKYWTTFNEPRV  208

Query  664  VAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            VAALGYDN    P RCSK +GNCT GNS TEPYIV H+LLLS
Sbjct  209  VAALGYDNALNPPARCSKAYGNCTVGNSGTEPYIVAHHLLLS  250



>gb|KHN23728.1| Beta-glucosidase 44 [Glycine soja]
Length=450

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  238  GRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPN  417
            GRGPSIWD FIK PG   NN TGEVSVDQYHRYKEDIDL+A+LNF+AYRFSISWSRIFPN
Sbjct  6    GRGPSIWDVFIKKPGIVANNGTGEVSVDQYHRYKEDIDLMASLNFDAYRFSISWSRIFPN  65

Query  418  GTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYA  597
            GTG+VNW+GVAYYNRLINY+L++GITPYANL HYDLP AL++RYNG L R+VV+DFADYA
Sbjct  66   GTGQVNWKGVAYYNRLINYLLEKGITPYANLYHYDLPLALEERYNGLLSRQVVKDFADYA  125

Query  598  EFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHN  777
            EFCFKTFGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV HN
Sbjct  126  EFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKEYGNCTAGNSGTEPYIVAHN  185

Query  778  LLLS  789
            L+LS
Sbjct  186  LILS  189



>ref|XP_008457084.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=517

 Score =   336 bits (861),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
             DTG LSR +FPKGF+FGTATSAYQVEG A KE GRG SIWD +++ PG    NATGEV+
Sbjct  41   LDTGELSRNAFPKGFIFGTATSAYQVEGMA-KEDGRGQSIWDPYVQIPGNIAGNATGEVA  99

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYHRYKED+D++  LNF+AYRFSISW RIFPNGTG+VNW+GVAYYNRLI+YM+ +GIT
Sbjct  100  VDQYHRYKEDVDIMKRLNFDAYRFSISWPRIFPNGTGEVNWKGVAYYNRLIDYMIDQGIT  159

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PYANL HYDLP  LQ+RY G L +++V+DFA YA+FCF+ FGDRVKNW +FNEPRV+AAL
Sbjct  160  PYANLYHYDLPLTLQERYGGLLGKQIVKDFAKYAKFCFEHFGDRVKNWMTFNEPRVIAAL  219

Query  676  GYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            G+DNG   P RCSK +GNCT GNS TEPY+  H++LLS
Sbjct  220  GFDNGINPPSRCSKEYGNCTNGNSGTEPYLAAHHILLS  257



>ref|XP_006299658.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
 gb|EOA32556.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
Length=491

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 181/226 (80%), Gaps = 13/226 (6%)
 Frame = +1

Query  112  PETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREP  291
            P +      DTG L R SFP+GF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG+  
Sbjct  17   PSSGDGVSLDTGDLKRQSFPEGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGKIA  75

Query  292  NNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLIN  471
            NNAT E++VDQYHRYKEDIDL+ NLNF+AYRFSISWSRIFP GTGK+NW GVAYYN LI+
Sbjct  76   NNATAEITVDQYHRYKEDIDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNSLID  135

Query  472  YMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFN  651
            Y++++GI PYANL HYDLP AL+ +Y G L            +FCFKTFGDRVKNW +FN
Sbjct  136  YLIQKGIKPYANLYHYDLPLALEQKYQGLL------------KFCFKTFGDRVKNWMTFN  183

Query  652  EPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            EPRVVAALGYDNG FAPGRCSK FGNCT+GNSATEPYIV H+L+L+
Sbjct  184  EPRVVAALGYDNGIFAPGRCSKAFGNCTDGNSATEPYIVAHHLILA  229



>ref|XP_008811965.1| PREDICTED: beta-glucosidase 1-like isoform X1 [Phoenix dactylifera]
Length=505

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 185/222 (83%), Gaps = 6/222 (3%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            PA      LSR+SFP+GFVFGTA SAYQVEG A KE GRGP IWDTF+K PG    NAT 
Sbjct  26   PALKHARPLSRSSFPEGFVFGTAASAYQVEGMALKE-GRGPCIWDTFVKIPGNIAGNATA  84

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED+D++  +NF+AYRFSISWSRIFP GTGKVNW+GV YYNRLINYMLK+
Sbjct  85   DVTVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPKGTGKVNWRGVFYYNRLINYMLKQ  144

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLPQALQD Y GWL  ++VE +A++A+FCFK FGDRVKNWF+FNEPRVV
Sbjct  145  GITPYANLYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKMFGDRVKNWFTFNEPRVV  204

Query  667  AALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            AALGYD+G  APGRC+    NC+  GNSATEPYIV H+L+LS
Sbjct  205  AALGYDDGTHAPGRCT----NCSAGGNSATEPYIVAHHLILS  242



>ref|XP_008811966.1| PREDICTED: beta-glucosidase 1-like isoform X2 [Phoenix dactylifera]
Length=525

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 185/222 (83%), Gaps = 6/222 (3%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            PA      LSR+SFP+GFVFGTA SAYQVEG A KE GRGP IWDTF+K PG    NAT 
Sbjct  26   PALKHARPLSRSSFPEGFVFGTAASAYQVEGMALKE-GRGPCIWDTFVKIPGNIAGNATA  84

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED+D++  +NF+AYRFSISWSRIFP GTGKVNW+GV YYNRLINYMLK+
Sbjct  85   DVTVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPKGTGKVNWRGVFYYNRLINYMLKQ  144

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLPQALQD Y GWL  ++VE +A++A+FCFK FGDRVKNWF+FNEPRVV
Sbjct  145  GITPYANLYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKMFGDRVKNWFTFNEPRVV  204

Query  667  AALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            AALGYD+G  APGRC+    NC+  GNSATEPYIV H+L+LS
Sbjct  205  AALGYDDGTHAPGRCT----NCSAGGNSATEPYIVAHHLILS  242



>ref|XP_006482390.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=518

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 184/219 (84%), Gaps = 3/219 (1%)
 Frame = +1

Query  133  GFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEV  312
            GFDTGGLSR SFP+GFVFGTATSAYQVEG A K+ GRGP IWD +   PG   NNAT +V
Sbjct  43   GFDTGGLSRKSFPEGFVFGTATSAYQVEGMADKD-GRGPCIWDVYAHTPGHIANNATADV  101

Query  313  SVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGI  492
            +VDQYHRYKEDIDL+ NLNF+AYRFSISWSRIFP GTG VN +GV YYNRLI+YML++GI
Sbjct  102  TVDQYHRYKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGI  161

Query  493  TPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAA  672
            TPYANL HYD+P ALQ++Y G LD +V  D+ADYA+FCFKTFGDRVKNW++FNEPRV+AA
Sbjct  162  TPYANLYHYDMPLALQEKYGGLLDCQV--DYADYADFCFKTFGDRVKNWYTFNEPRVIAA  219

Query  673  LGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            LG+D+G   P RCSK   NCT+GNS TEPYI  HN++L+
Sbjct  220  LGFDDGSNPPSRCSKEVNNCTDGNSGTEPYIAAHNMILA  258



>gb|AFW79802.1| hypothetical protein ZEAMMB73_091278 [Zea mays]
Length=539

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 182/216 (84%), Gaps = 4/216 (2%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGLSR SFPKGFVFGTA SAYQVEG A K+ GRGPSIWD FIK PG   NNAT +V+VD
Sbjct  54   TGGLSRRSFPKGFVFGTAASAYQVEGMAHKD-GRGPSIWDAFIKIPGEIANNATADVTVD  112

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            +YHRYKED++++ N+ F+AYRFSISWSRIFPNGTG+VNW+GVAYYNRLINYM+K+GITPY
Sbjct  113  EYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLINYMVKKGITPY  172

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP+AL+ RY G L R VV  FADYA+FCF  FGDRVKNW +FNEPRVVAALGY
Sbjct  173  ANLYHYDLPEALEVRYGGLLSREVVRSFADYADFCFGAFGDRVKNWLTFNEPRVVAALGY  232

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            D+G FAPGRC+   G    G+S TEPY+V H+L+LS
Sbjct  233  DDGRFAPGRCT---GCEAGGDSGTEPYVVAHHLILS  265



>ref|XP_010916341.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=503

 Score =   331 bits (848),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 185/227 (81%), Gaps = 6/227 (3%)
 Frame = +1

Query  109  SPETTAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGRE  288
            S     PA    G LSR SFP+GFVFGTA SAYQVEG A K  GRGP IWDTF++ PG  
Sbjct  20   SAHIRRPALKHAGFLSRGSFPEGFVFGTAASAYQVEGMALKA-GRGPCIWDTFVRIPGNI  78

Query  289  PNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLI  468
              NAT +V+VD+YHRYKED+D++  +NF+AYRFSISWSRIFPNGTG VNW+GV YYNRLI
Sbjct  79   AGNATADVTVDEYHRYKEDVDIMKKMNFDAYRFSISWSRIFPNGTGTVNWRGVHYYNRLI  138

Query  469  NYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSF  648
            NYMLK+GITPYANL HYDLPQALQD Y GWL  ++VE +A++A+FCFKT+GDRVKNWF+F
Sbjct  139  NYMLKQGITPYANLYHYDLPQALQDEYLGWLSPKIVEAYANFADFCFKTYGDRVKNWFTF  198

Query  649  NEPRVVAALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLL  786
            NEPRVVAALGYD+G  APGRC+    NC+  GNS+TEPYIV H+L+L
Sbjct  199  NEPRVVAALGYDDGTHAPGRCT----NCSAGGNSSTEPYIVAHHLIL  241



>ref|XP_002461141.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
 gb|EER97662.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
Length=512

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 184/222 (83%), Gaps = 6/222 (3%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P  +D GGLSR +FP+GFVFGTA SAYQVEG A K  GRGPSIWD FI+ PG  PNNAT 
Sbjct  35   PEIYDAGGLSRRAFPEGFVFGTAASAYQVEGMA-KHGGRGPSIWDAFIEVPGTIPNNATA  93

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFPNGTGKVN +GV YYNRLI+YML++
Sbjct  94   DVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGKVNQEGVDYYNRLIDYMLQQ  153

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP AL ++Y GWL  ++VE FADYAEFCF+TFGDRVKNWF+FNEPR V
Sbjct  154  GITPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFQTFGDRVKNWFTFNEPRCV  213

Query  667  AALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            AALGYDNG  APGRCS+    C   GNS TEPY+  H+L+LS
Sbjct  214  AALGYDNGLHAPGRCSE----CAAGGNSTTEPYLAAHHLILS  251



>ref|XP_008655551.1| PREDICTED: beta-glucosidase 1-like [Zea mays]
Length=570

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 182/216 (84%), Gaps = 4/216 (2%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGLSR SFPKGFVFGTA SAYQVEG A K+ GRGPSIWD FIK PG   NNAT +V+VD
Sbjct  97   TGGLSRRSFPKGFVFGTAASAYQVEGMAHKD-GRGPSIWDAFIKIPGEIANNATADVTVD  155

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            +YHRYKED++++ N+ F+AYRFSISWSRIFPNGTG+VNW+GVAYYNRLINYM+K+GITPY
Sbjct  156  EYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNWKGVAYYNRLINYMVKKGITPY  215

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP+AL+ RY G L R VV  FADYA+FCF  FGDRVKNW +FNEPRVVAALGY
Sbjct  216  ANLYHYDLPEALEVRYGGLLSREVVRSFADYADFCFGAFGDRVKNWLTFNEPRVVAALGY  275

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            D+G FAPGRC+   G    G+S TEPY+V H+L+LS
Sbjct  276  DDGRFAPGRCT---GCEAGGDSGTEPYVVAHHLILS  308



>ref|XP_006658055.1| PREDICTED: beta-glucosidase 26-like [Oryza brachyantha]
Length=511

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 185/222 (83%), Gaps = 6/222 (3%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P  +D GGLSR +FPKGFVFGTA SAYQVEG A K+ GRGPSIWD FI+ PG  PNNAT 
Sbjct  33   PEIYDAGGLSRRAFPKGFVFGTAASAYQVEGMA-KQGGRGPSIWDAFIEKPGTIPNNATA  91

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFP+GTGKVN +GV YYNRLI+YM+K+
Sbjct  92   DVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMIKK  151

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP AL ++Y GWL  ++VE FADYAEFCF TFGDRVK+WF+FNEPR V
Sbjct  152  GITPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFLTFGDRVKDWFTFNEPRCV  211

Query  667  AALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            AALGYDNG  APGRCS    +C   GNS TEPY+V H+L+LS
Sbjct  212  AALGYDNGLHAPGRCS----DCDAGGNSTTEPYLVAHHLILS  249



>ref|XP_004958541.1| PREDICTED: beta-glucosidase 26-like [Setaria italica]
Length=539

 Score =   329 bits (843),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 184/221 (83%), Gaps = 4/221 (2%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P  ++TGGLSR +FP GFVFGTA SAYQVEG A K+ GRGPSIWD FIK PG  P+NAT 
Sbjct  62   PEIYNTGGLSRRAFPAGFVFGTAASAYQVEGMA-KQGGRGPSIWDAFIKVPGTIPDNATA  120

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFPNGTG+VN +GV YYNRLI+YM+++
Sbjct  121  DVAVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGEVNQEGVDYYNRLIDYMIQQ  180

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP AL ++Y GWL  ++VE FADYAEFCF+ FGDRVKNWF+FNEPR V
Sbjct  181  GITPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFQMFGDRVKNWFTFNEPRCV  240

Query  667  AALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            AALGYDNG  APGRCS   G    GNS TEPY+V H+L+LS
Sbjct  241  AALGYDNGLHAPGRCS---GCAAGGNSTTEPYLVAHHLILS  278



>dbj|BAB02019.1| beta-glucosidase [Arabidopsis thaliana]
Length=495

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 181/216 (84%), Gaps = 9/216 (4%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGL+R SFP+GF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG+  NNAT E++VD
Sbjct  27   TGGLNRKSFPEGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGKIANNATAEITVD  85

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYHRYKED+DL+ NLN +AYRFSISWSRIFP G+GK+N  GVAYYNRLI+Y++++GITPY
Sbjct  86   QYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSGKINSNGVAYYNRLIDYLIEKGITPY  145

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP AL+ +Y G L ++VV          F+TFGDRVKNW +FNEPRVVAALGY
Sbjct  146  ANLYHYDLPLALEQKYQGLLSKQVV--------VLFQTFGDRVKNWMTFNEPRVVAALGY  197

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            DNG FAPGRCS+ FGNCT+GNSATEPYIV H+L+L+
Sbjct  198  DNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILA  233



>ref|XP_003562544.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
 ref|XP_010234616.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
Length=500

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 181/222 (82%), Gaps = 6/222 (3%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P   DTGGLSR +FP+GFVFGTA SAYQVEG A K  GRGPSIWD FI+ PG    N T 
Sbjct  23   PEIHDTGGLSRGAFPEGFVFGTAASAYQVEGMA-KRGGRGPSIWDAFIEIPGMISGNGTA  81

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED+D++ ++ F+AYRFSISWSRIFPNG GKVN +GV YYNRLI+YML++
Sbjct  82   DVAVDEYHRYKEDVDIMKSMGFDAYRFSISWSRIFPNGAGKVNQEGVDYYNRLIDYMLQQ  141

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP AL  +Y GWL  ++VE FADYA+FCFK FGDRVKNWF+FNEPR V
Sbjct  142  GITPYANLYHYDLPLALHQQYLGWLSPKIVEAFADYADFCFKVFGDRVKNWFTFNEPRCV  201

Query  667  AALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            AALGYDNG+ APGRCS+    CT  GNS TEPY+V H+L+LS
Sbjct  202  AALGYDNGYHAPGRCSQ----CTAGGNSMTEPYLVAHHLILS  239



>ref|NP_001148821.1| LOC100282438 precursor [Zea mays]
 gb|ACG33023.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=512

 Score =   326 bits (835),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 180/221 (81%), Gaps = 4/221 (2%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P  +D GGLSR +FP GFVFGTA SAYQVEG A K  GRGPSIWD FI+ PG  PNNAT 
Sbjct  35   PEIYDAGGLSRRAFPDGFVFGTAASAYQVEGMA-KHGGRGPSIWDAFIEVPGTIPNNATA  93

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFP+GTGKVN +GV YYNRLI+YML++
Sbjct  94   DVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQ  153

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GI PYANL HYDLP AL ++Y GWL  ++VE FADYAEFCF  FGDRVKNWF+FNEPR V
Sbjct  154  GIAPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFHAFGDRVKNWFTFNEPRCV  213

Query  667  AALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            AALGYDNG  APGRCS   G    GNS TEPY+V H+L+LS
Sbjct  214  AALGYDNGLHAPGRCS---GCPAGGNSTTEPYLVAHHLILS  251



>gb|ACL52625.1| unknown [Zea mays]
 tpg|DAA63940.1| TPA: non-cyanogenic beta-glucosidase [Zea mays]
Length=512

 Score =   326 bits (835),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 180/221 (81%), Gaps = 4/221 (2%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P  +D GGLSR +FP GFVFGTA SAYQVEG A K  GRGPSIWD FI+ PG  PNNAT 
Sbjct  35   PEIYDAGGLSRRAFPDGFVFGTAASAYQVEGMA-KHGGRGPSIWDAFIEVPGTIPNNATA  93

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFP+GTGKVN +GV YYNRLI+YML++
Sbjct  94   DVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQ  153

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GI PYANL HYDLP AL ++Y GWL  ++VE FADYAEFCF  FGDRVKNWF+FNEPR V
Sbjct  154  GIAPYANLYHYDLPLALHEQYLGWLSPKIVEAFADYAEFCFHAFGDRVKNWFTFNEPRCV  213

Query  667  AALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            AALGYDNG  APGRCS   G    GNS TEPY+V H+L+LS
Sbjct  214  AALGYDNGLHAPGRCS---GCPAGGNSTTEPYLVAHHLILS  251



>pdb|4JIE|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
 pdb|4JHO|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
Length=503

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 189/239 (79%), Gaps = 6/239 (3%)
 Frame = +1

Query  79   STATEIQSEVSPET--TAPAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPS  252
            S   + +S  +P T    P  +D GGLSR +FP+GFVFGTA SAYQVEG A K+ GRGPS
Sbjct  7    SLYKKAESAAAPFTYWLNPEIYDAGGLSRRAFPEGFVFGTAASAYQVEGMA-KQGGRGPS  65

Query  253  IWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKV  432
            IWD FI+ PG  PNNAT +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFPNGTG V
Sbjct  66   IWDAFIEKPGTIPNNATADVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMV  125

Query  433  NWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFK  612
            N +GV YYNRLI+YM+K+GI PYANL HYDLP AL ++Y GWL   +VE FADYA+FCF+
Sbjct  126  NQEGVDYYNRLIDYMVKKGIKPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQ  185

Query  613  TFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            TFGDRVK+WF+FNEPR VAALGYDNGF APGRCS   G    GNS TEPY+  H+L+LS
Sbjct  186  TFGDRVKDWFTFNEPRCVAALGYDNGFHAPGRCS---GCDAGGNSTTEPYLAAHHLILS  241



>gb|ACF35791.1| beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group]
Length=483

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 182/221 (82%), Gaps = 4/221 (2%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P  +D GGLSR +FP+GFVFGTA SAYQVEG A K+ GRGPSIWD FI+ PG  PNNAT 
Sbjct  5    PEIYDAGGLSRRAFPEGFVFGTAASAYQVEGMA-KQGGRGPSIWDAFIEKPGTIPNNATA  63

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFPNGTG VN +GV YYNRLI+YM+K+
Sbjct  64   DVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKK  123

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GI PYANL HYDLP AL ++Y GWL   +VE FADYA+FCF+TFGDRVK+WF+FNEPR V
Sbjct  124  GIKPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCV  183

Query  667  AALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            AALGYDNGF APGRCS   G    GNS TEPY+  H+L+LS
Sbjct  184  AALGYDNGFHAPGRCS---GCDAGGNSTTEPYLAAHHLILS  221



>ref|NP_188435.2| beta glucosidase 43 [Arabidopsis thaliana]
 sp|Q9LV34.2|BGL43_ARATH RecName: Full=Beta-glucosidase 43; Short=AtBGLU43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE76042.1| beta glucosidase 43 [Arabidopsis thaliana]
Length=501

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 180/216 (83%), Gaps = 3/216 (1%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGL+R SFP+GF+FGTATSAYQVEG   ++ GRGPSIWD F+K PG+  NNAT E++VD
Sbjct  27   TGGLNRKSFPEGFLFGTATSAYQVEGETHQD-GRGPSIWDAFVKIPGKIANNATAEITVD  85

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYHRYKED+DL+ NLN +AYRFSISWSRIFP G+GK+N  GVAYYNRLI+Y++++GITPY
Sbjct  86   QYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSGKINSNGVAYYNRLIDYLIEKGITPY  145

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
            ANL HYDLP AL+ +Y G L ++    F       F+TFGDRVKNW +FNEPRVVAALGY
Sbjct  146  ANLYHYDLPLALEQKYQGLLSKQ--GRFCGLRRVLFQTFGDRVKNWMTFNEPRVVAALGY  203

Query  682  DNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            DNG FAPGRCS+ FGNCT+GNSATEPYIV H+L+L+
Sbjct  204  DNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILA  239



>sp|A3BMZ5.1|BGL26_ORYSJ RecName: Full=Beta-glucosidase 26; Short=Os7bglu26; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|EAZ04982.1| hypothetical protein OsI_27163 [Oryza sativa Indica Group]
 gb|EAZ40934.1| hypothetical protein OsJ_25416 [Oryza sativa Japonica Group]
Length=510

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 182/221 (82%), Gaps = 4/221 (2%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P  +D GGLSR +FP+GFVFGTA SAYQVEG A K+ GRGPSIWD FI+ PG  PNNAT 
Sbjct  32   PEIYDAGGLSRRAFPEGFVFGTAASAYQVEGMA-KQGGRGPSIWDAFIEKPGTIPNNATA  90

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED++++ N+ F+AYRFSISWSRIFPNGTG VN +GV YYNRLI+YM+K+
Sbjct  91   DVTVDEYHRYKEDVNIMKNMGFDAYRFSISWSRIFPNGTGMVNQEGVDYYNRLIDYMVKK  150

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GI PYANL HYDLP AL ++Y GWL   +VE FADYA+FCF+TFGDRVK+WF+FNEPR V
Sbjct  151  GIKPYANLYHYDLPLALHEQYLGWLSPNIVEAFADYADFCFQTFGDRVKDWFTFNEPRCV  210

Query  667  AALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            AALGYDNGF APGRCS   G    GNS TEPY+  H+L+LS
Sbjct  211  AALGYDNGFHAPGRCS---GCDAGGNSTTEPYLAAHHLILS  248



>gb|KCW83983.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=450

 Score =   321 bits (823),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  223  AGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWS  402
            A KE GRGPSIWD F+K PG    NATGEVSVDQYHRYKED+DL+A LNF+AYRFSISWS
Sbjct  2    ADKE-GRGPSIWDVFVKIPGIVAGNATGEVSVDQYHRYKEDVDLMAKLNFDAYRFSISWS  60

Query  403  RIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVED  582
            RIFP+GTGKVNW+GVAYYNRLINY+L++GITPYANL HYDLP+AL+ +Y G L   VV+D
Sbjct  61   RIFPDGTGKVNWKGVAYYNRLINYLLRKGITPYANLYHYDLPEALEKKYKGLLSPNVVKD  120

Query  583  FADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPY  762
            FADYA+FCFKTFGDRVKNW +FNEPRVVAALGYDNG FAP RCSK +GNCT GNS TEPY
Sbjct  121  FADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGLFAPARCSKAYGNCTAGNSGTEPY  180

Query  763  IVTHNLLLS  789
            IV H+L+LS
Sbjct  181  IVAHHLILS  189



>emb|CDM80087.1| unnamed protein product [Triticum aestivum]
Length=507

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 179/222 (81%), Gaps = 6/222 (3%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P   D GGLSR  FP+GFVFGTA SAYQVEG A ++ GRGPSIWD FIK PG    N T 
Sbjct  29   PEIHDAGGLSRQGFPEGFVFGTAASAYQVEGMA-EQGGRGPSIWDAFIKIPGTIAGNGTA  87

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED+D++ N+ F+AYRFSISWSRIFP+GTGKVNW+GV YYNRLI+YML++
Sbjct  88   DVAVDEYHRYKEDVDIMKNMGFDAYRFSISWSRIFPDGTGKVNWEGVDYYNRLIDYMLQQ  147

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP AL  +Y GWL  R+V  FADYA+FCFK FGDRVKNWF+FNEPR V
Sbjct  148  GITPYANLYHYDLPLALHQQYLGWLSPRIVGAFADYADFCFKVFGDRVKNWFTFNEPRCV  207

Query  667  AALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            AALGYDNG  APGRCS+    C+  G+S TEPY+  H+L+LS
Sbjct  208  AALGYDNGLHAPGRCSQ----CSAGGDSTTEPYLAAHHLILS  245



>ref|XP_007036680.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
 gb|EOY21181.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
Length=469

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  238  GRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPN  417
            GRGPSI D F+K PG    NATGEVSVDQYHRYKED+DL+ANLNF+AYRFSISWSRIFP+
Sbjct  6    GRGPSICDVFVKIPGIVAKNATGEVSVDQYHRYKEDVDLMANLNFDAYRFSISWSRIFPD  65

Query  418  GTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYA  597
            GTGKVNW+GVAYYNRLI+ +L+RGITPYANL HYDLP+AL+ RYNG L  +VV+DFAD+A
Sbjct  66   GTGKVNWKGVAYYNRLIDSLLQRGITPYANLYHYDLPEALEKRYNGLLSYQVVKDFADFA  125

Query  598  EFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHN  777
            +FCFKTFGDRVKNW +FNEPRVVAALGYDNGFFAPGRCSK +GNCT GNS TEPYIV H+
Sbjct  126  DFCFKTFGDRVKNWMTFNEPRVVAALGYDNGFFAPGRCSKAYGNCTAGNSGTEPYIVAHH  185

Query  778  LLLS  789
            L+L+
Sbjct  186  LILA  189



>gb|EMT23872.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=537

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 178/222 (80%), Gaps = 6/222 (3%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P   D GG SR  FP+GFVFGTATSAYQVEG A ++ GRGPSIWD FIK PG  P N T 
Sbjct  39   PEIHDAGGRSRQGFPEGFVFGTATSAYQVEGMA-EQGGRGPSIWDAFIKIPGTIPGNGTA  97

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED+D++ N+ F+AYRFSISWSRIFP+GTGKVNW+GV YYNRLI+YML++
Sbjct  98   DVAVDEYHRYKEDVDIMKNMGFDAYRFSISWSRIFPDGTGKVNWEGVDYYNRLIDYMLQQ  157

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GITPYANL HYDLP AL  RY GWL   +V  FADYA+FCFK FGDRVKNWF+FNEPR V
Sbjct  158  GITPYANLYHYDLPLALHQRYLGWLSPNIVGAFADYADFCFKVFGDRVKNWFTFNEPRCV  217

Query  667  AALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            AALGYD G  APGRCS+    C+  G+S TEPY+  H+L+LS
Sbjct  218  AALGYDIGLHAPGRCSQ----CSAGGDSTTEPYLAAHHLILS  255



>tpg|DAA50880.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=260

 Score =   309 bits (792),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEGAA    GRGPSIWD+F   PG    N  G+V+VDQ
Sbjct  33   GGLSRASFPKGFVFGTATSAYQVEGAASTN-GRGPSIWDSFAHVPGNIAGNQNGDVAVDQ  91

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LINY+L++G+TPY 
Sbjct  92   YHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNPEGVAYYNNLINYLLQQGMTPYI  151

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL  ++ + F DYA+FCFKT+GDRVK+WF+FNEPR+VA LGYD
Sbjct  152  NLYHYDLPLALEKKYGGWLSAKMADLFTDYADFCFKTYGDRVKHWFTFNEPRIVALLGYD  211

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC++    C   GNSATEPYIV HN LL+
Sbjct  212  TGSNPPQRCTR----CAAGGNSATEPYIVAHNFLLA  243



>gb|ACF07998.1| beta-glucosidase [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            +TGGLSR  FP GFVFGTA SAYQVEG A ++ GRGP IWD F+  PG    N T +V+V
Sbjct  35   NTGGLSRQGFPAGFVFGTAASAYQVEGMA-RQGGRGPCIWDAFVAIPGMIAGNGTADVTV  93

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+ ++ N+ F+AYRFSI WSRIFP+GTGKVN +GV YYNRLI+YML++GITP
Sbjct  94   DEYHRYKEDVGIMKNMGFDAYRFSIIWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGITP  153

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            YANL HYDLP AL  +Y GWL  ++V  FADYAEFCFK FGDRVKNWF+FNEPRVVAALG
Sbjct  154  YANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWFTFNEPRVVAALG  213

Query  679  YDNGFFAPGRCSK-PFGNCTEGNSATEPYIVTHNLLLS  789
            YDNGF APGRCSK P G    G+S TEPYIVTHN++LS
Sbjct  214  YDNGFHAPGRCSKCPAG----GDSRTEPYIVTHNIILS  247



>ref|XP_004982054.1| PREDICTED: beta-glucosidase 8-like [Setaria italica]
Length=566

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 179/221 (81%), Gaps = 6/221 (3%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
             G DTGGLSR +FPKGFVFGTATSA+QVEGAA    GRGPSIWD F+  PG+   +A  +
Sbjct  40   VGADTGGLSRDAFPKGFVFGTATSAFQVEGAASTN-GRGPSIWDPFVHTPGKIAGDANAD  98

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+ D+YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G GKVN +GV YYN LI++MLK+G
Sbjct  99   VTTDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNEEGVQYYNNLIDHMLKQG  158

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            +TPYANLNHYDLP ALQ +Y GWL  ++V+ FADYA+FCFKTFGDRVKNWF+ NEPR+V+
Sbjct  159  LTPYANLNHYDLPLALQKKYKGWLGPKIVDIFADYADFCFKTFGDRVKNWFTLNEPRIVS  218

Query  670  ALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             LGYD G   P RC++    C   GNSATEPYIV HN+LLS
Sbjct  219  FLGYDKGLNPPNRCTQ----CAAGGNSATEPYIVVHNILLS  255



>ref|NP_001151026.1| LOC100284659 precursor [Zea mays]
 gb|ACG41348.1| beta-glucosidase precursor [Zea mays]
 tpg|DAA50884.1| TPA: hypothetical protein ZEAMMB73_397657 [Zea mays]
Length=564

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 180/221 (81%), Gaps = 6/221 (3%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            AG DTGGLSR +FPKGFVFGTATSAYQVEGAA    GRGP IWD F+  PG+   +A  +
Sbjct  41   AGADTGGLSRDAFPKGFVFGTATSAYQVEGAATSG-GRGPCIWDPFVHTPGKIAEDANAD  99

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+ D+YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G GK+N +GV YYN LI+YM+K+G
Sbjct  100  VTTDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKINEEGVQYYNNLIDYMIKQG  159

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            +TPYANLNHYDLP ALQ +Y GWL  ++V+ FADYA+FCFKTFG+RVKNWF+ NEPR+VA
Sbjct  160  LTPYANLNHYDLPLALQKKYQGWLGPKIVDIFADYADFCFKTFGNRVKNWFTLNEPRIVA  219

Query  670  ALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             LGYD G   P RC++    CT  GNS+TEPYIV HN+LLS
Sbjct  220  FLGYDKGLNPPNRCTQ----CTAGGNSSTEPYIVVHNILLS  256



>gb|AAA87339.1| beta-glucosidase [Hordeum vulgare]
Length=509

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            +TGGLSR  FP GFVFGTA SAYQVEG A ++ GRGP IWD F+   G    N T +V+V
Sbjct  35   NTGGLSRQGFPAGFVFGTAASAYQVEGMA-RQGGRGPCIWDAFVAIQGMIAGNGTADVTV  93

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+ ++ N+ F+AYRFSISWSRIFP+GTGKVN +GV YYNRLI+YML++GITP
Sbjct  94   DEYHRYKEDVGIMKNMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGITP  153

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            YANL HYDLP AL  +Y GWL  ++V  FADYAEFCFK FGDRVKNWF+FNEPRVVAALG
Sbjct  154  YANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWFTFNEPRVVAALG  213

Query  679  YDNGFFAPGRCSK-PFGNCTEGNSATEPYIVTHNLLLS  789
            YDNGF APGRCSK P G    G+S TEPYIVTHN++LS
Sbjct  214  YDNGFHAPGRCSKCPAG----GDSRTEPYIVTHNIILS  247



>ref|XP_006845278.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
 gb|ERN06953.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
Length=479

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 172/197 (87%), Gaps = 5/197 (3%)
 Frame = +1

Query  211  VEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFS  390
            VEGAA ++ GRGPSIWD F+++PG  PN ATGEVS D+YHRYKED+D++A++N +AYRFS
Sbjct  23   VEGAAHED-GRGPSIWDVFVQYPGIIPNGATGEVSADEYHRYKEDVDIMADMNMDAYRFS  81

Query  391  ISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRR  570
            ISWSRIFP G G+VN +GV YYNRLI+Y+L++GITPYANL HYDLPQ+L+D YNG L+RR
Sbjct  82   ISWSRIFPEGVGRVNQKGVDYYNRLIDYLLEKGITPYANLYHYDLPQSLEDSYNGLLNRR  141

Query  571  VVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFG----NCTE  738
            VV+DFA YA+FCFKTFGDRVKNW +FNEPRV+AALGYDNGF APGRCS PFG    NCT 
Sbjct  142  VVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGFHAPGRCSNPFGNDGMNCTA  201

Query  739  GNSATEPYIVTHNLLLS  789
            G+S+TEPYIV HNL+LS
Sbjct  202  GDSSTEPYIVAHNLILS  218



>ref|XP_006845277.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
 gb|ERN06952.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
Length=479

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 172/197 (87%), Gaps = 5/197 (3%)
 Frame = +1

Query  211  VEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFS  390
            VEGAA ++ GRGPSIWD F+++PG  PN ATGEVS D+YHRYKED+D++A++N +AYRFS
Sbjct  23   VEGAAHED-GRGPSIWDVFVQYPGIIPNGATGEVSADEYHRYKEDVDIMADMNMDAYRFS  81

Query  391  ISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRR  570
            ISWSRIFP G G+VN +GV YYNRLI+Y+L++GITPYANL HYDLPQ+L+D YNG L+RR
Sbjct  82   ISWSRIFPEGVGRVNQKGVDYYNRLIDYLLEKGITPYANLYHYDLPQSLEDSYNGLLNRR  141

Query  571  VVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFG----NCTE  738
            VV+DFA YA+FCFKTFGDRVKNW +FNEPRV+AALGYDNGF APGRCS PFG    NCT 
Sbjct  142  VVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGFHAPGRCSNPFGNDGMNCTA  201

Query  739  GNSATEPYIVTHNLLLS  789
            G+S+TEPYIV HNL+LS
Sbjct  202  GDSSTEPYIVAHNLILS  218



>ref|XP_006650460.1| PREDICTED: beta-glucosidase 8-like [Oryza brachyantha]
Length=568

 Score =   317 bits (812),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 177/221 (80%), Gaps = 6/221 (3%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            A  D GGLSRA+FPKGFVFGTATSA+QVEG A    GRGPSIWD F+  PG    NA  +
Sbjct  38   AADDAGGLSRAAFPKGFVFGTATSAFQVEGMAASA-GRGPSIWDPFVHTPGNIAGNANAD  96

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+ D+YHRYKED+DLL +LNF+AYRFSISWSRIFP+G G++N +GVAYYN LI+Y+LK+G
Sbjct  97   VTTDEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGRINTEGVAYYNNLIDYVLKQG  156

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            + PY NLNHYDLP ALQ +Y GWL  ++V  FADYAEFCFKT+GDRVKNWF+FNEPR+VA
Sbjct  157  LIPYVNLNHYDLPLALQKKYEGWLSSKIVGVFADYAEFCFKTYGDRVKNWFTFNEPRIVA  216

Query  670  ALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            ALG+D G   P RC+K    C   GNSATEPYIV HN++LS
Sbjct  217  ALGHDAGTDPPNRCTK----CAAGGNSATEPYIVAHNIILS  253



>gb|KJB16854.1| hypothetical protein B456_002G250800 [Gossypium raimondii]
Length=344

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +1

Query  232  EYGRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIF  411
            E GRGPSIWD F+  PG   NN TGEVS+DQYHRYKED+DL+  LNF+AYRFSISWSRIF
Sbjct  4    EDGRGPSIWDAFVNTPGHIANNETGEVSIDQYHRYKEDVDLMQMLNFDAYRFSISWSRIF  63

Query  412  PNGTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFAD  591
            PNGTG+VNW+GV YYNRLI+Y+L++GITP+ANL HYDLP ALQ++Y G LDR++++DFAD
Sbjct  64   PNGTGEVNWKGVDYYNRLIDYLLEKGITPHANLYHYDLPLALQEKYLGLLDRQIIQDFAD  123

Query  592  YAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVT  771
            YAEFCFKTFGDRVK W +FNEPRVVAALG+DNG   P RCSK FGNCT+GNSATEPYI  
Sbjct  124  YAEFCFKTFGDRVKTWMTFNEPRVVAALGFDNGINPPNRCSKKFGNCTDGNSATEPYIAA  183

Query  772  HNLLLS  789
            H+L+LS
Sbjct  184  HHLVLS  189



>tpg|DAA50882.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=390

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEGAA    GRGPSIWD+F   PG    N  G+V+VDQ
Sbjct  33   GGLSRASFPKGFVFGTATSAYQVEGAASTN-GRGPSIWDSFAHVPGNIAGNQNGDVAVDQ  91

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LINY+L++G+TPY 
Sbjct  92   YHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNPEGVAYYNNLINYLLQQGMTPYI  151

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL  ++ + F DYA+FCFKT+GDRVK+WF+FNEPR+VA LGYD
Sbjct  152  NLYHYDLPLALEKKYGGWLSAKMADLFTDYADFCFKTYGDRVKHWFTFNEPRIVALLGYD  211

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC++    C   GNSATEPYIV HN LL+
Sbjct  212  TGSNPPQRCTR----CAAGGNSATEPYIVAHNFLLA  243



>gb|EMT08337.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=507

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            +TGGLSR  FP GFVFGTA SAYQVEG A ++ GRGPSIWD F   PG    N + +V+V
Sbjct  33   NTGGLSRQGFPAGFVFGTAASAYQVEGMA-RQGGRGPSIWDAFAAIPGTIAGNGSADVTV  91

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+ ++ ++ F+AYRFSISWSRIFP+GTGKVN +GV YYNRLI+YML++GITP
Sbjct  92   DEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGITP  151

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            YANL HYDLP AL  +Y GWL  ++V  FADYAEFCFK FGDRVKNWF+FNEPRVVAALG
Sbjct  152  YANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWFTFNEPRVVAALG  211

Query  679  YDNGFFAPGRCSK-PFGNCTEGNSATEPYIVTHNLLLS  789
            YDNG  APGRCSK P G    G+S TEPYIVTHN++LS
Sbjct  212  YDNGLHAPGRCSKCPAG----GDSRTEPYIVTHNIILS  245



>gb|AEV76986.1| beta-glucosidase 4, partial [Triticum aestivum]
Length=501

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            +TGGLSR  FP GFVFGTA SAYQVEG A ++ GRGPSIWD F   PG    N + +V+V
Sbjct  27   NTGGLSRQGFPAGFVFGTAASAYQVEGMA-RQGGRGPSIWDAFAAIPGTIAGNGSADVTV  85

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+ ++ ++ F+AYRFSISWSRIFP+GTGKVN +GV YYNRLI+YML++GITP
Sbjct  86   DEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGITP  145

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            YANL HYDLP AL  +Y GWL  ++V  FADYAEFCFK FGDRVKNWF+FNEPRVVAALG
Sbjct  146  YANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWFTFNEPRVVAALG  205

Query  679  YDNGFFAPGRCSK-PFGNCTEGNSATEPYIVTHNLLLS  789
            YDNG  APGRCSK P G    G+S TEPYIVTHN++LS
Sbjct  206  YDNGLHAPGRCSKCPAG----GDSRTEPYIVTHNIILS  239



>ref|XP_002464026.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
 gb|EER91024.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
Length=567

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 178/221 (81%), Gaps = 6/221 (3%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
             G DTGGLSR +FPKGF+FGTATSA+QVEGAA    GRGP IWD F+  PG+   +   +
Sbjct  43   VGADTGGLSRDAFPKGFIFGTATSAFQVEGAATSG-GRGPCIWDPFVHTPGKIAEDGNAD  101

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+ D+YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G GKVN +GV YYN LI+YM+K+G
Sbjct  102  VTTDEYHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNEEGVQYYNDLIDYMIKQG  161

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            +TPYANLNHYDLP ALQ +Y GWL  ++V+ FADYA+FCFKTFGDRVKNWF+ NEPR+V+
Sbjct  162  LTPYANLNHYDLPLALQKKYQGWLGPKIVDIFADYADFCFKTFGDRVKNWFTLNEPRIVS  221

Query  670  ALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             LGYD G   P RC++    CT  GNS+TEPYIV HN+LLS
Sbjct  222  FLGYDKGIDPPNRCTQ----CTAGGNSSTEPYIVVHNILLS  258



>gb|EEC76023.1| hypothetical protein OsI_13187 [Oryza sativa Indica Group]
Length=568

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 176/218 (81%), Gaps = 6/218 (3%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            DTGGLSRA+FPKGFVFGTATSA+QVEG A    GRGPSIWD F+  PG    N   +V+ 
Sbjct  41   DTGGLSRAAFPKGFVFGTATSAFQVEGMAASG-GRGPSIWDPFVHTPGNIAGNGNADVTT  99

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+DLL +LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LI+Y++K+G+ P
Sbjct  100  DEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYNNLIDYVIKQGLIP  159

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            Y NLNHYDLP ALQ +Y GWL  ++V  F+DYAEFCFKT+GDRVKNWF+FNEPR+VAALG
Sbjct  160  YVNLNHYDLPLALQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNWFTFNEPRIVAALG  219

Query  679  YDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            +D G   P RC+K    C   GNSATEPYIV HN++LS
Sbjct  220  HDTGTDPPNRCTK----CAAGGNSATEPYIVAHNIILS  253



>ref|NP_001051014.1| Os03g0703100 [Oryza sativa Japonica Group]
 sp|Q75I94.1|BGL08_ORYSJ RecName: Full=Beta-glucosidase 8; Short=Os3bglu8; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07251.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF98427.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12928.1| Os03g0703100 [Oryza sativa Japonica Group]
 dbj|BAH00173.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59768.1| hypothetical protein OsJ_12263 [Oryza sativa Japonica Group]
Length=568

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 176/218 (81%), Gaps = 6/218 (3%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            DTGGLSRA+FPKGFVFGTATSA+QVEG A    GRGPSIWD F+  PG    N   +V+ 
Sbjct  41   DTGGLSRAAFPKGFVFGTATSAFQVEGMAASG-GRGPSIWDPFVHTPGNIAGNGNADVTT  99

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+DLL +LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LI+Y++K+G+ P
Sbjct  100  DEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNTEGVAYYNNLIDYVIKQGLIP  159

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            Y NLNHYDLP ALQ +Y GWL  ++V  F+DYAEFCFKT+GDRVKNWF+FNEPR+VAALG
Sbjct  160  YVNLNHYDLPLALQKKYEGWLSPKIVGVFSDYAEFCFKTYGDRVKNWFTFNEPRIVAALG  219

Query  679  YDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            +D G   P RC+K    C   GNSATEPYIV HN++LS
Sbjct  220  HDTGTDPPNRCTK----CAAGGNSATEPYIVAHNIILS  253



>ref|XP_009394053.1| PREDICTED: beta-glucosidase 26-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 176/214 (82%), Gaps = 6/214 (3%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R +FP+GFVFGTA SAYQVEG A  E GRGP IWD F++ PG  PNNAT +VSVD+YH
Sbjct  34   LNRDAFPEGFVFGTAASAYQVEGMA-LEGGRGPCIWDAFVRVPGIIPNNATADVSVDEYH  92

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
             YKED+D++   NF+AYRFSISWSRIFPNGTG++NWQGV YY+RLI+Y++ +GITPYANL
Sbjct  93   HYKEDVDIMKKFNFDAYRFSISWSRIFPNGTGEINWQGVDYYDRLIDYLILQGITPYANL  152

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLP AL   Y GW+  ++V+ FA+YA+FCF+ +GDRVKNWF+FNEPRVV+ALGYDNG
Sbjct  153  YHYDLPLALHKEYLGWVSPKIVDAFANYADFCFERYGDRVKNWFTFNEPRVVSALGYDNG  212

Query  691  FFAPGRCSKPFGNC-TEGNSATEPYIVTHNLLLS  789
              APGRC+    +C   GNS TEPYIVTHN++LS
Sbjct  213  LHAPGRCT----DCKVGGNSTTEPYIVTHNIILS  242



>ref|NP_001142124.1| uncharacterized protein LOC100274288 precursor [Zea mays]
 gb|ACF87697.1| unknown [Zea mays]
 gb|ACF87698.1| unknown [Zea mays]
 gb|ACR38603.1| unknown [Zea mays]
 tpg|DAA50881.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=502

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEGAA    GRGPSIWD+F   PG    N  G+V+VDQ
Sbjct  33   GGLSRASFPKGFVFGTATSAYQVEGAASTN-GRGPSIWDSFAHVPGNIAGNQNGDVAVDQ  91

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LINY+L++G+TPY 
Sbjct  92   YHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGKVNPEGVAYYNNLINYLLQQGMTPYI  151

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL  ++ + F DYA+FCFKT+GDRVK+WF+FNEPR+VA LGYD
Sbjct  152  NLYHYDLPLALEKKYGGWLSAKMADLFTDYADFCFKTYGDRVKHWFTFNEPRIVALLGYD  211

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC++    C   GNSATEPYIV HN LL+
Sbjct  212  TGSNPPQRCTR----CAAGGNSATEPYIVAHNFLLA  243



>gb|ACG44181.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=466

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGTATSAYQVEGAA    GRGPS WD F+  PG    N T +V+VDQ
Sbjct  34   GGLSRAAFPKDFVFGTATSAYQVEGAASTN-GRGPSTWDAFVHTPGNIVYNQTADVAVDQ  92

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRY+ED+DL+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPYA
Sbjct  93   YHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLRKGITPYA  152

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL H DLP ALQ++Y GWL+ ++ + F DYA+FCFKTFGDRVK+WF+FNEPR+VA LGYD
Sbjct  153  NLYHSDLPLALQNKYGGWLNAKMAKLFTDYADFCFKTFGDRVKHWFTFNEPRIVALLGYD  212

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C+  GNSATEPYIV HN LLS
Sbjct  213  AGSIPPQRCTK----CSAGGNSATEPYIVAHNFLLS  244



>gb|EMS60983.1| Beta-glucosidase 26 [Triticum urartu]
Length=525

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 175/218 (80%), Gaps = 6/218 (3%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            +TGGLSR  FP GFVFGTA SAYQVEG A ++ GRGPSIWD F   PG    N + +V+V
Sbjct  35   NTGGLSRQGFPAGFVFGTAASAYQVEGMA-RQGGRGPSIWDAFAAIPGTIAGNGSADVTV  93

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+ ++ ++ F+AYRFSISWSRIFP+GTGKVN +GV YYNRLI+YML++GI P
Sbjct  94   DEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGIAP  153

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            YANL HYDLP AL  +Y GWL  ++V  FADYAEFCFK FGDRVKNWF+FNEPRVVAALG
Sbjct  154  YANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWFTFNEPRVVAALG  213

Query  679  YDNGFFAPGRCSK-PFGNCTEGNSATEPYIVTHNLLLS  789
            YDNG  APGRC+K P G    G+S TEPYI THN++LS
Sbjct  214  YDNGLHAPGRCTKCPAG----GDSRTEPYIATHNIILS  247



>ref|XP_008665263.1| PREDICTED: beta-glucosidase 7-like [Zea mays]
 tpg|DAA50883.1| TPA: hypothetical protein ZEAMMB73_196159 [Zea mays]
Length=506

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGTATSAYQVEGAA    GRGPS WD F+  PG    N T +V+VDQ
Sbjct  34   GGLSRAAFPKDFVFGTATSAYQVEGAASTN-GRGPSTWDAFVHTPGNIVYNQTADVAVDQ  92

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRY+ED+DL+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPYA
Sbjct  93   YHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLRKGITPYA  152

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL H DLP ALQ++Y GWL+ ++ + F DYA+FCFKTFGDRVK+WF+FNEPR+VA LGYD
Sbjct  153  NLYHSDLPLALQNKYGGWLNAKMAKLFTDYADFCFKTFGDRVKHWFTFNEPRIVALLGYD  212

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C+  GNSATEPYIV HN LLS
Sbjct  213  AGSIPPQRCTK----CSAGGNSATEPYIVAHNFLLS  244



>gb|ABF98425.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
Length=298

 Score =   300 bits (769),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 171/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGTATSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  36   GGLSRAAFPKRFVFGTATSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  94

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  95   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  154

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  155  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  214

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  215  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  246



>emb|CBI33559.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +1

Query  238  GRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPN  417
            GRGP IWD ++K PG    N T +V+VDQYHRYKED+D++  LNF+AYRFSISWSRIFP 
Sbjct  6    GRGPCIWDPYVKIPGNIAENGTADVAVDQYHRYKEDLDIMKILNFDAYRFSISWSRIFPE  65

Query  418  GTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYA  597
            GTGKVNW+GVAYYNRLINYMLK+GI PYANL HYDLP  LQ++YNG L RR+VEDFA+YA
Sbjct  66   GTGKVNWEGVAYYNRLINYMLKKGIIPYANLYHYDLPLVLQEKYNGLLSRRIVEDFANYA  125

Query  598  EFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHN  777
            EFCFKTFGDRVK+W +FNEPRV+AALG+DNG   P RCSK FGNCT GNS+TEPYI  HN
Sbjct  126  EFCFKTFGDRVKHWTTFNEPRVIAALGFDNGINPPSRCSKAFGNCTAGNSSTEPYIAAHN  185

Query  778  LLLS  789
            +LLS
Sbjct  186  MLLS  189



>dbj|BAJ90056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 171/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEG A    GRGPSIWD F   PG    N   +V+ DQ
Sbjct  31   GGLSRASFPKGFVFGTATSAYQVEGMATGG-GRGPSIWDAFAHVPGNIAGNQNADVTTDQ  89

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+  LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LINY+L++GITPY 
Sbjct  90   YHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNQEGVAYYNNLINYLLQKGITPYI  149

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ + V  FADYA+FCFKTFGDRVK+WF+FNEPR+VA LGYD
Sbjct  150  NLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNEPRIVALLGYD  209

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RCSK    CT  GNSATEPYIV HN LL+
Sbjct  210  VGSNPPQRCSK----CTAGGNSATEPYIVAHNFLLA  241



>ref|XP_004982055.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Setaria italica]
Length=503

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 172/215 (80%), Gaps = 6/215 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEGAA    GRGPSIWD F   PG+   N  G+V+VDQ
Sbjct  33   GGLSRASFPKGFVFGTATSAYQVEGAASTN-GRGPSIWDAFAHIPGKVAGNQNGDVAVDQ  91

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++G+TPY 
Sbjct  92   YHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLQKGMTPYI  151

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL  ++ + F +Y +FCFKT+GDRVK+WF+FNEPR+VA LGYD
Sbjct  152  NLYHYDLPLALEQKYGGWLSSKMADLFTEYVDFCFKTYGDRVKHWFTFNEPRIVALLGYD  211

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLL  786
             G   P RC+K    C   GNSATEPYIV HN LL
Sbjct  212  AGSNPPQRCTK----CAAGGNSATEPYIVAHNFLL  242



>ref|XP_004982056.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Setaria italica]
Length=502

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 172/215 (80%), Gaps = 6/215 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEGAA    GRGPSIWD F   PG+   N  G+V+VDQ
Sbjct  33   GGLSRASFPKGFVFGTATSAYQVEGAASTN-GRGPSIWDAFAHIPGKVAGNQNGDVAVDQ  91

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED+DL+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++G+TPY 
Sbjct  92   YHRYKEDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYNNLINYLLQKGMTPYI  151

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL  ++ + F +Y +FCFKT+GDRVK+WF+FNEPR+VA LGYD
Sbjct  152  NLYHYDLPLALEQKYGGWLSSKMADLFTEYVDFCFKTYGDRVKHWFTFNEPRIVALLGYD  211

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLL  786
             G   P RC+K    C   GNSATEPYIV HN LL
Sbjct  212  AGSNPPQRCTK----CAAGGNSATEPYIVAHNFLL  242



>ref|XP_003559510.1| PREDICTED: beta-glucosidase 8-like [Brachypodium distachyon]
Length=570

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 175/221 (79%), Gaps = 6/221 (3%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            A  DTGGLSRA+FPKGFVFGTA SA+QVEG A    GRGPSIWD F+  PG    N   +
Sbjct  36   AAVDTGGLSRAAFPKGFVFGTAASAFQVEGMAASG-GRGPSIWDPFVHTPGNIAGNGNAD  94

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+ D+YH YKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LI+Y++K+G
Sbjct  95   VTTDEYHHYKEDVELMKSLNFDAYRFSISWSRIFPDGEGRVNEEGVAYYNNLIDYVIKKG  154

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            + PY NLNHYD+P ALQ +Y+GWL  ++V  F+DYAEFCFKT+GDRV+NWF+FNEPR+VA
Sbjct  155  LIPYVNLNHYDIPLALQKKYDGWLSPKIVNIFSDYAEFCFKTYGDRVQNWFTFNEPRIVA  214

Query  670  ALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            ALG+D G   P RC+K    C   GNSATEPY V HN+LLS
Sbjct  215  ALGFDTGIDPPNRCTK----CAAGGNSATEPYTVVHNILLS  251



>gb|ADP02192.1| putative non-cyanogenic beta-glucosidase [Triticum aestivum]
Length=507

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEG A    GRGPSIWD F   PG    N   +V+ DQ
Sbjct  37   GGLSRASFPKGFVFGTATSAYQVEGMAAGG-GRGPSIWDAFAHVPGNIAGNQNADVTTDQ  95

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+  LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LINY+L++GITPY 
Sbjct  96   YHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGDGKVNKEGVAYYNNLINYLLQKGITPYI  155

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ + V  FADYA+FCFKTFGDRVK+WF+FNEPR+VA LGYD
Sbjct  156  NLYHYDLPLALEKKYGGWLNAKTVGLFADYADFCFKTFGDRVKHWFTFNEPRIVALLGYD  215

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RCSK    C   GNSATEPYIV HN LL+
Sbjct  216  VGSNPPQRCSK----CAAGGNSATEPYIVAHNFLLA  247



>gb|ABF98426.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
Length=387

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 171/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGTATSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  36   GGLSRAAFPKRFVFGTATSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  94

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  95   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  154

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  155  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  214

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  215  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  246



>ref|NP_001051013.1| Os03g0703000 [Oryza sativa Japonica Group]
 sp|Q75I93.1|BGL07_ORYSJ RecName: Full=Beta-glucosidase 7; Short=Os3bglu7; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07254.1| beta-glucosidase (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|AAX95519.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
 gb|ABF98423.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12927.1| Os03g0703000 [Oryza sativa Japonica Group]
 dbj|BAG94472.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30396.1| beta-glucosidase [Oryza sativa]
Length=504

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 171/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGTATSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  36   GGLSRAAFPKRFVFGTATSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  94

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  95   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  154

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  155  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  214

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  215  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  246



>ref|XP_006651730.1| PREDICTED: beta-glucosidase 7-like, partial [Oryza brachyantha]
Length=467

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 168/214 (79%), Gaps = 6/214 (3%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSRA+FPKGFVFGTATSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQYH
Sbjct  1    LSRAAFPKGFVFGTATSAYQVEGMAASG-GRGPSIWDDFAHTPGNVAGNQNGDVATDQYH  59

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L +GITPY NL
Sbjct  60   RYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLLKGITPYVNL  119

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLP AL+ +Y GWL  ++ + F +YA+FCFKTFGDRVK+WF+FNEPR+VA LGYD G
Sbjct  120  YHYDLPLALEKKYGGWLSTKMADLFTEYADFCFKTFGDRVKHWFTFNEPRIVALLGYDQG  179

Query  691  FFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
               P RC+K    C   GNSATEPYIV HN LLS
Sbjct  180  TNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  209



>dbj|BAK08154.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   293 bits (751),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 170/213 (80%), Gaps = 4/213 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSR SFPKGFVFGTA+SAYQVEG A K YGRGP IWDTF+KFPG  P+NAT  V+VD+YH
Sbjct  23   LSRDSFPKGFVFGTASSAYQVEGNALK-YGRGPCIWDTFLKFPGATPDNATANVTVDEYH  81

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFP+G G++N  GV YY+RLI+YML   ITPY  L
Sbjct  82   RYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVNYYHRLIDYMLANNITPYVVL  141

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLP+ L ++YNGWL  RVV DFA +A+FCFKT+GDRVKNWF+ NEPR++A  GY +G
Sbjct  142  YHYDLPEVLNNQYNGWLSPRVVPDFAAFADFCFKTYGDRVKNWFTINEPRMMAWHGYGDG  201

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FFAPGRC+   G    GNSATEPYI  H+L+L+
Sbjct  202  FFAPGRCT---GCRFGGNSATEPYIAGHHLILA  231



>ref|XP_010237292.1| PREDICTED: beta-glucosidase 38-like [Brachypodium distachyon]
Length=494

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 172/215 (80%), Gaps = 4/215 (2%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            G L+R SFPKGFVFGTA+SAYQVEG A K YGRGP IWDTF+KFPG  P+NAT  V+VD+
Sbjct  26   GDLNRDSFPKGFVFGTASSAYQVEGNALK-YGRGPCIWDTFLKFPGATPDNATANVTVDE  84

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRY +D+D +  + F+AYRFSISWSRIFP+G G++N  GV YY+RLINYML   ITPY 
Sbjct  85   YHRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLINYMLANKITPYV  144

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
             L HYDLP+ L ++YNGWL  RVV DF ++A+FCFKT+GDRVKNWF+ NEPR++A+ GY 
Sbjct  145  VLYHYDLPEVLNNQYNGWLSPRVVSDFGNFADFCFKTYGDRVKNWFTINEPRMMASHGYG  204

Query  685  NGFFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            +GFFAPGRC+   G    GNSATEPYI  H+LLLS
Sbjct  205  DGFFAPGRCT---GCRFGGNSATEPYITGHHLLLS  236



>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCN|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCO|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCO|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCT|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCT|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCU|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
 pdb|3SCU|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
Length=481

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  13   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  71

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  72   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  131

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  132  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  191

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  192  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  223



>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCR|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCS|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCS|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  13   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  71

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  72   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  131

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  132  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  191

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  192  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  223



>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCV|B Chain B, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  13   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  71

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  72   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  131

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  132  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  191

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  192  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  223



>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGL|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
Length=481

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  13   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  71

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  72   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  131

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  132  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  191

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  192  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  223



>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCW|B Chain B, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  13   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  71

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  72   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  131

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  132  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  191

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  192  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  223



>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCP|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCQ|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCQ|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  13   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  71

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  72   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  131

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  132  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  191

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  192  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  223



>ref|XP_002464027.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
 gb|EER91025.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
Length=514

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSR +FP+GFVFGTATSAYQVEGAA    GRGPS WD F+  PG    N T +V+VDQ
Sbjct  43   GGLSRPAFPRGFVFGTATSAYQVEGAASTN-GRGPSTWDPFVHTPGNIVGNQTADVAVDQ  101

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRY+ED+DL+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYY  LI+Y+L++GITPYA
Sbjct  102  YHRYREDVDLMKSLNFDAYRFSISWSRIFPDGEGRVNPEGVAYYKNLISYLLQKGITPYA  161

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL H DLP ALQ++Y GWL+ ++ + F DYA+FCFK+FGD VK+WF+FNEPR+VA LGYD
Sbjct  162  NLYHSDLPLALQNKYGGWLNPKMAKLFTDYADFCFKSFGDHVKHWFTFNEPRIVALLGYD  221

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  222  GGSIPPQRCTK----CAAGGNSATEPYIVAHNFLLS  253



>gb|AAA84906.3| beta-glucosidase [Oryza sativa Japonica Group]
Length=504

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  36   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  94

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  95   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  154

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FNEPR+VA LGYD
Sbjct  155  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNEPRIVALLGYD  214

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  215  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  246



>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F4V|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3AHT|A Chain A, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHT|B Chain B, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHV|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
 pdb|3AHV|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
Length=481

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRA+FPK FVFGT TSAYQVEG A    GRGPSIWD F   PG    N  G+V+ DQ
Sbjct  13   GGLSRAAFPKRFVFGTVTSAYQVEGMAASG-GRGPSIWDAFAHTPGNVAGNQNGDVATDQ  71

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+ +LNF+AYRFSISWSRIFP+G G+VN +GVAYYN LINY+L++GITPY 
Sbjct  72   YHRYKEDVNLMKSLNFDAYRFSISWSRIFPDGEGRVNQEGVAYYNNLINYLLQKGITPYV  131

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ ++ + F +YA+FCFKTFG+RVK+WF+FN+PR+VA LGYD
Sbjct  132  NLYHYDLPLALEKKYGGWLNAKMADLFTEYADFCFKTFGNRVKHWFTFNQPRIVALLGYD  191

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LLS
Sbjct  192  QGTNPPKRCTK----CAAGGNSATEPYIVAHNFLLS  223



>ref|XP_003559509.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Brachypodium distachyon]
 ref|XP_010230912.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Brachypodium distachyon]
Length=510

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 166/216 (77%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEG A    GRGPSIWD F   PG    N   +V+ DQ
Sbjct  40   GGLSRASFPKGFVFGTATSAYQVEGMAASG-GRGPSIWDAFSHIPGNVVGNTNADVTTDQ  98

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+  LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LINY+L++GITPY 
Sbjct  99   YHRYKEDVNLMKGLNFDAYRFSISWSRIFPDGEGKVNEEGVAYYNNLINYLLQKGITPYI  158

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL H DLP AL+ +Y GWL  + VE FADYA+FCFKTFG+RVK+WF+ NEPR+   LGYD
Sbjct  159  NLYHADLPLALEKKYGGWLSAKTVELFADYADFCFKTFGNRVKHWFTLNEPRIACLLGYD  218

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN LL+
Sbjct  219  VGSTPPQRCTK----CAAGGNSATEPYIVAHNFLLA  250



>ref|XP_006832853.1| hypothetical protein AMTR_s00095p00054570, partial [Amborella 
trichopoda]
 gb|ERM98131.1| hypothetical protein AMTR_s00095p00054570, partial [Amborella 
trichopoda]
Length=205

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
             G  TGGLSR SFP GFVFGTATSAYQVEGAA K+ GRGPSIWD FI+ PG   +N TGE
Sbjct  30   GGVSTGGLSRESFPPGFVFGTATSAYQVEGAADKD-GRGPSIWDVFIRKPGVVADNGTGE  88

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            VSVD+YHRYKED+D++A++N +AYRFSISWSRIFP G G+VN +GV YYNRLI+Y+L+RG
Sbjct  89   VSVDEYHRYKEDVDIMADMNMDAYRFSISWSRIFPEGVGRVNQKGVDYYNRLIDYLLERG  148

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPR  660
            +TPYANL HYDLP+AL++ YNG L+RRVV+DFADYAEFCFKTFGDRVKNW +FNEP+
Sbjct  149  VTPYANLYHYDLPEALEESYNGLLNRRVVDDFADYAEFCFKTFGDRVKNWMTFNEPK  205



>emb|CDM83785.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 168/216 (78%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEG A    GRGPSIWD F   PG+   N   +V+ DQ
Sbjct  33   GGLSRASFPKGFVFGTATSAYQVEGMATGG-GRGPSIWDAFAHTPGKVVGNQNADVTTDQ  91

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+  LNFEAYRFSISWSRIFP+G GKVN +GVAYYN LI+Y+L++GITPY 
Sbjct  92   YHRYKEDVNLMKGLNFEAYRFSISWSRIFPDGEGKVNEEGVAYYNNLIDYLLQKGITPYV  151

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ + VE FADYA+FCFKTFGDRV +WF+FNEP  VA  GYD
Sbjct  152  NLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGDRVTHWFTFNEPSRVAIGGYD  211

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
                 P RC+K    C+  GNSATEPY+V HN LL+
Sbjct  212  IATTPPQRCTK----CSAGGNSATEPYVVGHNFLLA  243



>ref|XP_006664007.1| PREDICTED: beta-glucosidase 38-like [Oryza brachyantha]
Length=498

 Score =   295 bits (754),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 167/213 (78%), Gaps = 4/213 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+RASFP GFVFGTA+SAYQVEG A K YGRGP IWDTF+  PG+ P+NAT  V+VD+YH
Sbjct  32   LTRASFPLGFVFGTASSAYQVEGNALK-YGRGPCIWDTFLLHPGKTPDNATANVTVDEYH  90

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFP+G G++N  GV YY+RLI+YML   ITPY  L
Sbjct  91   RYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLIDYMLAHSITPYVAL  150

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLPQ L D+YNGWL  RVV DF  +A+FCFKT+G +VKNWF+ NEPR++A  GY +G
Sbjct  151  YHYDLPQVLHDQYNGWLHTRVVRDFVRFADFCFKTYGHKVKNWFTINEPRMMANHGYGDG  210

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            +FAPGRC+   G    GNSATEPYI  HNLLLS
Sbjct  211  YFAPGRCT---GCQFGGNSATEPYITAHNLLLS  240



>ref|XP_002979705.1| hypothetical protein SELMODRAFT_153534 [Selaginella moellendorffii]
 gb|EFJ19107.1| hypothetical protein SELMODRAFT_153534 [Selaginella moellendorffii]
Length=501

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 164/213 (77%), Gaps = 1/213 (0%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSR SFPKGFVFGTA++AYQ EGAA KE GRGPSIWD +   PG+  +  TG+V+VDQYH
Sbjct  26   LSRRSFPKGFVFGTASAAYQYEGAA-KEGGRGPSIWDVYAHTPGKIMDGTTGDVAVDQYH  84

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RYKED+ L+ ++  +AYRFSISWSRIFP G GK+N +GV YYN LIN +LK+GI PY  L
Sbjct  85   RYKEDVGLMVDMGVDAYRFSISWSRIFPEGRGKINQEGVDYYNNLINELLKKGIQPYVTL  144

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+D PQAL+D Y  WL  R+V+D+A YAE CF+ FGDRVK+W +FNEP VV   GY+ G
Sbjct  145  FHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKHWITFNEPHVVCNFGYNFG  204

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
              APGRCS   GNC+ GNS+ EPYIV H++LLS
Sbjct  205  MLAPGRCSSEVGNCSAGNSSVEPYIVGHHILLS  237



>ref|XP_003559508.1| PREDICTED: beta-glucosidase 7-like [Brachypodium distachyon]
Length=511

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 168/216 (78%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEG A    GRGPS+WD F   PG    N   +V+ DQ
Sbjct  41   GGLSRASFPKGFVFGTATSAYQVEGMAFSG-GRGPSVWDAFAHTPGNIVGNQNADVTTDQ  99

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YH YKED++L+  LNF+AYRFSISWSRIFP+G GKVN +GVAYYN LI+Y+L++GITPY 
Sbjct  100  YHHYKEDVNLMKGLNFDAYRFSISWSRIFPDGEGKVNEEGVAYYNNLIDYLLQKGITPYI  159

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ + VE FADYA+FCFKTFG+RVK+WF+FNEPR+V   GYD
Sbjct  160  NLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGNRVKHWFTFNEPRIVVLGGYD  219

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
             G   P RC+K    C   GNSATEPYIV HN +L+
Sbjct  220  VGSNPPQRCTK----CAAGGNSATEPYIVAHNFILA  251



>ref|XP_002988358.1| hypothetical protein SELMODRAFT_183841 [Selaginella moellendorffii]
 gb|EFJ10448.1| hypothetical protein SELMODRAFT_183841 [Selaginella moellendorffii]
Length=496

 Score =   292 bits (747),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 164/213 (77%), Gaps = 1/213 (0%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSR SFPKGFVFGTA++AYQ EGAA +E GRGPSIWD +   PG+  +  TG+V+VDQYH
Sbjct  21   LSRRSFPKGFVFGTASAAYQYEGAA-REGGRGPSIWDVYAHTPGKIMDGTTGDVAVDQYH  79

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RYKED+ L+ ++  +AYRFSISWSRIFP G GK+N +GV YYN LIN +LK+GI PY  L
Sbjct  80   RYKEDVGLMVDMGVDAYRFSISWSRIFPEGRGKINQEGVDYYNNLINELLKKGIQPYVTL  139

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+D PQAL+D Y  WL  R+V+D+A YAE CF+ FGDRVK+W +FNEP VV   GY+ G
Sbjct  140  FHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKHWITFNEPHVVCNFGYNFG  199

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
              APGRCS   GNC+ GNS+ EPYIV H++LLS
Sbjct  200  MLAPGRCSSEVGNCSAGNSSVEPYIVGHHILLS  232



>gb|EMS48652.1| Beta-glucosidase 7 [Triticum urartu]
Length=498

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 166/216 (77%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSRASFPKGFVFGTATSAYQVEG A    GRGPSIWD F   PG+   N   +V+ DQ
Sbjct  43   GGLSRASFPKGFVFGTATSAYQVEGMATGG-GRGPSIWDAFAHTPGKVVGNQNADVTTDQ  101

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHRYKED++L+  LNF+AYRFSISWSRIFP+  GKVN +GVAYYN LI+Y+L +GITPY 
Sbjct  102  YHRYKEDVNLMKGLNFDAYRFSISWSRIFPDSEGKVNEEGVAYYNNLIDYLLHKGITPYV  161

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
            NL HYDLP AL+ +Y GWL+ + VE FADYA+FCFKTFGDRV +WF+FNEP  VA  GYD
Sbjct  162  NLYHYDLPLALEKKYGGWLNAKTVELFADYADFCFKTFGDRVTHWFTFNEPSRVAIGGYD  221

Query  685  NGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
                 P RC+K    C+  GNSATEPYIV HN LL+
Sbjct  222  IATTPPQRCTK----CSAGGNSATEPYIVGHNFLLA  253



>gb|KCW52109.1| hypothetical protein EUGRSUZ_J01543 [Eucalyptus grandis]
Length=448

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = +1

Query  238  GRGPSIWDTFIKFPGREPNNATGEVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPN  417
            GRGPSIWD F++ PG      +GE++VDQYH+YKEDIDL+  LNF+AYRFSISWSRIFPN
Sbjct  6    GRGPSIWDAFVQVPGNIKELDSGEMAVDQYHKYKEDIDLMHKLNFDAYRFSISWSRIFPN  65

Query  418  GTGKVNWQGVAYYNRLINYMLKRGITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYA  597
            GTG VNW+GV YYNRLI+ ++ +GITPYANL HYD+P ALQ RY G L   VV+DFADYA
Sbjct  66   GTGYVNWRGVNYYNRLIDALIAKGITPYANLYHYDMPLALQLRYEGLLSINVVKDFADYA  125

Query  598  EFCFKTFGDRVKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTEGNSATEPYIVTHN  777
            EFCFKTFGDRVKNW +FNEPRV+AALG+D+G   P RCSKP+GNCT GNSATEPYI  H+
Sbjct  126  EFCFKTFGDRVKNWMTFNEPRVIAALGFDSGSNPPNRCSKPYGNCTAGNSATEPYIAAHH  185

Query  778  LLLS  789
            L+LS
Sbjct  186  LILS  189



>ref|XP_002438912.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
 gb|EER90279.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
Length=480

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 168/213 (79%), Gaps = 4/213 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSR +FP GFVFGTA+SAYQVEG   +++GRGPSIWDTF+K+PG  P+NAT +VSVD+Y 
Sbjct  42   LSRETFPPGFVFGTASSAYQVEGNT-RKFGRGPSIWDTFLKYPGTTPDNATADVSVDEYD  100

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFP+G G+VN  GV YY+RLI+YML   ITPY  L
Sbjct  101  RYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLIDYMLANHITPYVVL  160

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLPQ LQD+YNGWL  R+V DF  +A+FCFKT+GDRVK WF+ NEP++VA+ GY + 
Sbjct  161  YHYDLPQVLQDQYNGWLSPRIVPDFTAFADFCFKTYGDRVKFWFTINEPQMVASHGYGDA  220

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FF PGRC+   G    GNSATEPYI  H+LLLS
Sbjct  221  FFPPGRCT---GCYFGGNSATEPYIAGHHLLLS  250



>gb|ADP02193.1| Glyco_hydro_1 domain-containing protein [Triticum aestivum]
Length=587

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 177/235 (75%), Gaps = 23/235 (10%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            DTGGLSRASFPKGFVFGTATSA+QVEGAA    GRGPSIWD F+  PG    NA  +V+ 
Sbjct  25   DTGGLSRASFPKGFVFGTATSAFQVEGAAAAG-GRGPSIWDPFVHTPGNIAENANADVAT  83

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+YHRYKED+DLL +LNF+AYRFSISWSRIFP+G GKVN +GV YYN LI+Y+LK+G+TP
Sbjct  84   DEYHRYKEDVDLLKSLNFDAYRFSISWSRIFPDGEGKVNKEGVTYYNNLIDYVLKQGLTP  143

Query  499  YANLNHYDLPQALQDRYNGWLDRRVV-----------------EDFADYAEFCFKTFGDR  627
            Y NLNHYD+P ALQ +Y+G+L  ++                    FADYAEFCFKT+GDR
Sbjct  144  YVNLNHYDIPLALQKKYDGFLSPKIAFYKGQGALKHFSVFFCRNIFADYAEFCFKTYGDR  203

Query  628  VKNWFSFNEPRVVAALGYDNGFFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            +KNWF+FNEPR+VAALG+D G   P RC+K    C   GNSATEPY V HN+LLS
Sbjct  204  IKNWFTFNEPRIVAALGFDTGTNPPNRCTK----CAAGGNSATEPYTVVHNILLS  254



>ref|NP_001064347.1| Os10g0323500 [Oryza sativa Japonica Group]
 sp|Q339X2.1|BGL34_ORYSJ RecName: Full=Beta-glucosidase 34; Short=Os10bglu34; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABB47155.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26261.1| Os10g0323500 [Oryza sativa Japonica Group]
 dbj|BAG92457.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50740.1| hypothetical protein OsJ_31060 [Oryza sativa Japonica Group]
Length=510

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGL+R SFP GFVFGTA+SAYQ EGA  KE GRGP+IWD F    G+  + +  +V+VD
Sbjct  30   TGGLTRKSFPNGFVFGTASSAYQYEGAV-KEDGRGPTIWDKFAHTFGKIIDFSNADVAVD  88

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYHR++EDI L+A++  +AYRFSISWSRIFPNGTG+VN  G+ +YN+LIN +L +GI PY
Sbjct  89   QYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEPY  148

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
              L H+DLPQAL+D+Y GWLDR+++ D+A YAE CF+ FGDRVK+W +FNEP  VA   Y
Sbjct  149  VTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQAY  208

Query  682  DNGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
            D+G  APGRCS      C +GNS TEPYIV HN++LS
Sbjct  209  DSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILS  245



>gb|AAK92581.1|AC074354_15 Putative beta-glucosidase [Oryza sativa Japonica Group]
Length=515

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGL+R SFP GFVFGTA+SAYQ EGA  KE GRGP+IWD F    G+  + +  +V+VD
Sbjct  30   TGGLTRKSFPNGFVFGTASSAYQYEGAV-KEDGRGPTIWDKFAHTFGKIIDFSNADVAVD  88

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYHR++EDI L+A++  +AYRFSISWSRIFPNGTG+VN  G+ +YN+LIN +L +GI PY
Sbjct  89   QYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEPY  148

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
              L H+DLPQAL+D+Y GWLDR+++ D+A YAE CF+ FGDRVK+W +FNEP  VA   Y
Sbjct  149  VTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQAY  208

Query  682  DNGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
            D+G  APGRCS      C +GNS TEPYIV HN++LS
Sbjct  209  DSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILS  245



>ref|XP_010936327.1| PREDICTED: beta-glucosidase 6 isoform X2 [Elaeis guineensis]
Length=504

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 169/218 (78%), Gaps = 2/218 (1%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            D GGLSR SFP+GF+FGTA+SAYQ EGA  KE GRGP++WDTF    G+  + +  +V+V
Sbjct  23   DNGGLSRGSFPEGFIFGTASSAYQYEGAV-KEAGRGPTVWDTFAHSFGKVIDFSNADVAV  81

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            DQYHR+ ED+ L++++  +AYRFSI+WSRIFPNGTG+VN  G+ +YN+LIN +L +GI P
Sbjct  82   DQYHRFVEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  141

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            Y  L H+DLPQALQD+YNGWLDR++++D+A+YAE CF+ FGDRV +W +FNEP   A  G
Sbjct  142  YVTLYHWDLPQALQDKYNGWLDRQIIKDYANYAETCFREFGDRVTHWITFNEPHTFAIQG  201

Query  679  YDNGFFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
            YD G  APGRCS      C  GNSATEPYIV HN+LLS
Sbjct  202  YDVGLQAPGRCSIILRLFCRAGNSATEPYIVGHNVLLS  239



>gb|EEC66726.1| hypothetical protein OsI_33062 [Oryza sativa Indica Group]
Length=510

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            TGGL+R SFP GFVFGTA+SAYQ EGA  KE GRGP+IWD F    G+  + +  +V+VD
Sbjct  30   TGGLTRKSFPNGFVFGTASSAYQYEGAV-KEDGRGPTIWDKFAHTFGKIIDFSNADVAVD  88

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYHR++EDI L+A++  +AYRFSI+WSRIFPNGTG+VN  G+ +YN+LIN +L +GI PY
Sbjct  89   QYHRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEPY  148

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
              L H+DLPQAL+D+Y GWLDR+++ D+A YAE CF+ FGDRVK+W +FNEP  VA   Y
Sbjct  149  VTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPHTVAVQAY  208

Query  682  DNGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
            D+G  APGRCS      C +GNS TEPYIV HN++LS
Sbjct  209  DSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILS  245



>ref|XP_010936326.1| PREDICTED: beta-glucosidase 6 isoform X1 [Elaeis guineensis]
Length=504

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 169/218 (78%), Gaps = 2/218 (1%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            D GGLSR SFP+GFVFGTA+S+YQ EGA  KE GRGP++WDTF    G+  + +  +V+V
Sbjct  23   DDGGLSRGSFPEGFVFGTASSSYQYEGAV-KEAGRGPTVWDTFAHSFGKVIDFSNADVAV  81

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            DQYHR+ ED+ L++++  +AYRFSI+WSRIFPNGTG+VN  G+ +YN+LIN +L +GI P
Sbjct  82   DQYHRFVEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEP  141

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            Y  L H+DLPQALQD+YNGWLDR++++D+A+YAE CF+ FGDRV +W +FNEP   A  G
Sbjct  142  YVTLYHWDLPQALQDKYNGWLDRQIIKDYANYAETCFREFGDRVTHWITFNEPHTFAIQG  201

Query  679  YDNGFFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
            YD G  APGRCS      C  GNSATEPYIV HN+LLS
Sbjct  202  YDVGLQAPGRCSIILRLFCRAGNSATEPYIVGHNVLLS  239



>ref|XP_006661692.1| PREDICTED: beta-glucosidase 34-like [Oryza brachyantha]
Length=509

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +1

Query  148  GLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQY  327
            GL+R SFPKGFVFGTA+SAYQ EGA  KE GRGP+IWD F    G+  + +  +V+VDQY
Sbjct  31   GLTRGSFPKGFVFGTASSAYQYEGAV-KEDGRGPAIWDKFAHTFGKIIDFSNADVAVDQY  89

Query  328  HRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYAN  507
            HR++EDI L+A++  +AYRFSI+WSRIFPNGTG++N  G+ +YN+LIN +L +GI PY  
Sbjct  90   HRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGQINQAGIDHYNKLINALLAKGIEPYVT  149

Query  508  LNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDN  687
            L H+DLPQAL+D+Y GWLDR+++ D+A YAE CFK FGDRVK+W +FNEP  VA   YD+
Sbjct  150  LYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFKAFGDRVKHWITFNEPHTVAVQAYDS  209

Query  688  GFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
            G  APGRCS      C +GNS TEPYIV HN++LS
Sbjct  210  GMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILS  244



>gb|EEC69164.1| hypothetical protein OsI_38122 [Oryza sativa Indica Group]
Length=492

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 163/214 (76%), Gaps = 6/214 (3%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R +FP GFVFGTA+SAYQVEG A K YGRGP IWDTF+  PG  P+N+T  V+VD+YH
Sbjct  26   LTRETFPAGFVFGTASSAYQVEGNALK-YGRGPCIWDTFLMQPGVTPDNSTANVTVDEYH  84

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFP+G GK+N  GV YY+RLI+YML   I PY  L
Sbjct  85   RYMDDVDNMVRVGFDAYRFSISWSRIFPSGLGKINKDGVDYYHRLIDYMLANNIIPYVVL  144

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLPQ L D+Y GWL  R+V DF  YA+FCFKT+G +VKNWF+ NEPR++A  GY +G
Sbjct  145  YHYDLPQVLHDQYKGWLHPRIVRDFVRYADFCFKTYGHKVKNWFTINEPRMMANHGYGDG  204

Query  691  FFAPGRCSKPFGNCTE-GNSATEPYIVTHNLLLS  789
            FF PGRC+    +C   GNSATEPYI  HNLLLS
Sbjct  205  FFPPGRCT----SCQPGGNSATEPYIAAHNLLLS  234



>gb|EMS63424.1| Beta-glucosidase 38 [Triticum urartu]
Length=490

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSR SFPKGFVFGTA+SAYQVEG + K YGRGP IWDTF+K+PG  P+NAT  V+VD+YH
Sbjct  23   LSRDSFPKGFVFGTASSAYQVEGNSLK-YGRGPCIWDTFLKYPGATPDNATANVTVDEYH  81

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFPNG G++N  GV YY+RLI+YML   ITPY  L
Sbjct  82   RYMDDVDNMVRVGFDAYRFSISWSRIFPNGIGRINKDGVDYYHRLIDYMLANNITPYVVL  141

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLP+ L ++YNGWL  RVV DF  +A+FCFKT+GDRVKNWF+ NEPR++A  GY +G
Sbjct  142  YHYDLPEVLNNQYNGWLSPRVVPDFTAFADFCFKTYGDRVKNWFTINEPRMMAWHGYGDG  201

Query  691  FFAPGRCSKPFGNCTEGNSATEPYI  765
            FFAPGRC+   G    GNSATEPYI
Sbjct  202  FFAPGRCT---GCRFGGNSATEPYI  223



>ref|XP_001753376.1| predicted protein [Physcomitrella patens]
 gb|EDQ81599.1| predicted protein [Physcomitrella patens]
Length=499

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 162/213 (76%), Gaps = 1/213 (0%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            + RASFPKGF+FGTAT+AYQ EGAA  E G+GPSIWDTF   PG+   N TG+++VDQYH
Sbjct  31   VERASFPKGFIFGTATAAYQYEGAA-SEGGKGPSIWDTFSHQPGKIQGNGTGDIAVDQYH  89

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY ED+ LL +LN EAYRFSISW R+FP GTG VNW+GV YY+ LI+ +LK GI PY  L
Sbjct  90   RYVEDVWLLKDLNMEAYRFSISWPRVFPKGTGVVNWEGVKYYDNLISELLKLGIEPYVTL  149

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+D+PQAL+D   GWL  ++VE FA YA FCF+ +G +VK+W +FNE    A  GY  G
Sbjct  150  YHWDMPQALEDSIGGWLSPQIVEPFARYARFCFERWGTKVKHWITFNEIHSFAGAGYYTG  209

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
              APGRCS P+GNC++GNS TEPYIV+H+ LLS
Sbjct  210  VMAPGRCSAPYGNCSQGNSLTEPYIVSHHALLS  242



>ref|XP_004963948.1| PREDICTED: beta-glucosidase 38-like [Setaria italica]
Length=499

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 165/209 (79%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  DTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSV  318
            D G L+R +FP GFVFGTA+SAYQVEG   K YGRGP IWDTF+K+PG  P+N+T  V+V
Sbjct  30   DHGNLTRQAFPPGFVFGTASSAYQVEGNTLK-YGRGPCIWDTFLKYPGTTPDNSTANVTV  88

Query  319  DQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITP  498
            D+Y+RY +D+D +  + F+AYRFSISWSRIFP+G G++N  GV YY+RLINY+++  ITP
Sbjct  89   DEYNRYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRINKDGVDYYHRLINYLIESHITP  148

Query  499  YANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALG  678
            Y  L HYDLPQ LQD+YNGWL  R+VEDF  +A+FCFKT+GDRVKNWF+ NEPR++AA G
Sbjct  149  YVVLYHYDLPQVLQDQYNGWLSPRIVEDFTKFADFCFKTYGDRVKNWFTINEPRMMAAHG  208

Query  679  YDNGFFAPGRCSKPFGNCTEGNSATEPYI  765
            Y +GFF P RC+   G    GNSATEPYI
Sbjct  209  YGDGFFPPARCT---GCHFGGNSATEPYI  234



>ref|NP_001066656.1| Os12g0420100 [Oryza sativa Japonica Group]
 sp|Q2QSR8.2|BGL38_ORYSJ RecName: Full=Beta-glucosidase 38; Short=Os12bglu38; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA97621.2| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29675.1| Os12g0420100 [Oryza sativa Japonica Group]
 dbj|BAG92285.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53109.1| hypothetical protein OsJ_35886 [Oryza sativa Japonica Group]
Length=492

 Score =   284 bits (726),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 162/213 (76%), Gaps = 4/213 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R +FP GFVFGTA+SAYQVEG A  +YGRGP IWDTF+  PG  P+N+T  V+VD+YH
Sbjct  26   LTRETFPAGFVFGTASSAYQVEGNA-LQYGRGPCIWDTFLMQPGVTPDNSTANVTVDEYH  84

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFP+G GK+N  GV YY+RLI+YML   I PY  L
Sbjct  85   RYMDDVDNMVRVGFDAYRFSISWSRIFPSGLGKINKDGVDYYHRLIDYMLANNIIPYVVL  144

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLPQ L D+Y GWL  R+V DF  +A+FCFKT+G +VKNWF+ NEPR++A  GY +G
Sbjct  145  YHYDLPQVLHDQYKGWLHPRIVRDFVRFADFCFKTYGHKVKNWFTINEPRMMANHGYGDG  204

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
            FF PGRC+   G    GNSATEPYI  HNLLLS
Sbjct  205  FFPPGRCT---GCQPGGNSATEPYIAAHNLLLS  234



>ref|XP_009416570.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=505

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            +GGLSR SFPKGFVFGTA+S+YQ EGA  KE GRG ++WD F    G+  + +  +V+VD
Sbjct  25   SGGLSRGSFPKGFVFGTASSSYQYEGAV-KEDGRGRTVWDAFAHSFGKVIDFSNADVAVD  83

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYHRY EDI L+ ++  +AYRFSI+WSRIFPNGTG VN  G+ +YN+LI+ +L  GI PY
Sbjct  84   QYHRYHEDIQLMKDMGMDAYRFSIAWSRIFPNGTGVVNQAGIDHYNKLIDALLANGIEPY  143

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
              L H+DLPQAL DRYNGWLDR+++ED+A+YAE CFK FGDRVK+W + NEP   A  G+
Sbjct  144  VTLYHWDLPQALADRYNGWLDRQIIEDYANYAETCFKAFGDRVKHWMTLNEPHTFAVQGF  203

Query  682  DNGFFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
            D G  APGRCS P    C  GNSATEPY+V HN+LLS
Sbjct  204  DVGLQAPGRCSIPLLLFCRAGNSATEPYVVAHNVLLS  240



>tpg|DAA44055.1| TPA: hypothetical protein ZEAMMB73_095768 [Zea mays]
Length=404

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFPKGFVFGTA +AYQ EGA  K  GRG +IWDTF    G+  + +  +V+VDQYH
Sbjct  45   LTRGSFPKGFVFGTAAAAYQYEGAV-KTDGRGQTIWDTFAHTFGKISDFSNADVAVDQYH  103

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            R++ED+ L+A++  +AYRFSI+WSRI PNGTG+VN  G+ +YN++IN +L +GI PY  L
Sbjct  104  RFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYVTL  163

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWLDR++V DFA YAE CFK FGDRVK+W + NEP  VA  GYD G
Sbjct  164  YHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAVQGYDAG  223

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNS TEPYIV HN +L+
Sbjct  224  LHAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILA  257



>ref|XP_010109366.1| Beta-glucosidase 40 [Morus notabilis]
 gb|EXC22071.1| Beta-glucosidase 40 [Morus notabilis]
Length=500

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 165/214 (77%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            ++R SFPKGFVFGTA+SAYQ EGA  KE GRGPS+WDTF    G+  + +  +V+VDQYH
Sbjct  27   INRGSFPKGFVFGTASSAYQYEGAV-KEDGRGPSVWDTFAHTFGKIIDLSNADVAVDQYH  85

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY+ED+ L+ ++  +AYRFSISWSRIFPNGTG++N  GV YYN+LIN +L +GI PY  L
Sbjct  86   RYEEDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDYYNKLINALLAKGIEPYVTL  145

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+D+Y GWLDR+V++DFA +AE CF+ FGDRVK+W +FNE   VA  GYD G
Sbjct  146  YHWDLPQALEDKYKGWLDRQVIKDFALFAETCFQQFGDRVKHWITFNEAYTVAVQGYDVG  205

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNS+TEPYIV HN+LLS
Sbjct  206  LQAPGRCSILLHLLCRAGNSSTEPYIVGHNILLS  239



>ref|XP_002465651.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
 gb|EER92649.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
Length=508

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 162/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGL+R SFPKGFVFGTA +AYQ EGA   + GRG +IWDTF    G+  + +  +V+VDQ
Sbjct  28   GGLTRGSFPKGFVFGTAAAAYQYEGAVTTD-GRGRTIWDTFAHTFGKISDFSNADVAVDQ  86

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHR++ED+ L+A++  +AYRFSI+WSRI PNGTG+VN  G+ +YN++IN +L +GI PY 
Sbjct  87   YHRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYV  146

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
             L H+DLPQAL+DRYNGWLDR++V DFA YAE CFK FGDRVK+W + NEP  VA  GYD
Sbjct  147  TLYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAIQGYD  206

Query  685  NGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
             G  APGRCS      C  GNS TEPYIV HN +L+
Sbjct  207  AGLHAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILA  242



>ref|XP_002988359.1| hypothetical protein SELMODRAFT_127964 [Selaginella moellendorffii]
 gb|EFJ10449.1| hypothetical protein SELMODRAFT_127964 [Selaginella moellendorffii]
Length=494

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 161/213 (76%), Gaps = 3/213 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            LSR SFPKGFVFGTA++AYQ EGAA KE GRGPSIWD +   PG+  +  TG+V+VDQYH
Sbjct  21   LSRRSFPKGFVFGTASAAYQYEGAA-KEGGRGPSIWDVYAHTPGKIMDGTTGDVAVDQYH  79

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RYKED+ L+ ++  +AYRFSISW   FP   GK+N +GVAYYN LIN +LK+GI PY  L
Sbjct  80   RYKEDVGLMVDMGVDAYRFSISWVSDFP--WGKINQEGVAYYNNLINELLKKGIQPYVTL  137

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+D PQAL+D Y  WL  R+V+D+A YAE CF+ FGDRVK+W +FNEP VV   GY+ G
Sbjct  138  FHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKHWITFNEPHVVCNFGYNFG  197

Query  691  FFAPGRCSKPFGNCTEGNSATEPYIVTHNLLLS  789
              APGRCS   GNC+ GNS+ EPYIV H++LLS
Sbjct  198  MLAPGRCSSEVGNCSAGNSSVEPYIVGHHILLS  230



>gb|KJB80346.1| hypothetical protein B456_013G093000 [Gossypium raimondii]
Length=391

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = +1

Query  130  AGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGE  309
            AGF +  +S+ASFPKGF+FGTA+SA+Q EGA  KE GRGP+IWDTF    G+  + +  +
Sbjct  21   AGF-SQNISKASFPKGFIFGTASSAFQYEGAV-KEDGRGPTIWDTFSHTFGKILDGSNAD  78

Query  310  VSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRG  489
            V+VDQYHRY EDI L+ ++  +AYRFSI+WSRIFPNGTG++N  GV +YN  IN +L  G
Sbjct  79   VAVDQYHRYPEDIQLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNFINALLAAG  138

Query  490  ITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVA  669
            I PY  L H+DLPQAL+D+YNGWLD ++++DFA YAE CFK FGDRVK W +FNEP    
Sbjct  139  IQPYVTLYHWDLPQALEDKYNGWLDPQIIKDFAMYAETCFKLFGDRVKYWMTFNEPDTFT  198

Query  670  ALGYDNGFFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
              GYD G  APGRCS      C  GNS TEPYIV HN+LLS
Sbjct  199  VQGYDVGLQAPGRCSIVLHLFCKAGNSGTEPYIVAHNVLLS  239



>ref|XP_009406319.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=505

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSR SFP+GFVFGTA+S+YQ EGA  +E GRG ++WDTF    G+  + +  +V+VDQ
Sbjct  26   GGLSRGSFPQGFVFGTASSSYQYEGAV-EEDGRGKTVWDTFAHSFGKVIDFSNADVAVDQ  84

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHR+ +DI L+A++  +AYRFSI+WSRI PNG G+VN  G+ +YN  IN +L +GI PY 
Sbjct  85   YHRFHDDIQLMADMGMDAYRFSIAWSRILPNGAGEVNQAGIDHYNEEINALLAKGIQPYV  144

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
             L H+DLPQALQDRYNGW+DR+++EDFA+YAE CFK FGDRVK+W +FNEP   A  GYD
Sbjct  145  TLYHWDLPQALQDRYNGWIDRQIIEDFANYAEICFKAFGDRVKHWITFNEPHTFAIQGYD  204

Query  685  NGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
             G  APGRCS      C  GNSATEPY V H++LLS
Sbjct  205  VGLHAPGRCSTLLHFLCRAGNSATEPYTVAHHVLLS  240



>ref|XP_008658980.1| PREDICTED: uncharacterized protein LOC100502286 isoform X2 [Zea 
mays]
Length=453

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFPKGFVFGTA+SAYQ EGA  KE GRG +IWD F    G+  + +  +V+VDQYH
Sbjct  31   LTRGSFPKGFVFGTASSAYQYEGAV-KEDGRGKTIWDKFAHTFGKVADLSNADVAVDQYH  89

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            R++EDI L+A++  +AYRFSI+WSRI PNGTG+VN  GV +YNR I+ +L +GI PY  L
Sbjct  90   RFEEDIQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGVDHYNRFIDALLSKGIEPYVTL  149

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWLDR++V DFA+YAE CF+ FGDRV++W + NEP  VA  GYD G
Sbjct  150  YHWDLPQALEDRYNGWLDRQIVYDFAEYAETCFEAFGDRVRHWVTLNEPHTVAVQGYDAG  209

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  G+SATEPY+V HN +L+
Sbjct  210  LQAPGRCSLLLHLYCRSGDSATEPYVVAHNFILA  243



>ref|XP_008389423.1| PREDICTED: beta-glucosidase 40-like [Malus domestica]
Length=511

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 167/222 (75%), Gaps = 2/222 (1%)
 Frame = +1

Query  127  PAGFDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATG  306
            P       ++R SFPKGFVFGTA+SA+Q EGA  KE GRGPSIWDTF    G+  +++  
Sbjct  22   PTCLSDSDINRGSFPKGFVFGTASSAFQYEGAV-KEDGRGPSIWDTFSHTFGKIADSSNA  80

Query  307  EVSVDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKR  486
            +V+VD+YHRYKED+  + ++  +AYRFSISW+RIFPNGTG +N  GV YYNRLI+ +L +
Sbjct  81   DVAVDEYHRYKEDVQRMKDMGMDAYRFSISWTRIFPNGTGHINQAGVDYYNRLIDALLAK  140

Query  487  GITPYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVV  666
            GI PY  L H+DLPQAL+D+Y+GWL+ +V++DFA YA+ CF+ FGDRVK+W +FNEP   
Sbjct  141  GIEPYVTLYHWDLPQALEDKYSGWLNPQVIKDFATYADACFQNFGDRVKHWITFNEPHTF  200

Query  667  AALGYDNGFFAPGRCSKP-FGNCTEGNSATEPYIVTHNLLLS  789
            +  GYD G  APGRCS P F  C  GNSATEPY+V HN++LS
Sbjct  201  SIQGYDVGLEAPGRCSIPLFLFCRAGNSATEPYMVAHNVILS  242



>ref|XP_010551390.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
 ref|XP_010551391.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
Length=515

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 165/216 (76%), Gaps = 6/216 (3%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            + R SFP+GFVFGTA+SA+Q EGA  KE GRGPS+WDTF    G+  +++  +V+VDQYH
Sbjct  35   IGRGSFPEGFVFGTASSAFQYEGAV-KEDGRGPSVWDTFSHAFGKIVDSSNADVAVDQYH  93

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY+ED+ L+ N+  +AYRFSISWSRIFPNGTG++N  G+ +YN+LIN +L +GI PY  L
Sbjct  94   RYEEDVQLMKNMGMDAYRFSISWSRIFPNGTGQINQAGIDHYNKLINALLAKGIQPYVTL  153

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWL  +++ DFA YAE CFK FGDRVK+W +FNEP   A  GYD G
Sbjct  154  YHWDLPQALEDRYNGWLSPQIINDFAIYAEVCFKNFGDRVKHWITFNEPHNFAIQGYDVG  213

Query  691  FFAPGRCS---KPFGNCTEGNSATEPYIVTHNLLLS  789
              APGRCS   K F  C  GNS+TEPYIV HN+LLS
Sbjct  214  LQAPGRCSILLKLF--CRVGNSSTEPYIVAHNVLLS  247



>ref|XP_004985213.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=520

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 161/214 (75%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFPKGFVFGTA +AYQ EGA  K  GRG +IWDTF    G+  + +  +V+VDQYH
Sbjct  42   LTRGSFPKGFVFGTAAAAYQYEGAV-KVDGRGQTIWDTFAHTFGKISDFSNADVAVDQYH  100

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            R++ED+ L+A++  +AYRFSI+WSRIFPNGTG+VN  G+ +YN++IN +L +GI PY  L
Sbjct  101  RFQEDVQLMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKVINALLSKGIQPYVTL  160

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWLDR++V DFA YAE CFK FGDRVK+W + NEP  VA  GYD G
Sbjct  161  YHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITINEPHTVAVQGYDAG  220

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNS TEPYIV HN +L+
Sbjct  221  LHAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILA  254



>ref|XP_007045908.1| Beta glucosidase 40 isoform 2 [Theobroma cacao]
 gb|EOY01740.1| Beta glucosidase 40 isoform 2 [Theobroma cacao]
Length=413

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            +SRASFPKGFVFGTA+S++Q EGA  KE GRGP+IWD F    G+  + +  +V+VDQYH
Sbjct  29   ISRASFPKGFVFGTASSSFQYEGAV-KEDGRGPTIWDKFSHTFGKIIDGSNADVAVDQYH  87

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY EDI L+ ++  +AYRFSI+WSRIFPNGTG++N  GV +YN LIN +L +GI PY  L
Sbjct  88   RYTEDIRLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNLINALLAKGIEPYVTL  147

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWL+ ++++DFA +AE CF+ FGDRVK+W +FNEP      GYD G
Sbjct  148  YHWDLPQALEDRYNGWLNPQIIKDFAMFAETCFQIFGDRVKHWITFNEPHTFTVQGYDVG  207

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNSATEPYIV HN+LLS
Sbjct  208  LQAPGRCSIILRLICKAGNSATEPYIVAHNVLLS  241



>gb|AFW89226.1| hypothetical protein ZEAMMB73_293984 [Zea mays]
Length=436

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFPKGFVFGTA+SAYQ EGA  KE GRG +IWD F    G+  + +  +V+VDQYH
Sbjct  31   LTRGSFPKGFVFGTASSAYQYEGAV-KEDGRGKTIWDKFAHTFGKVADLSNADVAVDQYH  89

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            R++EDI L+A++  +AYRFSI+WSRI PNGTG+VN  GV +YNR I+ +L +GI PY  L
Sbjct  90   RFEEDIQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGVDHYNRFIDALLSKGIEPYVTL  149

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWLDR++V DFA+YAE CF+ FGDRV++W + NEP  VA  GYD G
Sbjct  150  YHWDLPQALEDRYNGWLDRQIVYDFAEYAETCFEAFGDRVRHWVTLNEPHTVAVQGYDAG  209

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  G+SATEPY+V HN +L+
Sbjct  210  LQAPGRCSLLLHLYCRSGDSATEPYVVAHNFILA  243



>ref|XP_009356385.1| PREDICTED: beta-glucosidase 40 [Pyrus x bretschneideri]
Length=511

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 164/214 (77%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            ++R SFPKGFVFGTA+SA+Q EGA  KE GRGPSIWDTF    G+  +++  +V+VD+YH
Sbjct  30   INRGSFPKGFVFGTASSAFQYEGAV-KEDGRGPSIWDTFSHTFGKIADSSNADVAVDEYH  88

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RYKED+  + ++  +AYRFSISW+RIFPNGTG +N  GV YYNRLI+ +L +GI PY  L
Sbjct  89   RYKEDVQRMKDMGMDAYRFSISWTRIFPNGTGHINQAGVDYYNRLIDALLAKGIEPYVTL  148

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+D+Y GWL+ +V++DFA YAE CF+ FGDRVK+W +FNEP   +  GYD G
Sbjct  149  YHWDLPQALEDKYRGWLNPQVIKDFATYAEACFQNFGDRVKHWITFNEPHTFSIQGYDVG  208

Query  691  FFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
              APGRCS P    C  GNSATEPYIV HN++LS
Sbjct  209  LEAPGRCSIPLLLFCRAGNSATEPYIVAHNVILS  242



>ref|XP_006484173.1| PREDICTED: beta-glucosidase 40-like [Citrus sinensis]
Length=506

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            ++RASFPKGFVFGTA+SA+Q EGA  KE GRGP++WDTF    G+  +N+  +V+VDQYH
Sbjct  28   INRASFPKGFVFGTASSAFQYEGAV-KEDGRGPTVWDTFSHTFGKILDNSNADVAVDQYH  86

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY ED+ L+ ++  +AYRFSI+WSRIFPNGTG++N  GV +YN+LI+ +L +GI PY  L
Sbjct  87   RYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAKGIEPYVTL  146

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL D+Y GWLDR+++ DFA YAE CF+ FGDRVK+W +FNEP      GYD G
Sbjct  147  YHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTFTIQGYDVG  206

Query  691  FFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNSATEPYIV HN LL+
Sbjct  207  LQAPGRCSILLHLFCRAGNSATEPYIVAHNALLT  240



>ref|XP_006437961.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
 gb|ESR51201.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
Length=506

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            ++RASFPKGFVFGTA+SA+Q EGA  KE GRGP++WDTF    G+  +N+  +V+VDQYH
Sbjct  28   INRASFPKGFVFGTASSAFQYEGAV-KEDGRGPTVWDTFSHTFGKILDNSNADVAVDQYH  86

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY ED+ L+ ++  +AYRFSI+WSRIFPNGTG++N  GV +YN+LI+ +L +GI PY  L
Sbjct  87   RYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAKGIEPYVTL  146

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL D+Y GWLDR+++ DFA YAE CF+ FGDRVK+W +FNEP      GYD G
Sbjct  147  YHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTFTIQGYDVG  206

Query  691  FFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNSATEPYIV HN LL+
Sbjct  207  LQAPGRCSILLHLFCRAGNSATEPYIVAHNALLT  240



>ref|XP_010446113.1| PREDICTED: putative beta-glucosidase 41 [Camelina sativa]
Length=336

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 160/215 (74%), Gaps = 4/215 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            +SRA+FP GFVFGTA+SAYQ EGA  KE  +G SIWDTF K PG+  + +  + +VDQYH
Sbjct  30   ISRANFPDGFVFGTASSAYQFEGAV-KEGNKGESIWDTFTKKPGKILDFSNADTTVDQYH  88

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            R+  DIDL+ +L+ +AYRFSISWSRIFPNGTGKVN  GV YYN LI+ +L +GI PY  L
Sbjct  89   RFHSDIDLMKDLSMDAYRFSISWSRIFPNGTGKVNPDGVKYYNSLIDALLVKGIKPYVTL  148

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRY GWL R VV+DF  YA  CFK FGDRVK W +FNEP  ++  GYD G
Sbjct  149  YHWDLPQALEDRYEGWLSREVVDDFERYAFTCFKAFGDRVKYWVTFNEPHGLSIQGYDTG  208

Query  691  FFAPGRCSKPFGN--CTEGNSATEPYIVTHNLLLS  789
              APGRCS   G+  C +G S+ EPY+V HN+LLS
Sbjct  209  IQAPGRCSL-LGHWFCKKGTSSVEPYVVAHNILLS  242



>ref|XP_009406318.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=506

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 165/216 (76%), Gaps = 2/216 (1%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            GGLSR+SFP+GFVFGTA+S+YQ EGA  +E G+G ++WD F    G+  + +  +V+VDQ
Sbjct  27   GGLSRSSFPEGFVFGTASSSYQYEGAV-EEDGKGRTVWDVFAHTFGKVIDFSNADVAVDQ  85

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHR+ EDI L+ ++  +AYRFSI+WSRIFPNGTG+VN  G+ +YN+LIN +L  GI PY 
Sbjct  86   YHRFDEDILLMKDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLANGIEPYV  145

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
             L H+DLPQAL+DRY+GW+D R+++D+ADYAE CFK FGDRVK+W +FNEP   A  GYD
Sbjct  146  TLYHWDLPQALEDRYDGWIDPRIIQDYADYAETCFKAFGDRVKHWMTFNEPHTFAIQGYD  205

Query  685  NGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
             G  APGRCS      C  GNSATEPYIV HN+LLS
Sbjct  206  VGLQAPGRCSAFLRLLCRAGNSATEPYIVAHNVLLS  241



>ref|XP_009631811.1| PREDICTED: beta-glucosidase 40 [Nicotiana tomentosiformis]
Length=505

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            +    +SR +FPKGFVFGTA+SAYQ EGA  KE GRGP+IWD F    G+  + + G+V+
Sbjct  23   YSAQNISRNNFPKGFVFGTASSAYQFEGAV-KEDGRGPTIWDKFSHSFGKVVDFSNGDVA  81

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYH+Y EDI L+ ++  +AYRFSI+W+RIFPNGTG++N  GV +YN+LIN +L  GI 
Sbjct  82   VDQYHQYPEDIQLMKDMGMDAYRFSIAWTRIFPNGTGEINQAGVDHYNKLINALLANGIQ  141

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PY  L H+DLPQAL+D+YNGWL  ++++DFA YAE CF+ FGDRVKNW + NEP  VA  
Sbjct  142  PYVTLYHWDLPQALEDKYNGWLSPQIIKDFAIYAETCFQKFGDRVKNWITINEPHTVAIQ  201

Query  676  GYDNGFFAPGRCS---KPFGNCTEGNSATEPYIVTHNLLLS  789
            G+D G  APGRCS   K F  C  GNSATEPYIVTHNLLL+
Sbjct  202  GFDVGLQAPGRCSILLKVF--CRAGNSATEPYIVTHNLLLA  240



>ref|XP_010066854.1| PREDICTED: beta-glucosidase 40 [Eucalyptus grandis]
 gb|KCW64896.1| hypothetical protein EUGRSUZ_G02458 [Eucalyptus grandis]
Length=511

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = +1

Query  148  GLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQY  327
             + R+SFPKGFVFGTA+SA+Q EGA  KE GRGPS+WDTF    G+  + +  +V+VDQY
Sbjct  31   AIGRSSFPKGFVFGTASSAFQYEGAV-KEDGRGPSVWDTFSHQFGKVIDLSNADVAVDQY  89

Query  328  HRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYAN  507
            HR+ EDI L+ ++  +AYRFSISWSRIFPNG+G++N  GV +YN LIN +L +GI PY  
Sbjct  90   HRFNEDIQLMKDMGMDAYRFSISWSRIFPNGSGQINQAGVDHYNNLINALLAKGIEPYVT  149

Query  508  LNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDN  687
            L H+DLPQAL+D+YNGWLD ++++DFA YAE CF+ FGDRVK+W +FNEP  +A  GYD 
Sbjct  150  LFHWDLPQALEDKYNGWLDPQIIKDFATYAETCFQKFGDRVKHWVTFNEPHTLAIQGYDV  209

Query  688  GFFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
            G  APGRCS      C  GNSATEPYIV HN+LLS
Sbjct  210  GLQAPGRCSILLHLFCRAGNSATEPYIVGHNILLS  244



>ref|XP_004985215.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=512

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            G L+R SFP+GFVFGTA+SAYQ EGA  KE GRG + WDTF    G+  + +  +V++D 
Sbjct  33   GALTRGSFPEGFVFGTASSAYQYEGAV-KEDGRGKTTWDTFAHTFGKVADFSNADVAIDH  91

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHR++EDI L+A++  +AYRFSI+WSRI PNG G+VN  G+ +YN+LI+ +L +GI PY 
Sbjct  92   YHRFEEDIQLMADMGMDAYRFSIAWSRILPNGIGQVNQAGIDHYNKLIDALLAKGIEPYV  151

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
             L H+DLPQAL+DRYNGWLDR+++ DFA YAE CFK FGDRVK+W + NEP  VA  GYD
Sbjct  152  TLYHWDLPQALEDRYNGWLDRQIINDFAAYAEICFKAFGDRVKHWITLNEPHTVAIQGYD  211

Query  685  NGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
            +G  APGRCS      C  GNS TEPYIV HN +L+
Sbjct  212  DGLQAPGRCSLLLHLYCKAGNSGTEPYIVAHNFILA  247



>gb|AFW69221.1| hypothetical protein ZEAMMB73_365784 [Zea mays]
Length=502

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFP GFVFGTA+SAYQVEG   + YGRGP IWDTF+K+PG  P+NAT +V+VD+Y+
Sbjct  36   LNRQSFPPGFVFGTASSAYQVEGNTHR-YGRGPCIWDTFLKYPGTTPDNATADVTVDEYN  94

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFP+G G+VN  GV YY+RLINY+L   ITPY  L
Sbjct  95   RYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLINYLLANHITPYVVL  154

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLPQ LQD+YNGWL  R++ DF  +A+FCFKT+GDRVKNWF+ NEPR++A  GY +G
Sbjct  155  YHYDLPQVLQDQYNGWLSPRILGDFTAFADFCFKTYGDRVKNWFTINEPRMMAQHGYGDG  214

Query  691  FFAPGRCSKPFGNCTEGNSATEPYI  765
            FF P RC+   G    GNSATEPYI
Sbjct  215  FFPPARCT---GCQFGGNSATEPYI  236



>ref|XP_004985214.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=512

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 164/216 (76%), Gaps = 2/216 (1%)
 Frame = +1

Query  145  GGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQ  324
            G L+R SFP+GFVFGTA SAYQ EGA  KE GRG +IWDTF    G+  + +  +V+VDQ
Sbjct  30   GELTRGSFPEGFVFGTAASAYQYEGAV-KEDGRGQTIWDTFAHTLGKISDFSNADVAVDQ  88

Query  325  YHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYA  504
            YHR+++DI+L+A++  +AYRFSI+WSRIFPNGTG+VN  G+ +YN+LI+ +L + I PY 
Sbjct  89   YHRFEDDIELMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKLIDALLSKEIEPYV  148

Query  505  NLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYD  684
             L H+DLPQAL+DRY GWL+R +VEDFA YAE CFK FGDRVK+W + NEP  VA +GYD
Sbjct  149  TLYHWDLPQALEDRYKGWLNRTIVEDFAVYAETCFKAFGDRVKHWITLNEPHTVATMGYD  208

Query  685  NGFFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
             G  APGRCS     +C  G+S TEPYIV HN +L+
Sbjct  209  TGLEAPGRCSVLLHLHCRSGDSHTEPYIVGHNFILA  244



>ref|XP_008644530.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=523

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFPKGFVFGTA +AYQ EGA  K  GRG +IWDTF    G+  + +  +V+VDQYH
Sbjct  45   LTRGSFPKGFVFGTAAAAYQYEGAV-KTDGRGQTIWDTFAHTFGKISDFSNADVAVDQYH  103

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            R++ED+ L+A++  +AYRFSI+WSRI PNGTG+VN  G+ +YN++IN +L +GI PY  L
Sbjct  104  RFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYVTL  163

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWLDR++V DFA YAE CFK FGDRVK+W + NEP  VA  GYD G
Sbjct  164  YHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAVQGYDAG  223

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNS TEPYIV HN +L+
Sbjct  224  LHAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILA  257



>ref|XP_008658979.1| PREDICTED: uncharacterized protein LOC100502286 isoform X1 [Zea 
mays]
 gb|AFW89227.1| hypothetical protein ZEAMMB73_293984 [Zea mays]
Length=508

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFPKGFVFGTA+SAYQ EGA  KE GRG +IWD F    G+  + +  +V+VDQYH
Sbjct  31   LTRGSFPKGFVFGTASSAYQYEGAV-KEDGRGKTIWDKFAHTFGKVADLSNADVAVDQYH  89

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            R++EDI L+A++  +AYRFSI+WSRI PNGTG+VN  GV +YNR I+ +L +GI PY  L
Sbjct  90   RFEEDIQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGVDHYNRFIDALLSKGIEPYVTL  149

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWLDR++V DFA+YAE CF+ FGDRV++W + NEP  VA  GYD G
Sbjct  150  YHWDLPQALEDRYNGWLDRQIVYDFAEYAETCFEAFGDRVRHWVTLNEPHTVAVQGYDAG  209

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  G+SATEPY+V HN +L+
Sbjct  210  LQAPGRCSLLLHLYCRSGDSATEPYVVAHNFILA  243



>ref|XP_008644990.1| PREDICTED: beta-glucosidase 38-like [Zea mays]
Length=552

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            L+R SFP GFVFGTA+SAYQVEG   + YGRGP IWDTF+K+PG  P+NAT +V+VD+Y+
Sbjct  86   LNRQSFPPGFVFGTASSAYQVEGNTHR-YGRGPCIWDTFLKYPGTTPDNATADVTVDEYN  144

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY +D+D +  + F+AYRFSISWSRIFP+G G+VN  GV YY+RLINY+L   ITPY  L
Sbjct  145  RYMDDVDNMVRVGFDAYRFSISWSRIFPSGIGRVNKDGVDYYHRLINYLLANHITPYVVL  204

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             HYDLPQ LQD+YNGWL  R++ DF  +A+FCFKT+GDRVKNWF+ NEPR++A  GY +G
Sbjct  205  YHYDLPQVLQDQYNGWLSPRILGDFTAFADFCFKTYGDRVKNWFTINEPRMMAQHGYGDG  264

Query  691  FFAPGRCSKPFGNCTEGNSATEPYI  765
            FF P RC+   G    GNSATEPYI
Sbjct  265  FFPPARCT---GCQFGGNSATEPYI  286



>ref|XP_010521462.1| PREDICTED: beta-glucosidase 40-like isoform X2 [Tarenaya hassleriana]
Length=507

 Score =   276 bits (707),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            ++RASFP GFVFGTA++A+Q EGA  KE GRGPS+WDTF    G+  + +  +V+VDQYH
Sbjct  28   INRASFPNGFVFGTASAAFQYEGAV-KEDGRGPSVWDTFSHTLGKIADFSNADVAVDQYH  86

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY+EDI L+ N+  +AYRFSISW+RIFPNGTG++N  G+ +YN+LIN +L +GI PY  L
Sbjct  87   RYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGIQPYVTL  146

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL DRYNGWL  +++ D+A YAE CF+ FGDRVK+W +FNEP   A  GYD G
Sbjct  147  YHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAIQGYDVG  206

Query  691  FFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNSATEPYIV HN+LLS
Sbjct  207  LQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLS  240



>ref|XP_009802933.1| PREDICTED: beta-glucosidase 40-like [Nicotiana sylvestris]
Length=505

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +1

Query  136  FDTGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVS  315
            +    +SR +FPKGFVFGTA+SAYQ EGA  KE GRGP+IWD F    G+  + + G+V+
Sbjct  23   YSAQNISRNNFPKGFVFGTASSAYQFEGAV-KEDGRGPTIWDKFSHSFGKVLDFSNGDVA  81

Query  316  VDQYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGIT  495
            VDQYH+Y EDI L+ ++  +AYRFSI+W+RIFPNG+G++N  GV +YN+LIN +L  GI 
Sbjct  82   VDQYHKYPEDIQLMKDMGMDAYRFSIAWTRIFPNGSGEINQAGVDHYNKLINALLANGIQ  141

Query  496  PYANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  675
            PY  L H+DLPQAL+D+YNGWL  ++++DFA YAE CF+ FGDRVKNW + NEP  VA  
Sbjct  142  PYVTLYHWDLPQALEDKYNGWLSPQIIKDFAIYAETCFQKFGDRVKNWITINEPHTVAIQ  201

Query  676  GYDNGFFAPGRCS---KPFGNCTEGNSATEPYIVTHNLLLS  789
            G+D G  APGRCS   K F  C  GNSATEPYIVTHNLLL+
Sbjct  202  GFDVGLQAPGRCSILLKIF--CRAGNSATEPYIVTHNLLLA  240



>ref|XP_007045907.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
 gb|EOY01739.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
Length=506

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +1

Query  151  LSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQYH  330
            +SRASFPKGFVFGTA+S++Q EGA  KE GRGP+IWD F    G+  + +  +V+VDQYH
Sbjct  29   ISRASFPKGFVFGTASSSFQYEGAV-KEDGRGPTIWDKFSHTFGKIIDGSNADVAVDQYH  87

Query  331  RYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYANL  510
            RY EDI L+ ++  +AYRFSI+WSRIFPNGTG++N  GV +YN LIN +L +GI PY  L
Sbjct  88   RYTEDIRLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNLINALLAKGIEPYVTL  147

Query  511  NHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDNG  690
             H+DLPQAL+DRYNGWL+ ++++DFA +AE CF+ FGDRVK+W +FNEP      GYD G
Sbjct  148  YHWDLPQALEDRYNGWLNPQIIKDFAMFAETCFQIFGDRVKHWITFNEPHTFTVQGYDVG  207

Query  691  FFAPGRCSKPFG-NCTEGNSATEPYIVTHNLLLS  789
              APGRCS      C  GNSATEPYIV HN+LLS
Sbjct  208  LQAPGRCSIILRLICKAGNSATEPYIVAHNVLLS  241



>ref|XP_009418476.1| PREDICTED: beta-glucosidase 25-like [Musa acuminata subsp. malaccensis]
Length=532

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +1

Query  148  GLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVDQY  327
             + R  FP GFVFGTA+SAYQ EGAAG E  RG SIWDTF + PGR  + +  +V+VDQY
Sbjct  41   AIRRDDFPSGFVFGTASSAYQFEGAAG-EGNRGKSIWDTFTRRPGRILDFSNADVAVDQY  99

Query  328  HRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPYAN  507
            HRYK D+DL+  +  +AYRFSISWSRIFPNGTG+ N +G++YYNRLI+ +L++GI PY  
Sbjct  100  HRYKSDVDLMKGMGMDAYRFSISWSRIFPNGTGEPNQEGISYYNRLIDTLLQKGIQPYVT  159

Query  508  LNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDN  687
            L H+DLPQAL+DRYNGWL + +++DF  YA  CFK FGDRVK+W +FNEP   +  GYD 
Sbjct  160  LFHWDLPQALEDRYNGWLSQEIIQDFKHYAYTCFKAFGDRVKHWITFNEPHGFSIQGYDT  219

Query  688  GFFAPGRCSKPFGN-CTEGNSATEPYIVTHNLLLS  789
            G  APGRCS      C  G S+ EPYIV HN+LLS
Sbjct  220  GLQAPGRCSILIHMLCRRGKSSIEPYIVAHNILLS  254



>ref|XP_010910032.1| PREDICTED: beta-glucosidase 25 isoform X4 [Elaeis guineensis]
Length=409

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 163/217 (75%), Gaps = 2/217 (1%)
 Frame = +1

Query  142  TGGLSRASFPKGFVFGTATSAYQVEGAAGKEYGRGPSIWDTFIKFPGREPNNATGEVSVD  321
            T  L+RA FP  FVFGTA+SA+Q EGA   E  RG SIWDTF + PGR  + +  E++VD
Sbjct  17   TEALTRADFPSDFVFGTASSAFQFEGAV-NEGKRGDSIWDTFTRRPGRILDFSNAEIAVD  75

Query  322  QYHRYKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWQGVAYYNRLINYMLKRGITPY  501
            QYHRYK D+DL+ ++  +AYRFSISWSRIFPNGTG+ N +G+++YN LI+ +L++G+ PY
Sbjct  76   QYHRYKTDVDLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQPY  135

Query  502  ANLNHYDLPQALQDRYNGWLDRRVVEDFADYAEFCFKTFGDRVKNWFSFNEPRVVAALGY  681
              L H+DLPQ+L+DRY+GWL R++VEDF  YA  CF+TFGDRVK+W +FNEP   +  GY
Sbjct  136  VTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYARTCFETFGDRVKHWITFNEPHGFSIQGY  195

Query  682  DNGFFAPGRCS-KPFGNCTEGNSATEPYIVTHNLLLS  789
            D G  APGRCS      C +G S+TEPYIV HN+LLS
Sbjct  196  DTGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLS  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570