BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041I08

Length=806
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243213.1|  PREDICTED: protein VACUOLELESS1                    463   3e-154   Solanum lycopersicum
ref|XP_006348963.1|  PREDICTED: vacuolar protein sorting-associat...    460   6e-153   
ref|XP_009625096.1|  PREDICTED: protein VACUOLELESS1                    459   1e-152   Nicotiana tomentosiformis
ref|XP_009790374.1|  PREDICTED: protein VACUOLELESS1                    455   5e-151   Nicotiana sylvestris
ref|XP_010271338.1|  PREDICTED: protein VACUOLELESS1 isoform X2         424   5e-141   
ref|XP_010681470.1|  PREDICTED: protein VACUOLELESS1                    427   2e-140   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010271337.1|  PREDICTED: protein VACUOLELESS1 isoform X1         427   4e-140   Nelumbo nucifera [Indian lotus]
emb|CDP06151.1|  unnamed protein product                                419   2e-137   Coffea canephora [robusta coffee]
gb|EYU33990.1|  hypothetical protein MIMGU_mgv1a001320mg                416   5e-136   Erythranthe guttata [common monkey flower]
gb|EPS58563.1|  hypothetical protein M569_16250                         392   3e-134   Genlisea aurea
ref|XP_011082899.1|  PREDICTED: protein VACUOLELESS1                    406   4e-132   Sesamum indicum [beniseed]
ref|XP_002283428.1|  PREDICTED: protein VACUOLELESS1                    406   4e-132   Vitis vinifera
ref|XP_004144632.1|  PREDICTED: vacuolar protein sorting-associat...    401   3e-130   Cucumis sativus [cucumbers]
ref|XP_008465445.1|  PREDICTED: protein VACUOLELESS1                    397   8e-129   Cucumis melo [Oriental melon]
ref|XP_008342344.1|  PREDICTED: protein VACUOLELESS1                    394   2e-127   Malus domestica [apple tree]
gb|ABF69968.1|  vacuolar protein sorting 16 (VPS16) family protein      375   3e-127   Musa acuminata [banana]
ref|XP_004303883.1|  PREDICTED: protein VACUOLELESS1 isoform X2         394   3e-127   Fragaria vesca subsp. vesca
ref|XP_011467591.1|  PREDICTED: protein VACUOLELESS1 isoform X1         394   8e-127   Fragaria vesca subsp. vesca
ref|XP_008229565.1|  PREDICTED: protein VACUOLELESS1                    390   5e-126   Prunus mume [ume]
ref|XP_008811095.1|  PREDICTED: protein VACUOLELESS1                    389   2e-125   Phoenix dactylifera
ref|XP_007214933.1|  hypothetical protein PRUPE_ppa001364mg             389   2e-125   Prunus persica
ref|XP_010087860.1|  Vacuolar protein sorting-associated protein ...    384   1e-123   Morus notabilis
gb|KCW89755.1|  hypothetical protein EUGRSUZ_A02017                     381   2e-123   Eucalyptus grandis [rose gum]
ref|XP_003551927.1|  PREDICTED: vacuolar protein sorting-associat...    382   5e-123   
ref|XP_004499978.1|  PREDICTED: vacuolar protein sorting-associat...    382   6e-123   Cicer arietinum [garbanzo]
ref|XP_010053830.1|  PREDICTED: protein VACUOLELESS1                    382   1e-122   Eucalyptus grandis [rose gum]
ref|XP_003532091.1|  PREDICTED: vacuolar protein sorting-associat...    379   1e-121   Glycine max [soybeans]
ref|XP_009416537.1|  PREDICTED: protein VACUOLELESS1                    379   1e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003599782.1|  Vacuolar protein sorting-associated protein-...    379   2e-121   
gb|KEH16900.1|  vacuolar protein sorting-associated-like protein        379   2e-121   Medicago truncatula
gb|AES70033.2|  vacuolar protein sorting-associated-like protein        379   2e-121   Medicago truncatula
ref|XP_010918871.1|  PREDICTED: protein VACUOLELESS1                    375   2e-120   Elaeis guineensis
ref|XP_007146219.1|  hypothetical protein PHAVU_006G022400g             375   3e-120   Phaseolus vulgaris [French bean]
ref|XP_010557595.1|  PREDICTED: protein VACUOLELESS1                    371   2e-118   Tarenaya hassleriana [spider flower]
gb|KJB10620.1|  hypothetical protein B456_001G211500                    365   4e-118   Gossypium raimondii
gb|KHG27227.1|  Vacuolar sorting-associated protein 16                  367   2e-117   Gossypium arboreum [tree cotton]
gb|KJB10619.1|  hypothetical protein B456_001G211500                    366   2e-117   Gossypium raimondii
gb|KJB10617.1|  hypothetical protein B456_001G211500                    366   4e-117   Gossypium raimondii
gb|KJB10618.1|  hypothetical protein B456_001G211500                    367   6e-117   Gossypium raimondii
gb|KJB10616.1|  hypothetical protein B456_001G211500                    367   1e-116   Gossypium raimondii
ref|XP_007048987.1|  Vacuoleless1 (VCL1) isoform 3                      364   3e-116   
ref|XP_007048986.1|  Vacuoleless1 (VCL1) isoform 2                      363   7e-116   
ref|XP_007048985.1|  Vacuoleless1 (VCL1) isoform 1                      364   1e-115   
ref|XP_011026232.1|  PREDICTED: protein VACUOLELESS1-like isoform X1    360   2e-114   Populus euphratica
ref|XP_002302135.2|  MANGLED family protein                             360   2e-114   
ref|XP_006411003.1|  hypothetical protein EUTSA_v10016232mg             360   3e-114   Eutrema salsugineum [saltwater cress]
ref|XP_011044765.1|  PREDICTED: protein VACUOLELESS1-like               356   8e-113   Populus euphratica
emb|CDY07756.1|  BnaA03g17550D                                          356   9e-113   Brassica napus [oilseed rape]
gb|KDO51890.1|  hypothetical protein CISIN_1g003205mg                   352   1e-112   Citrus sinensis [apfelsine]
ref|XP_002306748.1|  MANGLED family protein                             355   1e-112   
ref|XP_010505412.1|  PREDICTED: protein VACUOLELESS1-like               353   9e-112   Camelina sativa [gold-of-pleasure]
ref|XP_006296131.1|  hypothetical protein CARUB_v10025283mg             353   1e-111   Capsella rubella
ref|XP_006437140.1|  hypothetical protein CICLE_v10030701mg             352   1e-111   Citrus clementina [clementine]
gb|KDO51887.1|  hypothetical protein CISIN_1g003205mg                   352   2e-111   Citrus sinensis [apfelsine]
ref|XP_009133226.1|  PREDICTED: protein VACUOLELESS1                    352   2e-111   Brassica rapa
emb|CDY14496.1|  BnaC03g20990D                                          352   3e-111   Brassica napus [oilseed rape]
ref|XP_010509236.1|  PREDICTED: protein VACUOLELESS1                    352   5e-111   Camelina sativa [gold-of-pleasure]
ref|XP_002881559.1|  hypothetical protein ARALYDRAFT_321506             347   2e-109   Arabidopsis lyrata subsp. lyrata
gb|KDP24238.1|  hypothetical protein JCGZ_26643                         347   3e-109   Jatropha curcas
ref|NP_565879.1|  vacuoleless1                                          346   6e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078020.1|  vacuoleless1                                       345   6e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517084.1|  PREDICTED: protein VACUOLELESS1-like               345   8e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002526647.1|  vacuolar protein sorting vps16, putative           337   1e-105   Ricinus communis
ref|XP_006854657.1|  hypothetical protein AMTR_s00030p00200210          333   7e-104   Amborella trichopoda
ref|XP_009377216.1|  PREDICTED: LOW QUALITY PROTEIN: protein VACU...    315   3e-97    Pyrus x bretschneideri [bai li]
dbj|BAJ33734.1|  unnamed protein product                                312   4e-96    Eutrema halophilum
ref|XP_001777594.1|  predicted protein                                  281   1e-84    
ref|XP_002963395.1|  hypothetical protein SELMODRAFT_80688              274   7e-82    
ref|XP_002974680.1|  hypothetical protein SELMODRAFT_101752             272   3e-81    
ref|NP_001043804.2|  Os01g0666800                                       192   1e-55    
gb|ERZ97236.1|  hypothetical protein GLOINDRAFT_334475                  198   2e-54    
emb|CDM83584.1|  unnamed protein product                                189   4e-53    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97322.1|  predicted protein                                      194   5e-53    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010232114.1|  PREDICTED: protein VACUOLELESS1                    191   6e-52    Brachypodium distachyon [annual false brome]
ref|XP_005650736.1|  vacuolar protein sorting-associated protein 16     191   1e-51    Coccomyxa subellipsoidea C-169
gb|EEE55144.1|  hypothetical protein OsJ_02938                          191   1e-51    Oryza sativa Japonica Group [Japonica rice]
gb|KFH65750.1|  hypothetical protein MVEG_07854                         189   4e-51    Mortierella verticillata NRRL 6337
dbj|BAB90498.1|  vacuolar protein sorting-associated protein VPS1...    189   4e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969467.1|  PREDICTED: vacuolar protein sorting-associat...    186   5e-50    Setaria italica
ref|XP_004345413.1|  vacuolar assembling/sorting protein VPS16          184   3e-49    Capsaspora owczarzaki ATCC 30864
emb|CEG71651.1|  hypothetical protein RMATCC62417_07353                 182   8e-49    Rhizopus microsporus
emb|CEP18375.1|  hypothetical protein                                   180   5e-48    Parasitella parasitica
dbj|GAN01171.1|  vacuolar protein sorting vps16 protein                 179   1e-47    Mucor ambiguus
gb|AFW83494.1|  hypothetical protein ZEAMMB73_114694                    178   2e-47    
ref|XP_006646183.1|  PREDICTED: vacuolar protein sorting-associat...    179   2e-47    Oryza brachyantha
ref|XP_008656726.1|  PREDICTED: protein VACUOLELESS1                    178   4e-47    Zea mays [maize]
ref|XP_002456108.1|  hypothetical protein SORBIDRAFT_03g030590          173   2e-45    
ref|XP_005839798.1|  hypothetical protein GUITHDRAFT_161084             172   5e-45    Guillardia theta CCMP2712
ref|XP_004340672.1|  vacuolar protein sorting 16, putative              166   6e-43    Acanthamoeba castellanii str. Neff
ref|XP_006682562.1|  hypothetical protein BATDEDRAFT_14644              165   8e-43    Batrachochytrium dendrobatidis JAM81
emb|CDH59927.1|  vacuolar protein sorting vps16                         156   1e-39    Lichtheimia corymbifera JMRC:FSU:9682
emb|CEJ04541.1|  Putative Vacuolar protein sorting vps16                153   5e-39    Rhizopus microsporus
gb|EPB85961.1|  hypothetical protein HMPREF1544_07293                   154   8e-39    Mucor circinelloides f. circinelloides 1006PhL
emb|CEI87038.1|  hypothetical protein RMCBS344292_01458                 153   1e-38    Rhizopus microsporus
ref|XP_646623.2|  hypothetical protein DDB_G0270754                     151   2e-37    Dictyostelium discoideum AX4
emb|CDS07252.1|  hypothetical protein LRAMOSA01201                      139   1e-33    Lichtheimia ramosa
ref|XP_002621281.1|  vacuolar protein sorting vps16                     138   5e-33    Blastomyces gilchristii SLH14081
ref|XP_003287306.1|  hypothetical protein DICPUDRAFT_32286              138   7e-33    Dictyostelium purpureum
emb|CCJ28605.1|  unnamed protein product                                137   7e-33    Pneumocystis jirovecii
gb|EQL37787.1|  hypothetical protein BDFG_00836                         137   7e-33    Blastomyces dermatitidis ATCC 26199
ref|XP_007873550.1|  hypothetical protein PNEG_01594                    137   1e-32    Pneumocystis murina B123
emb|CEG84394.1|  hypothetical protein RMATCC62417_18203                 130   5e-32    Rhizopus microsporus
gb|KEQ63929.1|  vacuolar protein sorting-associated protein 16          134   9e-32    Aureobasidium melanogenum CBS 110374
gb|KIW64485.1|  hypothetical protein PV04_09414                         134   1e-31    Phialophora americana
gb|EER38773.1|  vacuolar sorting protein                                131   9e-31    Histoplasma capsulatum H143
ref|XP_007728315.1|  hypothetical protein A1O1_09269                    131   1e-30    Capronia coronata CBS 617.96
gb|KFX91659.1|  hypothetical protein V490_05796                         131   1e-30    Pseudogymnoascus sp. VKM F-3557
gb|KIW86230.1|  hypothetical protein Z517_01625                         131   1e-30    Fonsecaea pedrosoi CBS 271.37
ref|XP_009153640.1|  hypothetical protein HMPREF1120_01377              131   1e-30    Exophiala dermatitidis NIH/UT8656
gb|KFY40837.1|  hypothetical protein V495_05238                         130   2e-30    Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|EGC44404.1|  vacuolar sorting-associated protein                     130   2e-30    Histoplasma capsulatum H88
ref|XP_007733017.1|  hypothetical protein A1O3_04699                    130   2e-30    Capronia epimyces CBS 606.96
gb|KFY04377.1|  hypothetical protein O988_00818                         130   2e-30    Pseudogymnoascus sp. VKM F-3808
gb|EEH09936.1|  vacuolar sorting-associated protein                     130   2e-30    Histoplasma capsulatum G186AR
gb|KIV93309.1|  hypothetical protein PV10_04533                         130   3e-30    Exophiala mesophila
ref|XP_001542324.1|  conserved hypothetical protein                     130   3e-30    Histoplasma capsulatum NAm1
gb|KFY19049.1|  hypothetical protein V491_04616                         129   4e-30    Pseudogymnoascus sp. VKM F-3775
ref|XP_008730333.1|  hypothetical protein G647_07799                    129   5e-30    Cladophialophora carrionii CBS 160.54
gb|KIY03984.1|  hypothetical protein Z520_00676                         129   6e-30    Fonsecaea multimorphosa CBS 102226
gb|KFY18957.1|  hypothetical protein V493_08231                         129   7e-30    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_001259325.1|  vacuolar protein sorting vps16, putative           129   7e-30    Aspergillus fischeri NRRL 181
gb|KEY77885.1|  vacuolar protein sorting vps16                          129   8e-30    Aspergillus fumigatus var. RP-2014
ref|XP_008712782.1|  hypothetical protein HMPREF1541_09888              129   8e-30    Cyphellophora europaea CBS 101466
gb|KEQ75501.1|  vacuolar protein sorting-associated protein 16          129   8e-30    Aureobasidium namibiae CBS 147.97
gb|KEQ96076.1|  hypothetical protein AUEXF2481DRAFT_64917               129   9e-30    Aureobasidium subglaciale EXF-2481
gb|KIW38854.1|  hypothetical protein PV06_08684                         129   1e-29    Exophiala oligosperma
ref|XP_753294.1|  vacuolar protein sorting vps16                        128   1e-29    Aspergillus fumigatus Af293
gb|KFZ12341.1|  hypothetical protein V502_07139                         129   1e-29    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY86286.1|  hypothetical protein V500_07738                         128   1e-29    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KIW33525.1|  hypothetical protein PV07_00366                         128   1e-29    Cladophialophora immunda
gb|KFY99509.1|  hypothetical protein V498_00707                         127   2e-29    Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|KFY51994.1|  hypothetical protein V496_08707                         127   2e-29    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KIW21568.1|  hypothetical protein PV08_02148                         127   2e-29    Exophiala spinifera
gb|KIW03814.1|  hypothetical protein PV09_05114                         127   2e-29    Verruconis gallopava
ref|XP_002848487.1|  vacuolar protein sorting-associated protein        127   2e-29    Microsporum canis CBS 113480
gb|KEQ80575.1|  vacuolar protein sorting-associated protein 16          127   3e-29    Aureobasidium pullulans EXF-150
ref|XP_007750426.1|  hypothetical protein A1O5_11664                    127   5e-29    Cladophialophora psammophila CBS 110553
gb|KFZ05975.1|  hypothetical protein V501_07859                         127   5e-29    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY11799.1|  hypothetical protein V492_04262                         126   5e-29    Pseudogymnoascus sp. VKM F-4246
gb|KFY39836.1|  hypothetical protein V494_03792                         126   5e-29    Pseudogymnoascus sp. VKM F-4513 (FW-928)
dbj|GAD99952.1|  vacuolar protein sorting vps16                         126   5e-29    Byssochlamys spectabilis No. 5
gb|KFY80059.1|  hypothetical protein V499_01034                         127   6e-29    Pseudogymnoascus sp. VKM F-103
gb|KEF53480.1|  hypothetical protein A1O9_10455                         126   6e-29    Exophiala aquamarina CBS 119918
ref|XP_007839731.1|  hypothetical protein PFICI_12959                   126   6e-29    Pestalotiopsis fici W106-1
dbj|GAM90669.1|  hypothetical protein ANO11243_087140                   126   7e-29    fungal sp. No.11243
gb|KIW90849.1|  hypothetical protein Z519_08632                         126   7e-29    Cladophialophora bantiana CBS 173.52
ref|XP_007674604.1|  hypothetical protein BAUCODRAFT_66530              126   8e-29    Baudoinia panamericana UAMH 10762
ref|XP_007796791.1|  putative vacuolar protein sorting-associated...    125   1e-28    
gb|KIV87870.1|  hypothetical protein PV11_03388                         125   1e-28    Exophiala sideris
ref|XP_003855617.1|  hypothetical protein MYCGRDRAFT_68201              125   1e-28    Zymoseptoria tritici IPO323
ref|XP_002678979.1|  predicted protein                                  125   1e-28    Naegleria gruberi strain NEG-M
gb|KIW59851.1|  hypothetical protein PV05_00117                         125   1e-28    Exophiala xenobiotica
emb|CCL98206.1|  predicted protein                                      125   2e-28    Fibroporia radiculosa
ref|XP_003655439.1|  hypothetical protein THITE_2119126                 125   2e-28    Thielavia terrestris NRRL 8126
gb|KGO75736.1|  Vps16, N-terminal                                       124   3e-28    Penicillium italicum
emb|CCX31232.1|  Similar to Probable vacuolar protein sorting-ass...    124   3e-28    Pyronema omphalodes CBS 100304
gb|EFW19425.1|  vacuolar protein sorting vps16                          124   3e-28    Coccidioides posadasii str. Silveira
ref|XP_003712813.1|  vacuolar protein sorting-associated protein        124   3e-28    Magnaporthe oryzae 70-15
gb|EMF15307.1|  vacuolar protein sorting-associated protein             124   4e-28    Sphaerulina musiva SO2202
emb|CCD43976.1|  similar to vacuolar protein sorting vps16              124   4e-28    Botrytis cinerea T4
gb|KIX08743.1|  hypothetical protein Z518_03400                         124   4e-28    Rhinocladiella mackenziei CBS 650.93
ref|XP_007761004.1|  hypothetical protein A1O7_08825                    124   4e-28    Cladophialophora yegresii CBS 114405
gb|EPS32356.1|  hypothetical protein PDE_07316                          124   6e-28    Penicillium oxalicum 114-2
ref|XP_010762126.1|  hypothetical protein PADG_06891                    123   6e-28    Paracoccidioides brasiliensis Pb18
gb|EEH15770.1|  hypothetical protein PABG_05857                         123   7e-28    Paracoccidioides brasiliensis Pb03
ref|XP_003067206.1|  Vps16 family protein                               123   8e-28    Coccidioides posadasii C735 delta SOWgp
ref|XP_007869321.1|  vacuolar assembling/sorting protein VPS16          123   1e-27    Gloeophyllum trabeum ATCC 11539
ref|XP_002598771.1|  hypothetical protein BRAFLDRAFT_212848             122   1e-27    Branchiostoma floridae
gb|ELR08066.1|  hypothetical protein GMDG_02893                         122   1e-27    Pseudogymnoascus destructans 20631-21
gb|EMT03828.1|  Vacuolar sorting-associated protein 16-like protein     119   1e-27    
ref|XP_007785089.1|  hypothetical protein W97_09035                     122   1e-27    Coniosporium apollinis CBS 100218
ref|XP_002584341.1|  conserved hypothetical protein                     122   2e-27    Uncinocarpus reesii 1704
ref|XP_001239640.1|  hypothetical protein CIMG_09261                    122   2e-27    
gb|EEH40515.2|  vacuolar protein sorting-associated protein             122   2e-27    Paracoccidioides lutzii Pb01
gb|EAS28057.3|  vacuolar protein sorting vps16                          122   2e-27    Coccidioides immitis RS
ref|XP_003009824.1|  vacuolar protein sorting-associated protein        119   2e-27    Verticillium alfalfae VaMs.102
ref|XP_007290703.1|  vacuolar protein sorting                           121   4e-27    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
dbj|GAA90716.1|  vacuolar protein sorting vps16                         121   4e-27    Aspergillus kawachii IFO 4308
ref|XP_001401136.1|  vacuolar protein sorting vps16                     121   4e-27    Aspergillus niger CBS 513.88
gb|EHA27921.1|  hypothetical protein ASPNIDRAFT_53870                   121   4e-27    Aspergillus niger ATCC 1015
ref|XP_664515.1|  hypothetical protein AN6911.2                         120   5e-27    Aspergillus nidulans FGSC A4
tpe|CBF71716.1|  TPA: vacuolar protein sorting vps16, putative (A...    120   6e-27    Aspergillus nidulans FGSC A4
ref|XP_001229607.1|  hypothetical protein CHGG_03091                    120   6e-27    Chaetomium globosum CBS 148.51
gb|EME47796.1|  hypothetical protein DOTSEDRAFT_78000                   120   7e-27    Dothistroma septosporum NZE10
ref|XP_011318503.1|  hypothetical protein FGSG_02565                    120   7e-27    Fusarium graminearum PH-1
ref|XP_001274640.1|  vacuolar protein sorting vps16, putative           120   8e-27    Aspergillus clavatus NRRL 1
gb|EYE92957.1|  vacuolar protein sorting-associated protein 16          120   9e-27    Aspergillus ruber CBS 135680
gb|EJU02203.1|  vacuolar protein sorting-associated protein 16          120   9e-27    Dacryopinax primogenitus
ref|XP_003300566.1|  hypothetical protein PTT_11835                     120   1e-26    
gb|KIL59455.1|  hypothetical protein M378DRAFT_85025                    120   1e-26    Amanita muscaria Koide BX008
emb|CDM31032.1|  Probable transposable element                          119   1e-26    Penicillium roqueforti FM164
gb|EZF35996.1|  hypothetical protein H101_00471                         119   2e-26    Trichophyton interdigitale H6
ref|XP_002567389.1|  Pc21g03250                                         119   2e-26    Penicillium rubens Wisconsin 54-1255
ref|XP_003170422.1|  vacuolar protein sorting-associated protein        119   2e-26    Nannizzia gypsea CBS 118893
gb|KEZ45344.1|  Uncharacterized protein SAPIO_CDS2157                   119   2e-26    Scedosporium apiospermum
gb|ESZ95296.1|  vacuolar protein sorting                                119   2e-26    Sclerotinia borealis F-4128
ref|XP_009260076.1|  hypothetical protein FPSE_08683                    119   2e-26    Fusarium pseudograminearum CS3096
gb|KGO41557.1|  Vps16, N-terminal                                       119   2e-26    Penicillium expansum
gb|EGE07561.1|  vacuolar protein sorting protein vps16                  119   2e-26    Trichophyton equinum CBS 127.97
gb|EGD96647.1|  vacuolar protein sorting vps16                          119   3e-26    Trichophyton tonsurans CBS 112818
ref|XP_009850778.1|  hypothetical protein NEUTE1DRAFT_122061            119   3e-26    Neurospora tetrasperma FGSC 2508
ref|XP_007850547.1|  vacuolar protein sorting vps16                     119   3e-26    
ref|XP_009658018.1|  vacuolar protein sorting-associated protein        119   3e-26    Verticillium dahliae VdLs.17
ref|XP_007301979.1|  vacuolar assembling/sorting protein VPS16          119   3e-26    Stereum hirsutum FP-91666 SS1
gb|KGO60206.1|  Vps16, N-terminal                                       119   3e-26    Penicillium expansum
ref|XP_001215326.1|  conserved hypothetical protein                     118   3e-26    Aspergillus terreus NIH2624
gb|KIJ15884.1|  hypothetical protein PAXINDRAFT_168867                  119   3e-26    Paxillus involutus ATCC 200175
ref|XP_006693134.1|  putative vacuolar protein sorting-associated...    118   4e-26    Chaetomium thermophilum var. thermophilum DSM 1495
gb|KDQ31847.1|  hypothetical protein PLEOSDRAFT_48878                   118   4e-26    Pleurotus ostreatus PC15
gb|EWG49671.1|  hypothetical protein FVEG_09136                         118   4e-26    Fusarium verticillioides 7600
gb|KDB28142.1|  hypothetical protein H109_00087                         118   4e-26    Trichophyton interdigitale MR816
ref|XP_002837491.1|  hypothetical protein                               118   4e-26    Tuber melanosporum Mel28
ref|XP_003231008.1|  vacuolar protein sorting vps16                     118   5e-26    Trichophyton rubrum CBS 118892
ref|XP_007922652.1|  hypothetical protein MYCFIDRAFT_60175              118   5e-26    Pseudocercospora fijiensis CIRAD86
gb|EWG49670.1|  hypothetical protein FVEG_09136                         118   5e-26    Fusarium verticillioides 7600
ref|XP_005846081.1|  hypothetical protein CHLNCDRAFT_135924             118   6e-26    Chlorella variabilis
gb|EXM23638.1|  hypothetical protein FOTG_09079                         117   6e-26    Fusarium oxysporum f. sp. vasinfectum 25433
gb|EWZ38287.1|  hypothetical protein FOZG_09966                         117   6e-26    Fusarium oxysporum Fo47
gb|ENH66099.1|  Putative vacuolar protein sorting-associated prot...    117   6e-26    Fusarium oxysporum f. sp. cubense race 1
gb|EMT70745.1|  Putative vacuolar protein sorting-associated prot...    117   6e-26    Fusarium oxysporum f. sp. cubense race 4
emb|CCT69282.1|  related to vacuolar protein sorting VACUOLELESS1       117   7e-26    Fusarium fujikuroi IMI 58289
gb|EXK40358.1|  hypothetical protein FOMG_07258                         117   7e-26    Fusarium oxysporum f. sp. melonis 26406
gb|EWY91619.1|  hypothetical protein FOYG_08668                         117   8e-26    Fusarium oxysporum FOSC 3-a
ref|XP_003351543.1|  hypothetical protein SMAC_00085                    117   9e-26    
emb|CCC05869.1|  unnamed protein product                                117   9e-26    Sordaria macrospora k-hell
ref|XP_962872.3|  vacuolar protein sorting-associated protein           117   1e-25    Neurospora crassa OR74A
gb|KIJ36797.1|  hypothetical protein M422DRAFT_179088                   116   1e-25    Sphaerobolus stellatus SS14
ref|XP_002795864.1|  vacuolar protein sorting-associated protein        117   1e-25    
gb|KIK92586.1|  hypothetical protein PAXRUDRAFT_146989                  117   1e-25    Paxillus rubicundulus Ve08.2h10
gb|EFQ25156.1|  hypothetical protein GLRG_00300                         116   2e-25    Colletotrichum graminicola M1.001
ref|XP_009550055.1|  hypothetical protein HETIRDRAFT_325388             116   2e-25    Heterobasidion irregulare TC 32-1
gb|EKV05733.1|  Vacuolar protein sorting vps16, putative                116   2e-25    Penicillium digitatum Pd1
gb|KIK56666.1|  hypothetical protein GYMLUDRAFT_230051                  116   2e-25    Gymnopus luxurians FD-317 M1
ref|XP_001907999.1|  hypothetical protein                               116   2e-25    Podospora anserina S mat+
emb|CCA70355.1|  related to vacuolar protein sorting VACUOLELESS1       116   3e-25    Serendipita indica DSM 11827
ref|XP_011117417.1|  hypothetical protein AOL_s00004g466                115   3e-25    Arthrobotrys oligospora ATCC 24927
ref|XP_009217087.1|  vacuolar protein sorting-associated protein        115   3e-25    Gaeumannomyces tritici R3-111a-1
ref|XP_001641101.1|  predicted protein                                  115   3e-25    Nematostella vectensis
gb|KEY69049.1|  hypothetical protein S7711_03347                        115   3e-25    Stachybotrys chartarum IBT 7711
gb|KFA65450.1|  hypothetical protein S40285_00515                       115   3e-25    Stachybotrys chlorohalonata IBT 40285
gb|KDQ19047.1|  hypothetical protein BOTBODRAFT_28535                   115   3e-25    Botryobasidium botryosum FD-172 SS1
emb|CCG84590.1|  protein of unknown function                            115   4e-25    Taphrina deformans PYCC 5710
emb|CEL57340.1|  Vacuolar protein sorting-associated protein 16 h...    115   4e-25    Rhizoctonia solani AG-1 IB
ref|XP_005104108.1|  PREDICTED: vacuolar protein sorting-associat...    115   5e-25    
gb|EMS54443.1|  Vacuolar protein sorting-associated protein 16-li...    111   5e-25    Triticum urartu
ref|XP_003030158.1|  hypothetical protein SCHCODRAFT_69044              115   5e-25    Schizophyllum commune H4-8
ref|XP_001832533.2|  vacuolar protein sorting 16 isoform 1              115   5e-25    Coprinopsis cinerea okayama7#130
emb|CCO31224.1|  putative vacuolar protein sorting-associated pro...    115   6e-25    Rhizoctonia solani AG-1 IB
gb|KIK24542.1|  hypothetical protein PISMIDRAFT_645755                  115   6e-25    Pisolithus microcarpus 441
gb|ETP46453.1|  hypothetical protein F442_07305                         115   6e-25    Phytophthora parasitica P10297
gb|KIM67291.1|  hypothetical protein SCLCIDRAFT_179253                  114   6e-25    Scleroderma citrinum Foug A
ref|XP_007802765.1|  hypothetical protein EPUS_00545                    114   6e-25    Endocarpon pusillum Z07020
gb|ENH86351.1|  vacuolar protein sorting vps16                          114   7e-25    
gb|ETK88680.1|  hypothetical protein L915_07109                         115   7e-25    Phytophthora parasitica
gb|ETL95226.1|  hypothetical protein L917_06946                         115   7e-25    Phytophthora parasitica
gb|ETL42068.1|  hypothetical protein L916_07062                         115   7e-25    Phytophthora parasitica
gb|ETP18545.1|  hypothetical protein F441_07251                         115   7e-25    Phytophthora parasitica CJ01A1
gb|ETO77515.1|  hypothetical protein F444_07304                         115   7e-25    Phytophthora parasitica P1976
gb|ETM48446.1|  hypothetical protein L914_07020                         115   7e-25    Phytophthora parasitica
gb|ETI48788.1|  hypothetical protein F443_07235                         115   7e-25    Phytophthora parasitica P1569
gb|KHN97610.1|  Vacuolar protein sorting-associated protein 16          114   9e-25    Metarhizium album ARSEF 1941
ref|XP_001936289.1|  vacuolar protein sorting-associated protein        114   1e-24    Pyrenophora tritici-repentis Pt-1C-BFP
gb|KDN71765.1|  hypothetical protein CSUB01_02661                       114   1e-24    Colletotrichum sublineola
ref|XP_011112781.1|  hypothetical protein H072_7007                     114   1e-24    
ref|XP_007593995.1|  hypothetical protein CFIO01_01875                  114   1e-24    
ref|XP_007351763.1|  vacuolar protein sorting-associated protein 16     114   1e-24    
gb|EEC71233.1|  hypothetical protein OsI_03188                          108   1e-24    Oryza sativa Indica Group [Indian rice]
gb|KHJ32046.1|  putative vacuolar protein sorting-associated protein    114   1e-24    Erysiphe necator
gb|ERT01236.1|  hypothetical protein HMPREF1624_02478                   113   2e-24    Sporothrix schenckii ATCC 58251
gb|EWC48561.1|  hypothetical protein DRE_01783                          113   2e-24    Drechslerella stenobrocha 248
ref|XP_007810471.1|  vacuolar protein sorting-associated protein        112   2e-24    Metarhizium acridum CQMa 102
ref|XP_003663128.1|  hypothetical protein MYCTH_2304613                 112   3e-24    Thermothelomyces thermophila ATCC 42464
ref|XP_007825096.2|  vacuolar sorting protein                           112   3e-24    Metarhizium robertsii ARSEF 23
gb|KIY47376.1|  vacuolar protein sorting-associated protein 16          112   4e-24    Fistulina hepatica ATCC 64428
gb|KIJ59378.1|  hypothetical protein HYDPIDRAFT_118596                  112   4e-24    Hydnomerulius pinastri MD-312
gb|EMD88012.1|  hypothetical protein COCHEDRAFT_1143839                 112   4e-24    Bipolaris maydis C5
ref|XP_008025837.1|  hypothetical protein SETTUDRAFT_136246             112   4e-24    Exserohilum turcica Et28A
gb|KFG58811.1|  Vps16, N-terminal region protein                        109   4e-24    Toxoplasma gondii RUB
gb|KFG44033.1|  Vps16, N-terminal region protein                        109   4e-24    Toxoplasma gondii p89
gb|EKG16533.1|  Vps16                                                   112   4e-24    
gb|KIM91586.1|  hypothetical protein PILCRDRAFT_133551                  112   4e-24    
ref|XP_007686147.1|  hypothetical protein COCMIDRAFT_24756              112   5e-24    
gb|KID97671.1|  vacuolar protein sorting vps16                          112   5e-24    
ref|XP_007716056.1|  hypothetical protein COCCADRAFT_105988             112   5e-24    
ref|XP_007699491.1|  hypothetical protein COCSADRAFT_116187             112   5e-24    
ref|XP_002734080.2|  PREDICTED: vacuolar protein sorting-associat...    112   5e-24    
gb|KID75061.1|  vacuolar protein sorting vps16                          112   5e-24    
gb|KFG82733.1|  vacuolar protein sorting vps16                          112   5e-24    
gb|KFH03810.1|  Vps16, N-terminal region protein                        109   7e-24    
ref|XP_002899238.1|  vacuolar protein sorting-associated protein,...    112   9e-24    
ref|XP_009537636.1|  hypothetical protein PHYSODRAFT_530775             112   1e-23    
gb|KIH92692.1|  hypothetical protein SPBR_02318                         111   1e-23    
ref|XP_008078574.1|  SET                                                111   1e-23    
emb|CBJ31010.1|  conserved unknown protein                              106   1e-23    
ref|XP_001881053.1|  vacuolar assembling/sorting protein VPS16          110   2e-23    
gb|KFH40228.1|  vacuolar protein sorting-associated protein-like ...    110   2e-23    
ref|XP_007270430.1|  vacuolar protein sorting-associated protein 16     110   2e-23    
emb|CEJ82684.1|  Putative Vacuolar sorting protein                      109   3e-23    
gb|KIK00029.1|  hypothetical protein K443DRAFT_101182                   109   4e-23    
gb|EHK48630.1|  hypothetical protein TRIATDRAFT_158019                  109   4e-23    
gb|ESS29871.1|  putative vacuolar protein sorting 16                    109   4e-23    
gb|EPR58066.1|  putative vacuolar protein sorting 16                    109   4e-23    
ref|XP_007371512.1|  vacuolar protein sorting-associated protein 16     109   4e-23    
ref|XP_007384243.1|  vacuolar assembling/sorting protein VPS16          109   5e-23    
ref|XP_007313955.1|  hypothetical protein SERLADRAFT_365727             108   6e-23    
ref|XP_008887993.1|  vacuolar protein sorting 16, putative              109   6e-23    
ref|XP_001824206.1|  vacuolar protein sorting vps16                     108   7e-23    
gb|EHK17629.1|  hypothetical protein TRIVIDRAFT_76046                   108   7e-23    
gb|EPS95124.1|  hypothetical protein FOMPIDRAFT_1043679                 108   8e-23    
ref|XP_001800643.1|  hypothetical protein SNOG_10369                    108   8e-23    
ref|XP_007771096.1|  vacuolar assembling sorting protein VPS16          108   1e-22    
emb|CCA23589.1|  vacuolar protein sortingassociated protein putative    108   1e-22    
gb|KIK32973.1|  hypothetical protein CY34DRAFT_813942                   108   1e-22    
gb|KIP07308.1|  hypothetical protein PHLGIDRAFT_426170                  108   1e-22    
ref|XP_003839994.1|  similar to vacuolar protein sorting vps16          108   1e-22    
gb|ELU41202.1|  vacuolar assembling/sorting protein VPS16               107   1e-22    
ref|XP_002591465.1|  hypothetical protein BRAFLDRAFT_105238             107   2e-22    
gb|EMR87211.1|  putative vacuolar protein sorting-associated protein    107   2e-22    
gb|KFM68340.1|  hypothetical protein X975_12661                         107   2e-22    
emb|CCE32487.1|  related to vacuolar protein sorting VACUOLELESS1       107   3e-22    
ref|XP_011420366.1|  PREDICTED: vacuolar protein sorting-associat...    106   3e-22    
ref|XP_007588153.1|  putative vacuolar protein sorting vps16 protein    106   4e-22    
gb|ELU17286.1|  hypothetical protein CAPTEDRAFT_168734                  106   4e-22    
gb|KII87631.1|  hypothetical protein PLICRDRAFT_111626                  106   4e-22    
ref|XP_011420359.1|  PREDICTED: vacuolar protein sorting-associat...    106   5e-22    
gb|KIO05251.1|  hypothetical protein M404DRAFT_141113                   106   5e-22    
ref|XP_006463395.1|  hypothetical protein AGABI2DRAFT_208148            106   5e-22    
ref|XP_007331990.1|  hypothetical protein AGABI1DRAFT_77347             105   7e-22    
ref|XP_008042309.1|  vacuolar protein sorting-associated protein 16     105   7e-22    
ref|XP_007393336.1|  hypothetical protein PHACADRAFT_193129             105   8e-22    
ref|XP_002477405.1|  predicted protein                                  105   9e-22    
ref|XP_002145095.1|  vacuolar protein sorting vps16, putative           105   1e-21    
ref|XP_009823468.1|  hypothetical protein H257_01794                    105   1e-21    
ref|XP_006965386.1|  vacuolar sorting protein                           105   1e-21    
gb|EGN92883.1|  hypothetical protein SERLA73DRAFT_79230                 104   1e-21    
gb|EQL02195.1|  vacuolar sorting protein                                104   2e-21    
emb|CCI45876.1|  unnamed protein product                                104   2e-21    
gb|KJA15614.1|  hypothetical protein HYPSUDRAFT_1068261                 104   2e-21    
gb|KIR57748.1|  vacuolar protein sorting-associated protein             103   4e-21    
gb|KIR45019.1|  vacuolar protein sorting-associated protein             103   4e-21    
gb|KDR80313.1|  hypothetical protein GALMADRAFT_62817                   103   4e-21    
ref|XP_001699374.1|  VPS16-like protein                                 103   5e-21    
gb|EFX02190.1|  vacuolar protein sorting                                103   6e-21    
ref|XP_002172849.2|  HOPS complex subunit Vps16                         102   7e-21    
ref|XP_009052918.1|  hypothetical protein LOTGIDRAFT_115951             102   9e-21    
ref|XP_781126.3|  PREDICTED: vacuolar protein sorting-associated ...    101   2e-20    
dbj|GAM34585.1|  vacuole organization and biogenesis-related protein    101   2e-20    
gb|EMD35361.1|  hypothetical protein CERSUDRAFT_66538                   101   2e-20    
gb|KDR24089.1|  Vacuolar protein sorting-associated protein 16-li...    101   2e-20    
gb|KFX51261.1|  putative vacuolar protein sorting-associated prot...    101   2e-20    
gb|AFR93063.2|  vacuolar protein sorting-associated protein             101   2e-20    
gb|KIO15844.1|  hypothetical protein M407DRAFT_235273                   100   2e-20    
ref|XP_002953465.1|  hypothetical protein VOLCADRAFT_105988             101   3e-20    
gb|KFH11077.1|  Vps16, N-terminal region protein                      97.1    6e-20    
gb|KGQ08995.1|  putative vacuolar protein sorting-associated prot...  99.8    8e-20    
ref|XP_569075.1|  vacuole organization and biogenesis-related pro...  99.8    8e-20    
gb|KIY70700.1|  vacuolar assembling/sorting protein VPS16             99.8    9e-20    
ref|XP_776977.1|  hypothetical protein CNBB5050                       99.4    1e-19    
ref|XP_008597775.1|  vacuolar protein sorting vps16                   99.4    1e-19    
gb|KGB80280.1|  vacuolar assembling/sorting protein VPS16             99.4    1e-19    
gb|KIR31200.1|  vacuolar protein sorting-associated protein           99.4    1e-19    
gb|KIR50703.1|  vacuolar protein sorting-associated protein           99.4    1e-19    
gb|KIY31247.1|  vacuolar protein sorting-associated protein           99.4    1e-19    
ref|XP_003192484.1|  vacuole organization and biogenesis-related ...  99.4    1e-19    
gb|KIR83430.1|  vacuolar protein sorting-associated protein           99.0    1e-19    
gb|KIR76852.1|  vacuolar protein sorting-associated protein           99.0    1e-19    
gb|KID87415.1|  vacuolar protein sorting vps16                        99.0    1e-19    
ref|XP_002340287.1|  vacuolar protein sorting vps16, putative         99.0    2e-19    
ref|XP_008866355.1|  hypothetical protein H310_04019                  99.0    2e-19    
gb|KIM47049.1|  hypothetical protein M413DRAFT_440594                 98.6    2e-19    
ref|XP_002428971.1|  vacuolar protein sorting, putative               98.2    2e-19    
gb|KJE01407.1|  vacuolar protein sorting-associated protein           98.2    3e-19    
gb|KIR25553.1|  vacuolar protein sorting-associated protein           98.2    3e-19    
gb|KFG43269.1|  Vps16, N-terminal region protein                      94.4    3e-19    
gb|EPE10985.1|  vacuolar protein sorting-associated protein           97.8    3e-19    
ref|XP_004367009.1|  hypothetical protein DFA_07142                   97.8    4e-19    
ref|XP_003880525.1|  vps16-like protein, related                      96.7    1e-18    
ref|XP_006010586.1|  PREDICTED: vacuolar protein sorting-associat...  95.9    1e-18    
gb|KFX51260.1|  putative vacuolar protein sorting-associated prot...  95.9    1e-18    
ref|XP_005518015.1|  PREDICTED: vacuolar protein sorting-associat...  95.5    1e-18    
ref|XP_005812181.1|  PREDICTED: vacuolar protein sorting-associat...  95.1    2e-18    
gb|KDQ58687.1|  hypothetical protein JAAARDRAFT_57575                 95.5    2e-18    
ref|XP_003966794.1|  PREDICTED: vacuolar protein sorting-associat...  95.1    2e-18    
ref|XP_005812180.1|  PREDICTED: vacuolar protein sorting-associat...  95.1    3e-18    
ref|XP_002469782.1|  predicted protein                                94.4    3e-18    
ref|XP_007540621.1|  PREDICTED: vacuolar protein sorting-associat...  95.1    3e-18    
ref|XP_002369923.1|  hypothetical protein, conserved                  95.1    3e-18    
gb|KIL95901.1|  hypothetical protein FAVG1_00639                      94.7    3e-18    
ref|XP_008200104.1|  PREDICTED: vacuolar protein sorting-associat...  94.4    4e-18    
gb|EFA13302.1|  hypothetical protein TcasGA2_TC001384                 94.4    5e-18    
ref|XP_005176360.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    1e-17    
ref|XP_006606806.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  92.0    1e-17    
ref|XP_008323608.1|  PREDICTED: vacuolar protein sorting-associat...  92.8    1e-17    
emb|CDX91426.1|  BnaC04g07240D                                        85.1    1e-17    
ref|NP_001258079.1|  vacuolar protein sorting-associated protein ...  92.8    1e-17    
ref|XP_005431022.1|  PREDICTED: vacuolar protein sorting-associat...  92.0    2e-17    
ref|XP_004697935.1|  PREDICTED: vacuolar protein sorting-associat...  91.7    3e-17    
ref|XP_005463829.1|  PREDICTED: vacuolar protein sorting-associat...  91.7    3e-17    
gb|EFX68012.1|  hypothetical protein DAPPUDRAFT_63503                 91.7    4e-17    
ref|XP_004697934.1|  PREDICTED: vacuolar protein sorting-associat...  91.7    4e-17    
ref|XP_006636484.1|  PREDICTED: vacuolar protein sorting-associat...  91.7    4e-17    
ref|XP_007195891.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    4e-17    
ref|XP_001598431.1|  hypothetical protein SS1G_00520                  91.3    4e-17    
ref|XP_003458681.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    5e-17    
ref|XP_005951517.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    5e-17    
ref|XP_007898277.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    5e-17    
ref|XP_004523432.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    5e-17    
gb|KDB15389.1|  vacuolar protein sorting-associated protein           91.3    5e-17    
ref|XP_008121385.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    5e-17    
ref|XP_006791952.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    5e-17    
ref|XP_004285369.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    5e-17    
ref|XP_005951515.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    6e-17    
ref|XP_008495020.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    6e-17    
ref|XP_004317401.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    6e-17    
ref|XP_007195887.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    6e-17    
ref|XP_007497007.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    7e-17    
ref|XP_004285368.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    7e-17    
ref|XP_004317400.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    7e-17    
ref|XP_008434411.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    7e-17    
ref|XP_005735068.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    8e-17    
ref|XP_010566769.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    8e-17    
ref|XP_007248949.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    9e-17    
ref|XP_004575656.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    9e-17    
ref|XP_005735066.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    9e-17    
ref|XP_007465456.1|  PREDICTED: vacuolar protein sorting-associat...  90.1    9e-17    
gb|KIN04228.1|  hypothetical protein OIDMADRAFT_194588                90.5    9e-17    
ref|XP_008568869.1|  PREDICTED: vacuolar protein sorting-associat...  90.1    1e-16    
ref|XP_008568870.1|  PREDICTED: vacuolar protein sorting-associat...  90.1    1e-16    
ref|XP_007127204.1|  PREDICTED: vacuolar protein sorting-associat...  90.1    1e-16    
ref|XP_011500724.1|  PREDICTED: vacuolar protein sorting-associat...  90.1    1e-16    
ref|XP_007465455.1|  PREDICTED: vacuolar protein sorting-associat...  90.1    1e-16    
ref|XP_007404251.1|  hypothetical protein MELLADRAFT_32963            90.1    1e-16    
ref|XP_005068684.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16    
gb|KDO30335.1|  hypothetical protein SPRG_05046                       90.1    1e-16    
ref|XP_011212493.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16    
ref|XP_008568868.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16    
ref|XP_008852713.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16    
ref|XP_004611017.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16    
ref|XP_008606140.1|  hypothetical protein SDRG_02337                  89.7    2e-16    
ref|XP_003476674.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16    
ref|XP_005380824.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16    
ref|XP_004661527.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16    
ref|XP_001996143.1|  GH14334                                          89.7    2e-16    
ref|XP_004383068.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_011191448.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16    
ref|XP_005068683.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16    
ref|XP_010809680.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_004014429.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
tpg|DAA23165.1|  TPA: vacuolar protein sorting-associated protein...  89.4    2e-16    
ref|XP_002710925.2|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_006042779.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_004014428.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_005688275.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_004661526.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_004611016.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_006874900.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16    
ref|XP_010834814.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16    
ref|XP_006042780.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16    
ref|XP_005974817.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16    
ref|XP_003476673.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16    
ref|XP_004383066.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16    
ref|XP_005380823.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16    
ref|NP_536338.1|  vacuolar protein sorting-associated protein 16 ...  88.6    3e-16    
ref|XP_011279227.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16    
ref|XP_004398209.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16    
ref|XP_004585724.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16    
ref|XP_004634302.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16    
ref|XP_002000799.1|  GI10429                                          88.6    3e-16    
ref|XP_006042777.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    4e-16    
gb|EHK99978.1|  putative vacuolar protein sorting-associated prot...  88.2    4e-16    
ref|XP_001496814.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    4e-16    
ref|XP_006874899.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    4e-16    
ref|XP_006671984.1|  vacuolar protein sorting vps16                   88.6    4e-16    
ref|XP_004084191.2|  PREDICTED: vacuolar protein sorting-associat...  83.6    4e-16    
ref|XP_004687407.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16    
ref|XP_003134377.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16    
ref|XP_004398208.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16    
gb|AAG34678.1|AF308801_1  vacuolar protein sorting protein 16         88.2    5e-16    
ref|NP_072097.2|  vacuolar protein sorting-associated protein 16 ...  88.2    5e-16    
ref|XP_004585723.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16    
ref|XP_002806793.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  88.2    5e-16    
ref|XP_003774363.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16    
ref|XP_005894002.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    5e-16    
ref|XP_004634301.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16    
ref|XP_010862318.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16    
ref|XP_009434986.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16    
ref|NP_001015522.1|  vacuolar protein sorting-associated protein ...  87.8    6e-16    
ref|XP_007958199.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16    
ref|XP_005894001.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16    
ref|XP_003134376.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16    
ref|XP_003788109.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    6e-16    
ref|XP_003639899.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    6e-16    
ref|XP_004687406.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    7e-16    
dbj|BAB71013.1|  unnamed protein product                              87.4    8e-16    
ref|XP_003941102.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16    
ref|XP_005568560.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16    
ref|XP_001842734.1|  vacuolar protein sorting vps16                   87.4    8e-16    
ref|XP_007958197.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16    
ref|XP_006732343.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16    
ref|XP_005320597.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16    



>ref|XP_004243213.1| PREDICTED: protein VACUOLELESS1 [Solanum lycopersicum]
Length=843

 Score =   463 bits (1191),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 231/248 (93%), Gaps = 3/248 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ V+VAAEWQLLYNRYYRKPE+Y MQWKHVDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLYNRYYRKPEIYLMQWKHVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGVQI+ETVWKNPGGRL+GMSWTDDQ L+CITQDGTVYRY+I AEP+
Sbjct  61   AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYRYNIHAEPI  120

Query  431  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            E    L+LG DCFTHSVV+CVFW NGVVCINEAFQV+CIPDF NP P+KLAD GLEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECVFWGNGVVCINEAFQVYCIPDFNNPKPVKLADTGLEDFPL  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
             M VIEPQYTMSGNVEVLM V DHVLLVEEDG+Q++G+GIGPLQKMVVSRNGKLLASFTH
Sbjct  181  CMAVIEPQYTMSGNVEVLMGVADHVLLVEEDGVQEVGLGIGPLQKMVVSRNGKLLASFTH  240

Query  782  DGRLLVMT  805
            DGRLLVM+
Sbjct  241  DGRLLVMS  248



>ref|XP_006348963.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solanum tuberosum]
Length=844

 Score =   460 bits (1183),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 230/248 (93%), Gaps = 3/248 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ V+VAAEWQLLYNRYYRKPE+YQMQWKHVDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLYNRYYRKPEIYQMQWKHVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNS GVQI+ETVWKNPGGRL+GMSWTDDQ L+CITQDGTVYRY+I AEP+
Sbjct  61   AESALRKLRIFNSTGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYRYNIHAEPI  120

Query  431  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            E    L+LG DCFTHSVV+CVFW NGVVCINEAFQV+CIPDF NP P+KLAD  LEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECVFWGNGVVCINEAFQVYCIPDFNNPKPVKLADTDLEDFPL  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
             M VIEPQYTMSGNVEVLM V DHVLLVEEDG+Q++G+GIGPLQKMVVS+NGKLLASFTH
Sbjct  181  CMAVIEPQYTMSGNVEVLMGVADHVLLVEEDGVQEVGLGIGPLQKMVVSQNGKLLASFTH  240

Query  782  DGRLLVMT  805
            DGRLLVM+
Sbjct  241  DGRLLVMS  248



>ref|XP_009625096.1| PREDICTED: protein VACUOLELESS1 [Nicotiana tomentosiformis]
Length=843

 Score =   459 bits (1181),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 231/248 (93%), Gaps = 3/248 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ V+VAAEWQLL+NRYYRKPELYQMQWKHVDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLHNRYYRKPELYQMQWKHVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGVQI+ETVWKNPGGRL+GMSWTDDQTL+CITQDGT+YRY+I AEP+
Sbjct  61   AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQTLVCITQDGTIYRYNIHAEPI  120

Query  431  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            E    L+LG DCFTHSVV+C+FW NGVVCINEAFQV+CIPDF NP PIKLAD GLEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECIFWGNGVVCINEAFQVYCIPDFNNPKPIKLADTGLEDFPL  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
               VIEPQYTMSGNVEVLM V DHVLLVEEDG+QQ+G+GIGPLQKMVVS+NGKLLA+FTH
Sbjct  181  CTAVIEPQYTMSGNVEVLMGVADHVLLVEEDGVQQVGLGIGPLQKMVVSQNGKLLAAFTH  240

Query  782  DGRLLVMT  805
            D RLLV++
Sbjct  241  DDRLLVIS  248



>ref|XP_009790374.1| PREDICTED: protein VACUOLELESS1 [Nicotiana sylvestris]
Length=843

 Score =   455 bits (1170),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 231/248 (93%), Gaps = 3/248 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ V+VAAEWQLL+NRYYRKPELYQMQWK+VDLTRNKVAC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAAVTVAAEWQLLHNRYYRKPELYQMQWKNVDLTRNKVACAPFGGPIAVIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGVQI+ETVWKNPGGRL+GMSWTDDQ L+CITQDGTVYRY+I AEP+
Sbjct  61   AESALRKLRIFNSAGVQISETVWKNPGGRLIGMSWTDDQILVCITQDGTVYRYNIHAEPI  120

Query  431  E---SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            E    L+LG DCFTHSVV+C+FW NGVVCINEAFQV+CIPDF NP PIKLAD GLEDFPL
Sbjct  121  EPNSQLTLGADCFTHSVVECIFWGNGVVCINEAFQVYCIPDFNNPKPIKLADTGLEDFPL  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
               VIEPQYTMSGNVEVLM+V DHVLLVEEDG+QQ+G+GIGPLQKMVVS+NGKLLA+FTH
Sbjct  181  CTAVIEPQYTMSGNVEVLMSVADHVLLVEEDGVQQVGLGIGPLQKMVVSQNGKLLAAFTH  240

Query  782  DGRLLVMT  805
            D +LLVM+
Sbjct  241  DDKLLVMS  248



>ref|XP_010271338.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Nelumbo nucifera]
Length=691

 Score =   424 bits (1091),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 224/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y MQWK  DL RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MAAVSVAAEWQLLYNRYYRKPEIYTMQWKQFDLNRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGVQ++ETVW++ GGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESALRKLRIFNSAGVQLSETVWRHSGGRLVGMAWTDDQILVCVVQDGTVYRYNVHAELQ  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++S+GK+CF  +VV+CVFW NG+VCI EA Q+FCIPDF+NPNP KLADP LE+FPL M
Sbjct  121  EPNISMGKECFEQNVVECVFWGNGMVCITEANQIFCIPDFQNPNPCKLADPLLEEFPLCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
            TVIEPQYTMSGNVEVL+ V DHVLLVEE+G+QQLGVG+GPLQKMVVSRNGKLLASFTHDG
Sbjct  181  TVIEPQYTMSGNVEVLLGVNDHVLLVEEEGVQQLGVGVGPLQKMVVSRNGKLLASFTHDG  240

Query  788  RLLVMT  805
            R+LV++
Sbjct  241  RVLVIS  246



>ref|XP_010681470.1| PREDICTED: protein VACUOLELESS1 [Beta vulgaris subsp. vulgaris]
Length=844

 Score =   427 bits (1099),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/250 (80%), Positives = 225/250 (90%), Gaps = 6/250 (2%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYA  253
            + VS+AAEWQLLYNRYYRKPELY M+WKH+DL RNKVAC+PFGGPIAVIRDD+KIVQLYA
Sbjct  3    AAVSIAAEWQLLYNRYYRKPELYSMRWKHIDLNRNKVACAPFGGPIAVIRDDSKIVQLYA  62

Query  254  ESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE  433
            ESALRKLRIFNSAG QIAETVW+NPGGRL+GMSWTD+QTLICI QDGTVYRYDI A+ +E
Sbjct  63   ESALRKLRIFNSAGNQIAETVWRNPGGRLIGMSWTDEQTLICIVQDGTVYRYDIHAQVIE  122

Query  434  -SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNP-----IKLADPGLEDF  595
             SLSLGK+CF  SVV+CVFW NGVVC+NEAFQ FC+PDF N +      +KLADP L+D 
Sbjct  123  PSLSLGKECFEQSVVECVFWGNGVVCMNEAFQFFCVPDFSNFDSDNKGVVKLADPSLDDP  182

Query  596  PLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASF  775
            PL M VIEP+YTMSGNVEVL+AVGDHVLLV+EDGIQQ+GVG+GPLQKMVVSR+GK LASF
Sbjct  183  PLCMAVIEPKYTMSGNVEVLLAVGDHVLLVDEDGIQQVGVGVGPLQKMVVSRDGKYLASF  242

Query  776  THDGRLLVMT  805
            THDGRLLV+T
Sbjct  243  THDGRLLVIT  252



>ref|XP_010271337.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Nelumbo nucifera]
Length=841

 Score =   427 bits (1097),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 224/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y MQWK  DL RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MAAVSVAAEWQLLYNRYYRKPEIYTMQWKQFDLNRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGVQ++ETVW++ GGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESALRKLRIFNSAGVQLSETVWRHSGGRLVGMAWTDDQILVCVVQDGTVYRYNVHAELQ  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++S+GK+CF  +VV+CVFW NG+VCI EA Q+FCIPDF+NPNP KLADP LE+FPL M
Sbjct  121  EPNISMGKECFEQNVVECVFWGNGMVCITEANQIFCIPDFQNPNPCKLADPLLEEFPLCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
            TVIEPQYTMSGNVEVL+ V DHVLLVEE+G+QQLGVG+GPLQKMVVSRNGKLLASFTHDG
Sbjct  181  TVIEPQYTMSGNVEVLLGVNDHVLLVEEEGVQQLGVGVGPLQKMVVSRNGKLLASFTHDG  240

Query  788  RLLVMT  805
            R+LV++
Sbjct  241  RVLVIS  246



>emb|CDP06151.1| unnamed protein product [Coffea canephora]
Length=840

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/245 (78%), Positives = 218/245 (89%), Gaps = 0/245 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVAC+PFGGPIA IRDDAKIVQLY
Sbjct  1    MAAVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACAPFGGPIAAIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIFNSAGVQI+ETVW+N GGRL+GM+W+DD  LICITQDGTVY Y   AE +
Sbjct  61   SESALRKLRIFNSAGVQISETVWRNAGGRLIGMAWSDDLKLICITQDGTVYCYSFHAELI  120

Query  431  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  610
            ++LSLG+D   HS+V+CVFW NGVVCINEA +++CIP F NP+PI+LAD GLED PL M 
Sbjct  121  KTLSLGQDGLKHSIVECVFWGNGVVCINEAVELYCIPHFNNPSPIRLADTGLEDMPLCMA  180

Query  611  VIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGR  790
            VIEPQYTMSGNVEVL+ V D V++VEEDG+QQ G  IGP+QKMVVSRNGKL+ASFTHDGR
Sbjct  181  VIEPQYTMSGNVEVLLGVSDSVMVVEEDGVQQTGAEIGPIQKMVVSRNGKLIASFTHDGR  240

Query  791  LLVMT  805
            LLV++
Sbjct  241  LLVLS  245



>gb|EYU33990.1| hypothetical protein MIMGU_mgv1a001320mg [Erythranthe guttata]
Length=840

 Score =   416 bits (1069),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 216/245 (88%), Gaps = 0/245 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELYQMQWK+VDLTRNK+AC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAGVSVAAEWQLLYNRYYRKPELYQMQWKNVDLTRNKIACAPFGGPIAVIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIF S+G  I+ETVWKNPGGRL+G+SWTDD TL+CITQDGTVY YDI AE +
Sbjct  61   AESALRKLRIFTSSGRLISETVWKNPGGRLIGISWTDDLTLVCITQDGTVYSYDIHAELV  120

Query  431  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  610
             + SLGK+CF +SVV+CVFW +GVVCINEAF++F +PDFK P  +KLAD  LE+ P  M 
Sbjct  121  STFSLGKECFANSVVECVFWGSGVVCINEAFEIFAVPDFKTPKTVKLADSNLEELPHCMA  180

Query  611  VIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGR  790
            VIEPQYT SG+VEVL+ VGDHVLLVEEDG+Q L  GIGPLQKMVVSR G+ +ASFTHDGR
Sbjct  181  VIEPQYTKSGDVEVLLGVGDHVLLVEEDGVQSLAEGIGPLQKMVVSRKGEFVASFTHDGR  240

Query  791  LLVMT  805
            LLVM+
Sbjct  241  LLVMS  245



>gb|EPS58563.1| hypothetical protein M569_16250, partial [Genlisea aurea]
Length=258

 Score =   392 bits (1006),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 178/245 (73%), Positives = 214/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAA WQLLYNRYYRKPELYQMQWK+VDLTRNK+AC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAGVSVAAGWQLLYNRYYRKPELYQMQWKNVDLTRNKIACAPFGGPIAVIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESA+RKLR+F S+G  I+ET+W+NPGGRL+GMSWTDD  L+CITQDGT+Y Y+I AE +
Sbjct  61   AESAIRKLRLFTSSGCLISETIWRNPGGRLIGMSWTDDLMLVCITQDGTIYFYNIHAELV  120

Query  431  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  610
             + SLGK+CF +SVV+CVFW +GVVCINEAF++F +PDFK P  +KLAD  L++ P  M 
Sbjct  121  NTFSLGKECFENSVVECVFWGSGVVCINEAFRIFSVPDFKVPKTVKLADCNLDELPHCMA  180

Query  611  VIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGR  790
            VI+PQYT SG+VE+L+ VGDHVLLVEED +Q+L  GIGPLQKMVVSR G+ +ASFTHDGR
Sbjct  181  VIDPQYTKSGDVELLLGVGDHVLLVEEDEVQKLASGIGPLQKMVVSRKGEFVASFTHDGR  240

Query  791  LLVMT  805
            LLV++
Sbjct  241  LLVLS  245



>ref|XP_011082899.1| PREDICTED: protein VACUOLELESS1 [Sesamum indicum]
Length=840

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/245 (76%), Positives = 214/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ V+VAAEWQLLYNRYYRKPELYQMQWK+VDLTRNK+AC+PFGGPIAVIRDDAKIVQLY
Sbjct  1    MAGVAVAAEWQLLYNRYYRKPELYQMQWKNVDLTRNKIACAPFGGPIAVIRDDAKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIF S+G  I+ETVWKNPGGRL+GMSWTDD TLICITQDGTVY Y+I AE +
Sbjct  61   AESALRKLRIFTSSGRLISETVWKNPGGRLIGMSWTDDLTLICITQDGTVYSYNIHAELI  120

Query  431  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  610
             + SLGK+CF +SVV+CVFW NGVVCINEAF++F +PDFK P  +KLAD  LE+ P  + 
Sbjct  121  STFSLGKECFDNSVVECVFWGNGVVCINEAFEIFAVPDFKVPKTVKLADCNLEELPHCIA  180

Query  611  VIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGR  790
            VIEPQYT SG+VEVL+ VGDHVLLVEED +Q L  G+GP QKMVVSR G+ +ASFTHDGR
Sbjct  181  VIEPQYTKSGDVEVLLGVGDHVLLVEEDLVQPLAEGMGPFQKMVVSRKGEFVASFTHDGR  240

Query  791  LLVMT  805
            LLVM+
Sbjct  241  LLVMS  245



>ref|XP_002283428.1| PREDICTED: protein VACUOLELESS1 [Vitis vinifera]
 emb|CBI22093.3| unnamed protein product [Vitis vinifera]
Length=838

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 225/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y MQWKH+DL+RNKVA +PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYPMQWKHIDLSRNKVAGAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGVQI+ETVWK+PGGRLVGM+WTDDQTLIC+ QDGTV+RY++ AE  
Sbjct  61   AESALRKLRIFNSAGVQISETVWKHPGGRLVGMAWTDDQTLICVVQDGTVFRYNVHAELQ  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++S+GK+CF  +VV+CVFW NG+VCI EA Q+FCI DFKNPNP KLADP L+++PL +
Sbjct  121  EPNISMGKECFEQNVVECVFWGNGMVCITEANQIFCISDFKNPNPCKLADPNLDEYPLCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
             VIEPQYTMSGNVEVL+AV D VLLVEEDG+QQLG GIGPLQKMVVSRNGKLLASFTHDG
Sbjct  181  AVIEPQYTMSGNVEVLLAVDDLVLLVEEDGVQQLGAGIGPLQKMVVSRNGKLLASFTHDG  240

Query  788  RLLVMT  805
            RLLV++
Sbjct  241  RLLVIS  246



>ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 ref|XP_004166595.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 gb|KGN54934.1| hypothetical protein Csa_4G608100 [Cucumis sativus]
Length=844

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/249 (75%), Positives = 218/249 (88%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLL+NRYYRKPELY M+WKH+DL RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLHNRYYRKPELYPMRWKHIDLGRNKVACAPFGGPIAIIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFN AG+Q+AETVW+NPGGRL+GM+WTDDQTL+C+ QDGTVYRY+I AE L
Sbjct  61   AESALRKLRIFNCAGIQLAETVWRNPGGRLIGMAWTDDQTLVCVVQDGTVYRYNIHAELL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E + S+GK+CF  +VV+CVFW NGVVCI EA Q+FCI DFKNPN  KL+DPG+ED P  M
Sbjct  121  EPNFSMGKECFEQNVVECVFWGNGVVCITEANQIFCISDFKNPNACKLSDPGIEDLPHCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDH-VLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ VG+  V+ VEEDG+Q+LG GI  GPLQ+M VS +GK LA+FT
Sbjct  181  VVIEPQYTMSGNVEVLLGVGEACVIAVEEDGVQRLGEGILDGPLQRMAVSLDGKWLAAFT  240

Query  779  HDGRLLVMT  805
            HDGRLLV+T
Sbjct  241  HDGRLLVLT  249



>ref|XP_008465445.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
 ref|XP_008465446.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
Length=844

 Score =   397 bits (1021),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 217/249 (87%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLL+NRYYRKPELY M+WKH+DL RNKVAC+PFGGP+A+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLHNRYYRKPELYPMRWKHIDLGRNKVACAPFGGPVAIIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFN AG+Q+AETVW+NPGGRL+GM+WTDDQTL+C+ QDGTVYRY+I AE L
Sbjct  61   AESALRKLRIFNCAGIQLAETVWRNPGGRLIGMAWTDDQTLVCVVQDGTVYRYNIHAELL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E + S+GK+CF  +VV+CVFW NGVVCI EA Q+FCI DFKNP   KL+DPG+ED P  M
Sbjct  121  EPNFSMGKECFEQNVVECVFWGNGVVCITEANQIFCISDFKNPKSCKLSDPGIEDLPHCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDH-VLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ VG+  V+ VEEDG+Q+LG G+  GPLQ+M VS +GK LA+FT
Sbjct  181  VVIEPQYTMSGNVEVLLGVGEACVIAVEEDGVQRLGEGVLDGPLQRMAVSLDGKWLAAFT  240

Query  779  HDGRLLVMT  805
            HDGRLLV+T
Sbjct  241  HDGRLLVLT  249



>ref|XP_008342344.1| PREDICTED: protein VACUOLELESS1 [Malus domestica]
Length=840

 Score =   394 bits (1011),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 215/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESA RKLRIF+SAG  + ET+WK+PGGRL+GM+WTDDQ L+C+ QDGTV+RY I AE +
Sbjct  61   GESAQRKLRIFSSAGHLLGETIWKHPGGRLIGMAWTDDQNLVCLVQDGTVFRYTIHAELV  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E S+S+GK+CF  +VVDCVFW NGVVCI E  Q+FCI DFKNPNPIKLADPG+ED PL M
Sbjct  121  EPSISMGKECFERNVVDCVFWGNGVVCITETNQLFCISDFKNPNPIKLADPGIEDPPLCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDH-VLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ +GD  VL VEEDG+QQLG+ +  GP+QKM VSR+G+ LASFT
Sbjct  181  AVIEPQYTMSGNVEVLLGIGDACVLAVEEDGVQQLGLEMLRGPIQKMAVSRDGQWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLVMT
Sbjct  241  HDGRLLVMT  249



>gb|ABF69968.1| vacuolar protein sorting 16 (VPS16) family protein [Musa acuminata]
Length=280

 Score =   375 bits (963),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 205/245 (84%), Gaps = 1/245 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M++VSVA EWQLLYNR+YRK  +Y MQW  +DL+R+++A +PFGGP+A IRDD+KIVQLY
Sbjct  1    MTSVSVAGEWQLLYNRFYRKLTIYTMQWGRIDLSRHRIAAAPFGGPVAAIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESA RKL IFN+AG  +A  +W  PGGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESARRKLLIFNAAGRALASAIWDRPGGRLVGMAWTDDQVLVCVVQDGTVYRYNVHAELC  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
                S+GK+CF   VVDCVFW NG+VCI E F +FC+PDFKNP P +L+DPG++++PL +
Sbjct  121  APQFSMGKECFEQGVVDCVFWGNGMVCITEGFLIFCVPDFKNPVPCRLSDPGIDEYPLCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
             VI+PQYTMSGNVEVL+ VGDHVLLVEEDG+QQLGVG+GP QKM VS+NGK LA+FTHDG
Sbjct  181  AVIDPQYTMSGNVEVLLGVGDHVLLVEEDGVQQLGVGVGPFQKMAVSQNGKYLATFTHDG  240

Query  788  RLLVM  802
            RLLV+
Sbjct  241  RLLVI  245



>ref|XP_004303883.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=857

 Score =   394 bits (1011),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 217/249 (87%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y+M W HVDL+RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEVYRMTWSHVDLSRNKVACAPFGGPIAVIRDDSKIVQLR  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESA RKLRIFNS+G+ + ET+WK+PGGRL+GMSWTDDQTL+C+ QDGTVYRY+I AE +
Sbjct  61   GESAQRKLRIFNSSGLLLGETIWKHPGGRLIGMSWTDDQTLVCLVQDGTVYRYNILAEIV  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E S+S+GK+CF  +VVDCVFW NGVVCI E+ Q+FC+ DF+NPNP++LADPG+ED P  M
Sbjct  121  EPSISMGKECFERNVVDCVFWGNGVVCITESNQLFCVSDFQNPNPVQLADPGIEDPPYCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDH-VLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ + +  VL VEEDG+QQLGV +  GPLQKM VSR+G+ LASFT
Sbjct  181  AVIEPQYTMSGNVEVLLGISEPWVLAVEEDGVQQLGVDVLRGPLQKMAVSRDGQWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLVMT
Sbjct  241  HDGRLLVMT  249



>ref|XP_011467591.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=891

 Score =   394 bits (1011),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 217/249 (87%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y+M W HVDL+RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEVYRMTWSHVDLSRNKVACAPFGGPIAVIRDDSKIVQLR  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESA RKLRIFNS+G+ + ET+WK+PGGRL+GMSWTDDQTL+C+ QDGTVYRY+I AE +
Sbjct  61   GESAQRKLRIFNSSGLLLGETIWKHPGGRLIGMSWTDDQTLVCLVQDGTVYRYNILAEIV  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E S+S+GK+CF  +VVDCVFW NGVVCI E+ Q+FC+ DF+NPNP++LADPG+ED P  M
Sbjct  121  EPSISMGKECFERNVVDCVFWGNGVVCITESNQLFCVSDFQNPNPVQLADPGIEDPPYCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDH-VLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ + +  VL VEEDG+QQLGV +  GPLQKM VSR+G+ LASFT
Sbjct  181  AVIEPQYTMSGNVEVLLGISEPWVLAVEEDGVQQLGVDVLRGPLQKMAVSRDGQWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLVMT
Sbjct  241  HDGRLLVMT  249



>ref|XP_008229565.1| PREDICTED: protein VACUOLELESS1 [Prunus mume]
Length=841

 Score =   390 bits (1002),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 215/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESA RKLRIF+S+G  + ET+WK+PGGRL+GM+WTDDQTL+C+ QDGTV+RY I AE L
Sbjct  61   GESAQRKLRIFSSSGHLLGETIWKHPGGRLIGMAWTDDQTLVCLVQDGTVFRYTIHAELL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E S+S+G++CF  +VVDCVFW NG+VCI E  Q+FCI DFKNPNP+KLADP +ED PL M
Sbjct  121  EPSISMGQECFERNVVDCVFWGNGLVCITETNQLFCISDFKNPNPVKLADPEIEDPPLCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDH-VLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ +GD  VL VEEDG+QQLG+ +  GP+QKM VSR+G+ LASFT
Sbjct  181  AVIEPQYTMSGNVEVLLGIGDACVLAVEEDGVQQLGLEVLRGPIQKMAVSRDGQWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLVMT
Sbjct  241  HDGRLLVMT  249



>ref|XP_008811095.1| PREDICTED: protein VACUOLELESS1 [Phoenix dactylifera]
Length=844

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 209/246 (85%), Gaps = 1/246 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ V+VAAEWQLL++RYYRK E+Y MQW  +DL R++VAC+PFGGP+A IRDD+KIVQLY
Sbjct  1    MAAVAVAAEWQLLHDRYYRKLEIYSMQWGRMDLARHRVACAPFGGPVAAIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE-P  427
            AESA RKL IFNSAGV +A   W  PGGRLVGM+WTDDQ+L+C+ QDGTVYRY++RAE  
Sbjct  61   AESARRKLHIFNSAGVHLASAAWDRPGGRLVGMAWTDDQSLVCVVQDGTVYRYNLRAELS  120

Query  428  LESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
                S+GK+CF   VV+CVFW NG++C+ E  Q+FC+PDFKNP P KLADPG+E++PL +
Sbjct  121  APQFSMGKECFEQGVVECVFWGNGMICLTEDRQIFCVPDFKNPKPCKLADPGIEEYPLCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
            TV+EPQYTMSGNVEVL+ VGD+VL VEEDG+QQLG+G+GPLQKM +S NGK LA+FTHDG
Sbjct  181  TVVEPQYTMSGNVEVLLGVGDYVLAVEEDGVQQLGIGVGPLQKMALSHNGKYLATFTHDG  240

Query  788  RLLVMT  805
            RLLV+T
Sbjct  241  RLLVIT  246



>ref|XP_007214933.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
 gb|EMJ16132.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
Length=844

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 214/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESA RKLRIF+S+G  + ET+WK+PGGRL+GM+WTDDQTL+C+ QDGTV+RY I  E L
Sbjct  61   GESAQRKLRIFSSSGHLLGETIWKHPGGRLIGMAWTDDQTLVCLVQDGTVFRYTIHTELL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E S+S+G++CF  +VVDCVFW NG+VCI E  Q+FCI DFKNPNP+KLADP +ED PL M
Sbjct  121  EPSISMGQECFERNVVDCVFWGNGLVCITETNQLFCISDFKNPNPVKLADPEIEDPPLCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDH-VLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ +GD  VL VEEDG+QQLG+ +  GP+QKM VSR+G+ LASFT
Sbjct  181  AVIEPQYTMSGNVEVLLGIGDACVLAVEEDGVQQLGLEVLRGPIQKMAVSRDGQWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLVMT
Sbjct  241  HDGRLLVMT  249



>ref|XP_010087860.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
 gb|EXB30296.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
Length=842

 Score =   384 bits (986),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 215/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY+M W HVDL+RN+VAC+PFGGPIAVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYRMGWLHVDLSRNRVACAPFGGPIAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIFNSAGV ++ETVWKNPGGRLV MSWTDDQTL C+ QDGTVYRY++ A+ L
Sbjct  61   SESALRKLRIFNSAGVLLSETVWKNPGGRLVAMSWTDDQTLACVVQDGTVYRYNVYAKLL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++S+GK+CF  +VVDCVFW NG+VCI E+ Q+FCI DFKNP   +LAD G+E+ P  M
Sbjct  121  EPNISMGKECFEQNVVDCVFWGNGLVCITESNQLFCISDFKNPKSSQLADTGIEEPPHCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGD-HVLLVEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYTMSGNVEVL+ VG+ +VL VEEDG+QQLG  +  GPLQKM VS +G+ LASFT
Sbjct  181  AVIEPQYTMSGNVEVLLGVGEAYVLAVEEDGVQQLGFEVLRGPLQKMAVSCDGQWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLV+T
Sbjct  241  HDGRLLVLT  249



>gb|KCW89755.1| hypothetical protein EUGRSUZ_A02017 [Eucalyptus grandis]
Length=742

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 214/250 (86%), Gaps = 6/250 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEW LLYNRYYRKPELY M+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWLLLYNRYYRKPELYPMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV IAETVWK+PGGRL+GMSWTDDQTLIC+ QDGTV+RY+I AE L
Sbjct  61   AESALRKLRIFNSAGVLIAETVWKHPGGRLIGMSWTDDQTLICLVQDGTVFRYNIHAELL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++S+GK+CF  +VVDCVFW NG+VCI +A Q+FC+ DFKNP P KL+D GLED PL +
Sbjct  121  EPNISMGKECFEQNVVDCVFWGNGLVCITDANQLFCVSDFKNPQPYKLSDSGLEDLPLCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGD-HVLLVEEDGIQQL----GVGIGPLQKMVVSRNGKLLAS  772
             VIEPQY MSGNVEVLM V +  +++VEED +Q++    G  +GPLQKM VS +GK LA+
Sbjct  181  AVIEPQYVMSGNVEVLMGVSEGGLVVVEEDSVQRVEQVGGEVLGPLQKMAVSGDGKWLAA  240

Query  773  FTHDGRLLVM  802
            FTHDG+LLVM
Sbjct  241  FTHDGQLLVM  250



>ref|XP_003551927.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   382 bits (982),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 213/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M WKHVDL R KVA +PFGGPIAVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMPWKHVDLARTKVAAAPFGGPIAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLR+F+S+G  +A+ VW++PGGRLVGMSWTDDQTL+C+ QDGTVYRYD+ A  +
Sbjct  61   AESALRKLRLFSSSGRPLADAVWRHPGGRLVGMSWTDDQTLLCVVQDGTVYRYDVHANLI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +LSLGK+CF  +V DCVFW NG+VCI EA Q+FCI DF+NP+ +KLADP +E+ P  M
Sbjct  121  EPNLSLGKECFEDNVADCVFWGNGLVCITEANQLFCIADFRNPSAVKLADPEIEEMPHCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLL-VEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYT+SGNVEVL+ V D V+L VEEDG+Q+LG G+  GPLQKMVVSR+GK LASFT
Sbjct  181  AVIEPQYTVSGNVEVLLGVDDAVVLAVEEDGVQRLGEGVLRGPLQKMVVSRDGKWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLV T
Sbjct  241  HDGRLLVTT  249



>ref|XP_004499978.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cicer arietinum]
Length=850

 Score =   382 bits (982),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 212/255 (83%), Gaps = 10/255 (4%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNKVA +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKVAAAPFGGPLAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESALRKLRIF+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRIFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +LSLGK+CF  +V DC FW NGVVCI EA Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITEANQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGD-------HVLLVEEDGIQQLGVGI--GPLQKMVVSRNGK  760
             VIEPQYT+SGNVEVL+ VGD        VL VEEDG+Q+LG  +  GPLQKMVVSR+GK
Sbjct  181  AVIEPQYTVSGNVEVLLGVGDGGEEEDAAVLAVEEDGVQRLGGEMLRGPLQKMVVSRDGK  240

Query  761  LLASFTHDGRLLVMT  805
             LASFTHDGRLLV T
Sbjct  241  WLASFTHDGRLLVTT  255



>ref|XP_010053830.1| PREDICTED: protein VACUOLELESS1 [Eucalyptus grandis]
Length=843

 Score =   382 bits (980),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 214/250 (86%), Gaps = 6/250 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEW LLYNRYYRKPELY M+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWLLLYNRYYRKPELYPMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV IAETVWK+PGGRL+GMSWTDDQTLIC+ QDGTV+RY+I AE L
Sbjct  61   AESALRKLRIFNSAGVLIAETVWKHPGGRLIGMSWTDDQTLICLVQDGTVFRYNIHAELL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++S+GK+CF  +VVDCVFW NG+VCI +A Q+FC+ DFKNP P KL+D GLED PL +
Sbjct  121  EPNISMGKECFEQNVVDCVFWGNGLVCITDANQLFCVSDFKNPQPYKLSDSGLEDLPLCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGD-HVLLVEEDGIQQL----GVGIGPLQKMVVSRNGKLLAS  772
             VIEPQY MSGNVEVLM V +  +++VEED +Q++    G  +GPLQKM VS +GK LA+
Sbjct  181  AVIEPQYVMSGNVEVLMGVSEGGLVVVEEDSVQRVEQVGGEVLGPLQKMAVSGDGKWLAA  240

Query  773  FTHDGRLLVM  802
            FTHDG+LLVM
Sbjct  241  FTHDGQLLVM  250



>ref|XP_003532091.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 213/249 (86%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M WKHVDL R KVA +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMPWKHVDLARTKVAAAPFGGPVAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLR+F+S+G  +A+ VW++PGGRLVGMSWTDDQTL+C+ QDGTVYRYD+ A  +
Sbjct  61   AESALRKLRLFSSSGRPLADAVWRHPGGRLVGMSWTDDQTLLCVVQDGTVYRYDVHANLI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +LSLGK+CF  +V DC FW +G+VCI EA Q+FCI DF+NP+ +KLADPG+++ P  M
Sbjct  121  EPNLSLGKECFEDNVADCAFWGHGLVCITEANQLFCIADFRNPSAVKLADPGIDEMPHCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLL-VEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYT+SGNVEVL+ V D V+L VEEDG+Q+LG G+  GPLQKMVVSR+GK LASFT
Sbjct  181  AVIEPQYTVSGNVEVLLGVDDAVVLAVEEDGVQRLGEGLLRGPLQKMVVSRDGKWLASFT  240

Query  779  HDGRLLVMT  805
            HDGRLLV T
Sbjct  241  HDGRLLVTT  249



>ref|XP_009416537.1| PREDICTED: protein VACUOLELESS1 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   379 bits (972),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 205/245 (84%), Gaps = 1/245 (0%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M++VSVA EWQLLYNR+YRK  +Y MQW  +DL+R+++A +PFGGP+A IRDD+KIVQLY
Sbjct  1    MTSVSVAGEWQLLYNRFYRKLTIYTMQWGRIDLSRHRIAAAPFGGPVAAIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESA RKL IFN+AG  +A  +W  PGGRLVGM+WTDDQ L+C+ QDGTVYRY++ AE  
Sbjct  61   AESARRKLLIFNAAGRALASAIWDRPGGRLVGMAWTDDQVLVCVVQDGTVYRYNVHAELC  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
                S+GK+CF   VVDCVFW NG+VCI E F +FC+PDFKNP P +L+DPG++++PL +
Sbjct  121  APQFSMGKECFEQGVVDCVFWGNGMVCITEGFLIFCVPDFKNPVPCRLSDPGIDEYPLCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
             VI+PQYTMSGNVEVL+ VGDHVLLVEEDG+QQLGVG+GP QKM VS+NGK LA+FTHDG
Sbjct  181  AVIDPQYTMSGNVEVLLGVGDHVLLVEEDGVQQLGVGVGPFQKMAVSQNGKYLATFTHDG  240

Query  788  RLLVM  802
            RLLV+
Sbjct  241  RLLVI  245



>ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=856

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/255 (70%), Positives = 212/255 (83%), Gaps = 10/255 (4%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNK+A +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKIAAAPFGGPLAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESALRKLR+F+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRLFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +LSLGK+CF  +V DC FW NGVVCI E+ Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITESNQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGD-------HVLLVEEDGIQQLGVGI--GPLQKMVVSRNGK  760
             VIEPQYT+SGNVEVL+ VGD        V+ VEEDG+Q+LG  +  GPLQKMVVSR+GK
Sbjct  181  AVIEPQYTVSGNVEVLLGVGDGGEEEDAAVIAVEEDGVQRLGGEMLRGPLQKMVVSRDGK  240

Query  761  LLASFTHDGRLLVMT  805
             LASFTHDGRLLV T
Sbjct  241  WLASFTHDGRLLVTT  255



>gb|KEH16900.1| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/255 (70%), Positives = 212/255 (83%), Gaps = 10/255 (4%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNK+A +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKIAAAPFGGPLAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESALRKLR+F+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRLFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +LSLGK+CF  +V DC FW NGVVCI E+ Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITESNQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGD-------HVLLVEEDGIQQLGVGI--GPLQKMVVSRNGK  760
             VIEPQYT+SGNVEVL+ VGD        V+ VEEDG+Q+LG  +  GPLQKMVVSR+GK
Sbjct  181  AVIEPQYTVSGNVEVLLGVGDGGEEEDAAVIAVEEDGVQRLGGEMLRGPLQKMVVSRDGK  240

Query  761  LLASFTHDGRLLVMT  805
             LASFTHDGRLLV T
Sbjct  241  WLASFTHDGRLLVTT  255



>gb|AES70033.2| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/255 (70%), Positives = 212/255 (83%), Gaps = 10/255 (4%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M+WKHVDL RNK+A +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHVDLARNKIAAAPFGGPLAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESALRKLR+F+S+G  +A+TVW+NPGGRL+GMSWTDD TL+C+ QDGTVYRYD+ A  +
Sbjct  61   GESALRKLRLFSSSGHLLADTVWRNPGGRLIGMSWTDDHTLVCVVQDGTVYRYDVHARLI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +LSLGK+CF  +V DC FW NGVVCI E+ Q+FCI DFKNPN +KLADPG+ + P  M
Sbjct  121  EPNLSLGKECFESNVADCAFWGNGVVCITESNQLFCIADFKNPNAVKLADPGIVEPPRCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGD-------HVLLVEEDGIQQLGVGI--GPLQKMVVSRNGK  760
             VIEPQYT+SGNVEVL+ VGD        V+ VEEDG+Q+LG  +  GPLQKMVVSR+GK
Sbjct  181  AVIEPQYTVSGNVEVLLGVGDGGEEEDAAVIAVEEDGVQRLGGEMLRGPLQKMVVSRDGK  240

Query  761  LLASFTHDGRLLVMT  805
             LASFTHDGRLLV T
Sbjct  241  WLASFTHDGRLLVTT  255



>ref|XP_010918871.1| PREDICTED: protein VACUOLELESS1 [Elaeis guineensis]
Length=846

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 200/238 (84%), Gaps = 1/238 (0%)
 Frame = +2

Query  95   EWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKL  274
            EWQLL++RYYRK E+Y MQW  +DL R++VAC+PFGGPIA IRDD+KIVQLYAESA RKL
Sbjct  11   EWQLLHDRYYRKLEIYSMQWGRMDLARHRVACAPFGGPIAAIRDDSKIVQLYAESARRKL  70

Query  275  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE-PLESLSLGK  451
             IFNSAGV +A   W  PGGRLVGM+WTDDQ+L+C+ QDGTVY Y++RAE      S+GK
Sbjct  71   HIFNSAGVPLASAAWDRPGGRLVGMAWTDDQSLVCVVQDGTVYFYNLRAELSAPQFSMGK  130

Query  452  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  631
            +CF   VV+CVFW NG++C+ E  Q+FC+PDFKNP P KLADPG+E++PL + VIEPQYT
Sbjct  131  ECFEQGVVECVFWGNGMICLTEDRQIFCVPDFKNPKPCKLADPGIEEYPLCVAVIEPQYT  190

Query  632  MSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            MSGNVEVL+ VGD+VL VEEDG+QQLG+G+GPLQKM VS NGK LA+FTHDGRLLV+T
Sbjct  191  MSGNVEVLLGVGDYVLAVEEDGVQQLGIGVGPLQKMAVSHNGKYLATFTHDGRLLVIT  248



>ref|XP_007146219.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
 gb|ESW18213.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
Length=843

 Score =   375 bits (963),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 211/249 (85%), Gaps = 4/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M WKHVDL R KVA +PFGGP+AVIRDD+KIVQL+
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMPWKHVDLARTKVAVAPFGGPVAVIRDDSKIVQLH  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLR+F+S+G  +A+TVW++ GGRL+GMSWTDDQTL+CI QDGTVYRYD+ A  +
Sbjct  61   AESALRKLRLFSSSGRPLADTVWRHSGGRLIGMSWTDDQTLLCIVQDGTVYRYDVHANLI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +LSLGK+CF  +V DC FW NG+VCI EA Q+FCI DF+NP  +KLADP +++ P  M
Sbjct  121  EPNLSLGKECFEDNVADCAFWGNGLVCITEANQLFCIADFRNPKAVKLADPMIDEMPHCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLL-VEEDGIQQLGVGI--GPLQKMVVSRNGKLLASFT  778
             VIEPQYT+SGNVEVL+ V D V+L VEEDG+Q+LG G+  GPLQKMVVSR+GK LASFT
Sbjct  181  AVIEPQYTVSGNVEVLLGVDDAVVLAVEEDGVQRLGEGVLRGPLQKMVVSRDGKWLASFT  240

Query  779  HDGRLLVMT  805
            HDG+LLV T
Sbjct  241  HDGKLLVTT  249



>ref|XP_010557595.1| PREDICTED: protein VACUOLELESS1 [Tarenaya hassleriana]
Length=861

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/267 (68%), Positives = 212/267 (79%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLL+NRYYRKPE+YQM+WKHVDL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLFNRYYRKPEIYQMRWKHVDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ I+ETVWKNPGGRLVGMSW+DDQTLICI QDGTVYRY+I +EP+
Sbjct  61   AESALRKLRIFNSAGILISETVWKNPGGRLVGMSWSDDQTLICIVQDGTVYRYNIHSEPI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E + S+GK+CF  +VV+CVFW NGVVC+ E  Q+ CIPDFK   P KLAD PG+ +    
Sbjct  121  EPNFSMGKECFEQNVVECVFWGNGVVCLTEGGQLSCIPDFKTMKPCKLADVPGMTEDEML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P  + V EPQYTMSGNVEVL+AVGD V +V+ED  Q +                 G  I
Sbjct  181  RPYCLAVREPQYTMSGNVEVLVAVGDGVFVVDEDEAQSIRFDGQSVADSEMQNADYGNMI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKMVVS NGK LA FTHDGR++V+
Sbjct  241  GPVQKMVVSPNGKFLALFTHDGRIIVV  267



>gb|KJB10620.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=680

 Score =   365 bits (937),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 212/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVDGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>gb|KHG27227.1| Vacuolar sorting-associated protein 16 [Gossypium arboreum]
Length=789

 Score =   367 bits (941),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 212/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGTEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVDGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>gb|KJB10619.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=772

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 212/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVDGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>gb|KJB10617.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=795

 Score =   366 bits (939),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 212/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVDGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>gb|KJB10618.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=844

 Score =   367 bits (941),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 212/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVDGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>gb|KJB10616.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=888

 Score =   367 bits (942),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 212/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY ++WK++DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPLRWKNIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+GV I++TVWKNPGGRL+GMSWT+DQTLICI QDGTVYRY+I AE +
Sbjct  61   SESALRKLRIFTSSGVLISDTVWKNPGGRLIGMSWTEDQTLICIVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E +++LGK+CF  +VV+C+FW NGVVC+ E   +FCIPDFK   P +LA+ G ED P  M
Sbjct  121  EPNVTLGKECFEQNVVECIFWGNGVVCLTEGGLLFCIPDFKVMRPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVDGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>ref|XP_007048987.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
 gb|EOX93144.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
Length=809

 Score =   364 bits (934),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 211/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHMDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+G  I+ETVWK+PGGRL+GMSWT+DQTLICI QDGTVYRY++ AE +
Sbjct  61   SESALRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYRYNVHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++SLGK+CF  +VV+C+FW NGVVC+ E   +F IPDFK  +P +LA+ G ED P  M
Sbjct  121  EPNVSLGKECFEQNVVECMFWGNGVVCLTEGGLLFGIPDFKVMSPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVEGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>ref|XP_007048986.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
 gb|EOX93143.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
Length=844

 Score =   363 bits (933),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 211/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHMDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+G  I+ETVWK+PGGRL+GMSWT+DQTLICI QDGTVYRY++ AE +
Sbjct  61   SESALRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYRYNVHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++SLGK+CF  +VV+C+FW NGVVC+ E   +F IPDFK  +P +LA+ G ED P  M
Sbjct  121  EPNVSLGKECFEQNVVECMFWGNGVVCLTEGGLLFGIPDFKVMSPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVEGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>ref|XP_007048985.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
 gb|EOX93142.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
Length=874

 Score =   364 bits (934),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 211/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPELYPMRWKHMDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIF S+G  I+ETVWK+PGGRL+GMSWT+DQTLICI QDGTVYRY++ AE +
Sbjct  61   SESALRKLRIFTSSGALISETVWKHPGGRLIGMSWTEDQTLICIVQDGTVYRYNVHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E ++SLGK+CF  +VV+C+FW NGVVC+ E   +F IPDFK  +P +LA+ G ED P  M
Sbjct  121  EPNVSLGKECFEQNVVECMFWGNGVVCLTEGGLLFGIPDFKVMSPCQLAETGAEDLPNCM  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-GVGI-GPLQKMVVSRNGKLLASFTH  781
             VIEP+YT+SGNVEVL+ VGD +L+V+EDG+Q++ G  + GP+QKMVVS +GK LA FTH
Sbjct  181  AVIEPKYTVSGNVEVLVGVGDGILIVDEDGVQRVEGEAVQGPVQKMVVSWDGKYLAIFTH  240

Query  782  DGRLLV  799
            DGR+LV
Sbjct  241  DGRILV  246



>ref|XP_011026232.1| PREDICTED: protein VACUOLELESS1-like isoform X1 [Populus euphratica]
Length=844

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 205/251 (82%), Gaps = 7/251 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            MS VSVAAEWQLL +RYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MSNVSVAAEWQLLTDRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIALIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHGECL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD--PGLEDFPL  601
            E + S+GKDCF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+   G+E+ P 
Sbjct  121  EPNFSMGKDCFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKEIKPCKLAEIGVGVEELPH  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDG---IQQLGVGIGPLQKMVVSRNGKLLAS  772
             M VIEPQYT+SGNVEVL+ VG   ++V+ED    I +  VG G +QK+ VS NG+ LA 
Sbjct  181  CMAVIEPQYTVSGNVEVLLGVGSGFVIVDEDEVRFIDEEKVG-GAVQKIAVSHNGRFLAC  239

Query  773  FTHDGRLLVMT  805
            F HDGR LVM 
Sbjct  240  FMHDGRFLVMN  250



>ref|XP_002302135.2| MANGLED family protein [Populus trichocarpa]
 gb|EEE81408.2| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 205/251 (82%), Gaps = 7/251 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            MS VSVAAEWQLL +RYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MSNVSVAAEWQLLTDRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIALIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHGECL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD--PGLEDFPL  601
            E + S+GKDCF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+   G+E+ P 
Sbjct  121  EPNFSMGKDCFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKEIKPCKLAEIGVGVEELPH  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDG---IQQLGVGIGPLQKMVVSRNGKLLAS  772
             M VIEPQYT+SGNVEVL+ VG   ++V+ED    I +  VG G +QK+ VS NG+ LA 
Sbjct  181  CMAVIEPQYTVSGNVEVLLGVGSGFVIVDEDEVRFIDEEKVG-GAVQKIAVSHNGRFLAC  239

Query  773  FTHDGRLLVMT  805
            F HDGR LVM 
Sbjct  240  FMHDGRFLVMN  250



>ref|XP_006411003.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
 gb|ESQ52456.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
Length=858

 Score =   360 bits (924),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/267 (65%), Positives = 210/267 (79%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL +    
Sbjct  121  EPNMTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTEDDLL  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P  + V EPQYTMSGNVEVL+AVGD + +V+ED  Q +                 G  I
Sbjct  181  QPTCLAVREPQYTMSGNVEVLVAVGDDIFVVDEDEAQTIRFDEPSVEDSEMQNDDYGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRIVVV  267



>ref|XP_011044765.1| PREDICTED: protein VACUOLELESS1-like [Populus euphratica]
Length=844

 Score =   356 bits (913),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 206/251 (82%), Gaps = 7/251 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLL NRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLINRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIAIIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHCEVL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL--EDFPL  601
            E + S+GK+CF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+ G+  E+ P 
Sbjct  121  EPNFSMGKECFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKQIKPCKLAEVGIGAEELPQ  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDG---IQQLGVGIGPLQKMVVSRNGKLLAS  772
             M VIEPQYT+SGNVEVL+ VG  +++V+ED    I +  +G G + K+ VS NG+ LA 
Sbjct  181  CMAVIEPQYTVSGNVEVLLGVGSGIVIVDEDEVRFIDEEKIG-GVVLKIAVSHNGRFLAC  239

Query  773  FTHDGRLLVMT  805
            F HDGRL+VM 
Sbjct  240  FMHDGRLVVMN  250



>emb|CDY07756.1| BnaA03g17550D [Brassica napus]
Length=858

 Score =   356 bits (913),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/267 (65%), Positives = 209/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSW+DDQTLI I QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            + ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL D    
Sbjct  121  QPNVTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTDDDML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P  + V EPQYTMSGNVEVL+AVGD + +V+ED  Q +                 G  I
Sbjct  181  QPTCLAVREPQYTMSGNVEVLVAVGDEIYVVDEDEAQSIRFDEPSVEDSEMQNDDNGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRVVVV  267



>gb|KDO51890.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=691

 Score =   352 bits (902),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 202/244 (83%), Gaps = 3/244 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQL+YNRYYRKPELYQM+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV I+ETVWKNPGGRL+GMSW++DQTLIC+ QDGTVYRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E + S+GK+CF  +VV+CVFW NGVVC+ EA + FC+ DF      +LA P +E+ P  +
Sbjct  121  EPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
             VIEP+YTM+G+VEVL+     +L+++EDG+Q++   +   QKM VS NG  +A FTHDG
Sbjct  181  AVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLS--QKMAVSPNGNFVACFTHDG  238

Query  788  RLLV  799
            RL+V
Sbjct  239  RLVV  242



>ref|XP_002306748.1| MANGLED family protein [Populus trichocarpa]
 gb|EEE93744.1| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 205/251 (82%), Gaps = 7/251 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLL NRYYRKPELY M+WKH+DL+RNKVAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLINRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIAIIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+  +ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY++  E L
Sbjct  61   AESALRKLRIFNSAGILFSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHCEVL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL--EDFPL  601
            E + S+GK+CF  +VVDCVFW NGVVC+ EA ++FC+PDFK   P KLA+ G+  E+ P 
Sbjct  121  EPNFSMGKECFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKQIKPCKLAEVGIGAEELPH  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDG---IQQLGVGIGPLQKMVVSRNGKLLAS  772
             M VIEPQYT+SGNVEVL+ VG  +++V+ED    I +  +G G + K+ VS NG+ LA 
Sbjct  181  CMAVIEPQYTVSGNVEVLLGVGSGIVIVDEDEVRFIDEEKIG-GVVLKIAVSHNGRFLAC  239

Query  773  FTHDGRLLVMT  805
            F HDGRL+VM 
Sbjct  240  FMHDGRLVVMN  250



>ref|XP_010505412.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   353 bits (907),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 207/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MTNVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ET+WK+PGGRL+GMSW+DDQTLIC+ QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGLLLSETIWKHPGGRLIGMSWSDDQTLICVVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DF    PIKL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFDTMKPIKLPDVPGLTEDDML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG-----------------I  721
             P  + V EP+YTMSG VEVL+AVGD +  VEED +Q   V                  I
Sbjct  181  QPTCLAVREPKYTMSGTVEVLVAVGDEIFGVEEDSVQTFRVDEPSVNESDVQDTDYGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRIVVV  267



>ref|XP_006296131.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
 gb|EOA29029.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
Length=858

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 207/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ET+WK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DF+   P KL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFEMMKPFKLPDVPGLTEDDML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG-----------------I  721
             P  + V EP+YTMSG VEVL+AVGD +  VEED +Q   V                  I
Sbjct  181  QPTCLAVREPEYTMSGTVEVLVAVGDEIFGVEEDSVQTFRVDEPSFKDSETQNDDYGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRIVVV  267



>ref|XP_006437140.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
 ref|XP_006484899.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Citrus sinensis]
 gb|ESR50380.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
Length=839

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 202/244 (83%), Gaps = 3/244 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQL+YNRYYRKPELYQM+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV I+ETVWKNPGGRL+GMSW++DQTLIC+ QDGTVYRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E + S+GK+CF  +VV+CVFW NGVVC+ EA + FC+ DF      +LA P +E+ P  +
Sbjct  121  EPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
             VIEP+YTM+G+VEVL+     +L+++EDG+Q++   +   QKM VS NG  +A FTHDG
Sbjct  181  AVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLS--QKMAVSPNGNFVACFTHDG  238

Query  788  RLLV  799
            RL+V
Sbjct  239  RLVV  242



>gb|KDO51887.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=839

 Score =   352 bits (903),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 202/244 (83%), Gaps = 3/244 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQL+YNRYYRKPELYQM+WKH+DL+RNKVAC+PFGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV I+ETVWKNPGGRL+GMSW++DQTLIC+ QDGTVYRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E + S+GK+CF  +VV+CVFW NGVVC+ EA + FC+ DF      +LA P +E+ P  +
Sbjct  121  EPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCV  180

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
             VIEP+YTM+G+VEVL+     +L+++EDG+Q++   +   QKM VS NG  +A FTHDG
Sbjct  181  AVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLS--QKMAVSPNGNFVACFTHDG  238

Query  788  RLLV  799
            RL+V
Sbjct  239  RLVV  242



>ref|XP_009133226.1| PREDICTED: protein VACUOLELESS1 [Brassica rapa]
Length=858

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 208/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSW+DDQTLI I QDGT+Y Y+I AE +
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYCYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            + ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL D    
Sbjct  121  QPNVTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTDDDML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P  + V EPQYTMSGNVEVL+AVGD + +V+ED  Q +                 G  I
Sbjct  181  QPTCLAVREPQYTMSGNVEVLVAVGDEIYVVDEDEAQSIRFDEPSVEDSEMQNDDYGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRIVVV  267



>emb|CDY14496.1| BnaC03g20990D [Brassica napus]
Length=858

 Score =   352 bits (903),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 208/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAGV ++ETVWK+PGGRL+GMSW+DDQTLI I QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGVLLSETVWKHPGGRLIGMSWSDDQTLISIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            + ++++GK+CF  +VV+CVFW NGVVC+ E  Q+FCI DFK   P KLAD PGL +    
Sbjct  121  QPNVTMGKECFEQNVVECVFWGNGVVCLTEGGQLFCISDFKTMKPYKLADVPGLTEDDML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P  + V EPQYTMSGNVEVL+AVG  + +V+ED  Q +                 G  I
Sbjct  181  QPTCLAVREPQYTMSGNVEVLVAVGHEIYVVDEDEAQSIRFDEPSGEDSEMQNDDYGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRVVVV  267



>ref|XP_010509236.1| PREDICTED: protein VACUOLELESS1 [Camelina sativa]
Length=858

 Score =   352 bits (902),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 207/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MTNVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ET+WK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGLLLSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+ CI DF+   P KL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLVCISDFETMKPSKLPDVPGLTEDDML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG-----------------I  721
             P S+ V EP+YTMSG VEVL+AVGD +  VEED +Q   V                  I
Sbjct  181  QPTSLAVREPKYTMSGTVEVLVAVGDEIFGVEEDSVQTFRVDEPSVNESDVQDTDYGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRIVVV  267



>ref|XP_002881559.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57818.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
Length=858

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 208/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMKWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++S+GK+CF  +VV+CVFW NGVVC+ E  Q+ CI DFK   P KL D PGL +    
Sbjct  121  EPNMSMGKECFEQNVVECVFWGNGVVCLTEGGQLVCIFDFKTMKPSKLPDVPGLAEDDLL  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P+ +TV EP+YTMSG  EVL+AVGD + +VEED +Q +                 G  I
Sbjct  181  QPICLTVREPKYTMSGIAEVLVAVGDDIFVVEEDMVQTIRFDEPSVEDSEMQNDDSGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            G +QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GVVQKMIVSPNGKFLTLFTHDGRIVVV  267



>gb|KDP24238.1| hypothetical protein JCGZ_26643 [Jatropha curcas]
Length=847

 Score =   347 bits (889),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 205/249 (82%), Gaps = 6/249 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQ+L NR+YRK E+YQMQWKHVDL+RNKVAC+ FGGPIA+IRDD+KIVQLY
Sbjct  1    MANVSVAAEWQVLLNRFYRKLEIYQMQWKHVDLSRNKVACAQFGGPIAIIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSWTDDQTLICI QDGT+YRY+I AE L
Sbjct  61   SESALRKLRIFNSAGILVSETVWKHPGGRLIGMSWTDDQTLICIVQDGTIYRYNINAECL  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL---EDFP  598
            E + S+GK+CF  +VVDCVFW NGVVC+ EA ++FC+ DFK+  P K+AD  +   E+ P
Sbjct  121  EPNFSMGKECFEQNVVDCVFWGNGVVCLTEAGKLFCVADFKDIKPYKMADLVVEMEEELP  180

Query  599  LSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG--IGPLQKMVVSRNGKLLAS  772
              M VIEPQYT+SGNVEVL+ +GD +L V++D ++ + +    GP+QK+ VS +G+ LA 
Sbjct  181  HCMAVIEPQYTVSGNVEVLLGMGDKILRVDDDDVRPVEIEELQGPVQKIAVSHDGRFLAC  240

Query  773  FTHDGRLLV  799
            F HDG L++
Sbjct  241  FRHDGTLVM  249



>ref|NP_565879.1| vacuoleless1 [Arabidopsis thaliana]
 sp|Q93VQ0.1|VCL1_ARATH RecName: Full=Protein VACUOLELESS1; AltName: Full=Vacuolar protein 
sorting-associated protein 16 homolog [Arabidopsis thaliana]
 gb|AAK43713.1|AF359240_1 VCL1 [Arabidopsis thaliana]
 gb|AAK82510.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AAM98105.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AEC09479.1| vacuoleless1 [Arabidopsis thaliana]
Length=858

 Score =   346 bits (887),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 208/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMKWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++S+G++CF  +VV+CVFW NGVVC+ E  Q+ CI DFK   P KL D PGL +    
Sbjct  121  EPNMSMGQECFEQNVVECVFWGNGVVCLTEGGQLICIFDFKTMKPSKLPDVPGLAEDDLL  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P+ +TV EP+YTMSG  EVL+AVGD + +VEED +Q +                 G  I
Sbjct  181  QPICLTVREPKYTMSGIAEVLVAVGDDIFVVEEDMVQTIRFDEPSVDDSEMQNDDSGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            G +QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GVVQKMIVSPNGKFLTLFTHDGRIVVV  267



>ref|NP_001078020.1| vacuoleless1 [Arabidopsis thaliana]
 gb|AEC09480.1| vacuoleless1 [Arabidopsis thaliana]
Length=834

 Score =   345 bits (886),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 208/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MANVSVAAEWQLLYDRYYRKPEIYQMKWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+ ++ETVWK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGILLSETVWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++S+G++CF  +VV+CVFW NGVVC+ E  Q+ CI DFK   P KL D PGL +    
Sbjct  121  EPNMSMGQECFEQNVVECVFWGNGVVCLTEGGQLICIFDFKTMKPSKLPDVPGLAEDDLL  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL-----------------GVGI  721
             P+ +TV EP+YTMSG  EVL+AVGD + +VEED +Q +                 G  I
Sbjct  181  QPICLTVREPKYTMSGIAEVLVAVGDDIFVVEEDMVQTIRFDEPSVDDSEMQNDDSGNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            G +QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GVVQKMIVSPNGKFLTLFTHDGRIVVV  267



>ref|XP_010517084.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   345 bits (886),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 204/267 (76%), Gaps = 23/267 (9%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLY+RYYRKPE+YQM+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLY
Sbjct  1    MTNVSVAAEWQLLYDRYYRKPEIYQMRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            AESALRKLRIFNSAG+  +ET+WK+PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +
Sbjct  61   AESALRKLRIFNSAGLLHSETIWKHPGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELI  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLED----  592
            E ++S+GK+C   +VV+CVFW NGVVC+ E  Q+FCI DF    P KL D PGL +    
Sbjct  121  EPNMSMGKECDEQNVVECVFWGNGVVCLTEGGQLFCISDFDTMKPSKLPDVPGLTEDDML  180

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG-----------------I  721
             P  + V EP+YTMSG VEVL+AVGD +  VEED +Q   V                  I
Sbjct  181  QPTCLAVREPKYTMSGTVEVLVAVGDEIFGVEEDSVQTFRVDEPNVNDSDVQNDDYVNLI  240

Query  722  GPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GP+QKM+VS NGK L  FTHDGR++V+
Sbjct  241  GPVQKMIVSPNGKFLTLFTHDGRIVVV  267



>ref|XP_002526647.1| vacuolar protein sorting vps16, putative [Ricinus communis]
 gb|EEF35735.1| vacuolar protein sorting vps16, putative [Ricinus communis]
Length=851

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 205/258 (79%), Gaps = 13/258 (5%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            MS VSVAAEWQLL   +YRK E+YQMQWK++D TR  VAC+PFGGPIA+IRDD+KIVQLY
Sbjct  1    MSNVSVAAEWQLLTTTFYRKQEIYQMQWKNIDFTRYIVACAPFGGPIAIIRDDSKIVQLY  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
            +ESALRKLRIFNSAG+ I+ETVWK+PGGRL+GMSWT+DQTLICI QDGT+YRY+I AE +
Sbjct  61   SESALRKLRIFNSAGILISETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNIHAEII  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL--EDFPL  601
            E + S+GK+CF  +VV+CVFW NGVVC+ +A ++FC+ DFK+  P+K+AD GL  E+ P 
Sbjct  121  EPNYSMGKECFEQNVVECVFWGNGVVCLTQAGKLFCVADFKDVKPVKMADLGLEFEEKPH  180

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGI----------GPLQKMVVSR  751
             M VIEPQ+T+SGNVEV++ VG+ ++ V+ED ++ + V +          GP+ K+ VS 
Sbjct  181  CMAVIEPQFTVSGNVEVILGVGEGLVNVDEDEVRHVQVNVSSGLSEEALLGPVSKIAVSH  240

Query  752  NGKLLASFTHDGRLLVMT  805
            NGK+LA F HDG L +++
Sbjct  241  NGKILACFRHDGSLALLS  258



>ref|XP_006854657.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
 gb|ERN16124.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
Length=855

 Score =   333 bits (853),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 200/244 (82%), Gaps = 1/244 (0%)
 Frame = +2

Query  77   TVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  256
            +VSVAAEWQ+L + YY+KPELY M W+++DL+R+K+AC+PFGGPIA +RD++KI+QL +E
Sbjct  2    SVSVAAEWQILSSHYYQKPELYSMCWRNMDLSRHKLACAPFGGPIAALRDESKIIQLLSE  61

Query  257  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE-  433
             A RKL+IFN+AG+ +A TVW  PGGRLV M+WTD QTL C+ QDGT++ YDI A  LE 
Sbjct  62   PARRKLQIFNAAGIPLASTVWDRPGGRLVAMAWTDHQTLACLVQDGTLFFYDIHAHILEP  121

Query  434  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  613
            SLS+G++C   +VV+CVFW NGVVC+ E   +FC+PD K+  P K ADPGLE+ PL M V
Sbjct  122  SLSMGRECREQNVVECVFWGNGVVCLTEGNLIFCVPDLKDLRPCKFADPGLEEPPLCMAV  181

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRL  793
            IEP++TMSGNVEVL+AV D++L+VEED +Q++G G+GP+QKM VS +GK LA+FTH G+L
Sbjct  182  IEPKHTMSGNVEVLLAVEDYILVVEEDVVQRVGEGLGPIQKMAVSPHGKYLAAFTHIGKL  241

Query  794  LVMT  805
            +V++
Sbjct  242  VVLS  245



>ref|XP_009377216.1| PREDICTED: LOW QUALITY PROTEIN: protein VACUOLELESS1 [Pyrus x 
bretschneideri]
Length=831

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 167/194 (86%), Gaps = 2/194 (1%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            M+ VSVAAEWQLLYNRYYRKPE+Y+M WKHV+L RNKVAC+PFGGPIAVIRDD+KIVQL 
Sbjct  1    MANVSVAAEWQLLYNRYYRKPEIYRMSWKHVELNRNKVACAPFGGPIAVIRDDSKIVQLG  60

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
             ESA RKLRIF+SAG  + ET+WK+PGGRL+GM+WTDDQ L+C+ QDGTV+RY I AE +
Sbjct  61   GESAQRKLRIFSSAGHLLGETIWKHPGGRLIGMAWTDDQNLVCLVQDGTVFRYTIHAELV  120

Query  431  E-SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            E S+S+GKD F  +VVDCVFW NGVVCI E  Q+FCI DFKNPNPIKLADP +ED PL M
Sbjct  121  EPSISMGKD-FERNVVDCVFWGNGVVCITETNQLFCISDFKNPNPIKLADPAIEDPPLCM  179

Query  608  TVIEPQYTMSGNVE  649
             VIEPQYTMSGNVE
Sbjct  180  AVIEPQYTMSGNVE  193



>dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila]
Length=833

 Score =   312 bits (799),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 186/242 (77%), Gaps = 23/242 (10%)
 Frame = +2

Query  146  MQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKN  325
            M+WKHVDL+RNKVAC+ FGGPIAVIRDD+KIVQLYAESALRKLRIFNSAG+ ++ETVWK+
Sbjct  1    MRWKHVDLSRNKVACASFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGILLSETVWKH  60

Query  326  PGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE-SLSLGKDCFTHSVVDCVFWHNGV  502
            PGGRL+GMSW+DDQTLICI QDGT+YRY+I AE +E ++++GK+CF  +VV+CVFW NGV
Sbjct  61   PGGRLIGMSWSDDQTLICIVQDGTIYRYNIHAELIEPNMTMGKECFEQNVVECVFWGNGV  120

Query  503  VCINEAFQVFCIPDFKNPNPIKLAD-PGLED----FPLSMTVIEPQYTMSGNVEVLMAVG  667
            VC+ E  Q+FCI DFK   P KLAD PGL +     P  + V EPQYTMSGNVEVL AVG
Sbjct  121  VCLTEGGQLFCISDFKTMKPYKLADVPGLTEDDLLQPTCLAVREPQYTMSGNVEVLAAVG  180

Query  668  DHVLLVEEDGIQQL-----------------GVGIGPLQKMVVSRNGKLLASFTHDGRLL  796
            D + +V+ED  Q +                 G  IGP+QKM+VS NGK LA FTHDGR++
Sbjct  181  DDIFVVDEDEAQTIRFDEPSVEDSEMQNDDYGNLIGPVQKMIVSPNGKFLALFTHDGRIV  240

Query  797  VM  802
            V+
Sbjct  241  VV  242



>ref|XP_001777594.1| predicted protein [Physcomitrella patens]
 gb|EDQ57637.1| predicted protein [Physcomitrella patens]
Length=837

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 176/243 (72%), Gaps = 1/243 (0%)
 Frame = +2

Query  77   TVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  256
             +S+AAEW+ LYNRYYRK E+Y M W  +DL+R+KVAC+ FGGPIA++RD++K+VQL AE
Sbjct  2    AISIAAEWEALYNRYYRKLEVYTMCWNGIDLSRHKVACARFGGPIAMVRDESKMVQLRAE  61

Query  257  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-E  433
            SA  KL +F+++G  ++   W  PGGRL+ + WTD++ L+ +  DGTV++Y+I  E + E
Sbjct  62   SARAKLLLFSASGKLLSSVPWDRPGGRLITLGWTDEEILLAVVHDGTVFQYNIHGELIPE  121

Query  434  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  613
             LSLG++C+   V DC+ W +G+V I E  Q+F IP+ +    +KLADP LED P  M V
Sbjct  122  QLSLGQECWDQGVADCIIWGSGLVVITEQNQLFSIPNLETKKVVKLADPHLEDPPHCMAV  181

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRL  793
            +EPQYT SG +EVL+AVG  VL+V+ED  Q   V  GP+QKM +S NG  LA FTHDGRL
Sbjct  182  VEPQYTFSGKLEVLLAVGPSVLVVDEDNFQDQMVDFGPIQKMTLSSNGNFLACFTHDGRL  241

Query  794  LVM  802
            LV+
Sbjct  242  LVV  244



>ref|XP_002963395.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
 gb|EFJ35266.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
Length=839

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 174/244 (71%), Gaps = 1/244 (0%)
 Frame = +2

Query  77   TVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  256
             VSVAAEW  + NRYYRK E+Y+M W +V+L+ +KVAC+ FGG IA+IRDD KIV+L +E
Sbjct  2    AVSVAAEWSAIANRYYRKQEIYRMAWHNVELSGHKVACARFGGMIAIIRDDTKIVRLRSE  61

Query  257  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-E  433
             A  KL IF S+G+ +A   W  PGGRL+ M W+D++ L C+ QDG+V+RYD+  + L +
Sbjct  62   PARPKLLIFRSSGLLVASITWDRPGGRLIAMGWSDEEILHCVMQDGSVFRYDVHGKLLPD  121

Query  434  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  613
             +  G++C+   +++C+ W NG+VC+ EA  VFCIPD  +P  +KLA   LED P  M +
Sbjct  122  KVWFGQECWDQGIMECIIWGNGIVCLTEANAVFCIPDLGSPQFVKLAQLTLEDPPHCMAI  181

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRL  793
            IEPQ+T+SG+VEVL+AV   V++V+   IQ  G  IGPL KMV S NG  +A FTHDGRL
Sbjct  182  IEPQHTVSGSVEVLLAVESTVMVVDGGSIQDQGTTIGPLGKMVASPNGSYVACFTHDGRL  241

Query  794  LVMT  805
            LV+T
Sbjct  242  LVVT  245



>ref|XP_002974680.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
 gb|EFJ24200.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
Length=839

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 173/244 (71%), Gaps = 1/244 (0%)
 Frame = +2

Query  77   TVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  256
             VSVAAEW  + NRYYRK E+Y+M W +V+L+ +KVAC+ FGG IA+IRDD KIV+L +E
Sbjct  2    AVSVAAEWSAIANRYYRKQEIYRMAWHNVELSGHKVACARFGGMIAIIRDDTKIVRLRSE  61

Query  257  SALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-E  433
             A  KL IF S+G+ +A   W  PGGRL+ M W+D++ L C+ QDG+V+RYD+  + L +
Sbjct  62   PARPKLLIFRSSGLLVASITWDRPGGRLIAMGWSDEEILHCVMQDGSVFRYDVHGKLLPD  121

Query  434  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  613
             +  G++C+   +++C+ W NG+VC+ EA  VFCIPD  +P  +KL    LED P  M +
Sbjct  122  KVWFGQECWDQGIMECIIWGNGIVCLTEANAVFCIPDLGSPQFVKLTQLTLEDPPHCMAI  181

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRL  793
            IEPQ+T+SG+VEVL+AV   V++V+   IQ  G  IGPL KMV S NG  +A FTHDGRL
Sbjct  182  IEPQHTVSGSVEVLLAVESTVMVVDGGSIQDQGTTIGPLGKMVASPNGSYVACFTHDGRL  241

Query  794  LVMT  805
            LV+T
Sbjct  242  LVVT  245



>ref|NP_001043804.2| Os01g0666800 [Oryza sativa Japonica Group]
 dbj|BAF05718.2| Os01g0666800 [Oryza sativa Japonica Group]
Length=310

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 162/280 (58%), Gaps = 37/280 (13%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK---------------------------HVDL  169
            S+VSVAAEW LL +R+YR+  +Y  + W                             +DL
Sbjct  3    SSVSVAAEWDLLSDRFYRRITVYSPLPWSPPSAAAASSSSTSGGGGGGGGSGGVLGRLDL  62

Query  170  TRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGM  349
            + + VA +PFGGPIA +RDD+KIVQL++E + R+L +++S+G  IA + W     RL  +
Sbjct  63   STHIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLYSSSGHPIASSPWPPQLPRLHSL  122

Query  350  SWTDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEA  520
            +++    L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E 
Sbjct  123  AFSSSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTED  182

Query  521  FQVFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVE  688
             +V    D    +P+P + ADP  G ++  L M V+EPQ+ MSG+ EVL+AVGD VL V+
Sbjct  183  NRVVVTTDIDAADPHPREFADPCVGQDEQVLCMAVVEPQFVMSGSPEVLLAVGDRVLAVD  242

Query  689  EDGIQQLG--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            ED +Q LG  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  243  EDDVQTLGLELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  282



>gb|ERZ97236.1| hypothetical protein GLOINDRAFT_334475 [Rhizophagus irregularis 
DAOM 181602]
Length=820

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 149/240 (62%), Gaps = 4/240 (2%)
 Frame = +2

Query  89   AAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
              +W  L +R+YRK E+Y M WK +DL++  +A +P+GGPIA+IRDD K++ L  +  ++
Sbjct  6    TTDWNQLQDRFYRKQEIYAMLWKQLDLSKFMIAGAPYGGPIAMIRDDKKVILLQKQQPVK  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + ++ SAG  + +  W    GR+V M W++ + L+ + +DGT+  YDI  E    LSL
Sbjct  66   PTIYLYTSAGKLMEQLQWDK--GRIVAMGWSESEKLVVVLEDGTIRLYDINGE-YTQLSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
             K+   +SV+DC  W  G+V +   F++  + +F+ P P  +ADPGL + P S TVI PQ
Sbjct  123  VKEAKEYSVIDCQIWGTGLVALTGNFKLIVLTNFEEPRPHLMADPGLNEPPHSWTVIPPQ  182

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A G  +L V+    Q   +  GP  KM VS NGK LA FT DG+L V++
Sbjct  183  YTLSRHVEVLLATGSTILTVDTKESQDQLLQQGPFTKMAVSPNGKFLALFTSDGKLWVVS  242



>emb|CDM83584.1| unnamed protein product [Triticum aestivum]
Length=398

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 166/271 (61%), Gaps = 28/271 (10%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK------------------HVDLTRNKVACSP  196
            S+VSVAAEW LL +R+YR+  +Y  + W                    +DL+ + VA +P
Sbjct  3    SSVSVAAEWDLLSDRFYRRITIYSPLPWSSPATTTASSSGGGSSGVSRLDLSTHIVAAAP  62

Query  197  FGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLI  376
            FGGPIA +RDD+KIVQL++E + R+L +F+S+G  +A + W     RL  ++++    L+
Sbjct  63   FGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPLASSPWTPHLPRLHSLAFSSSLNLL  122

Query  377  CITQDGTVYRYDI-RAEPLESLSLGK--DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDF  547
             +  DG++ R+ +    P+ S S        +  V D VFW  GV  + E  +V    D 
Sbjct  123  ALLSDGSLLRFRLPDLNPITSSSPVPLLPPASGGVADAVFWGGGVAILTEDNRVVVTTDI  182

Query  548  K--NPNPIKLADPGL--EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLG-  712
            +  +P+P +LADPG+  ++  L M V+EPQ  MSG+ EVL+AVGD V+ V+EDG+Q LG 
Sbjct  183  EVDDPHPRELADPGVAEDEQVLCMAVVEPQLVMSGSPEVLLAVGDRVVAVDEDGVQVLGE  242

Query  713  -VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  243  ALEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  273



>dbj|BAJ97322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=899

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 173/287 (60%), Gaps = 28/287 (10%)
 Frame = +2

Query  26   ARIIQSGAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQ-MQWK---------------  157
            AR     AP+S     S++SVAAEW LL +R+YR+  +Y  + W                
Sbjct  15   ARARSGRAPTSPRPMSSSISVAAEWDLLSDRFYRRVTIYSPLPWSSPATTTASSSGGGSS  74

Query  158  ---HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNP  328
                +DL+ + VA +PFGGPIA +RDD+KIVQL++E + R+L +F+S+G  +A + W   
Sbjct  75   GVGRLDLSTHIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPLASSPWTPH  134

Query  329  GGRLVGMSWTDDQTLICITQDGTVYRYDI-RAEPLESLSLGK--DCFTHSVVDCVFWHNG  499
              RL  ++++    L+ +  DG++ R+ +    P+ S S        +  V D VFW  G
Sbjct  135  LPRLHSLAFSSSLNLLALLSDGSLLRFRLPDLNPITSSSPVPLLPPASGGVADAVFWGGG  194

Query  500  VVCINEAFQVFCIPDFK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMSGNVEVLMAVG  667
            V  + E  +V    D +  +P+P +LADPG+  ++  L M V+EPQ+ MSG+ EVL+AVG
Sbjct  195  VAILTEDNRVVVTTDIEVDDPHPRELADPGVAEDEQVLCMAVVEPQFVMSGSPEVLLAVG  254

Query  668  DHVLLVEEDGIQQLG--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            D V+ V+EDG+Q LG  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  255  DRVVAVDEDGVQVLGEALEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  301



>ref|XP_010232114.1| PREDICTED: protein VACUOLELESS1 [Brachypodium distachyon]
Length=877

 Score =   191 bits (486),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 165/271 (61%), Gaps = 28/271 (10%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK------------------HVDLTRNKVACSP  196
            S+VSVAAEW LL +R+YR+  +Y  + W                    +DL+ + VA +P
Sbjct  3    SSVSVAAEWDLLSDRFYRRITIYSPLPWSSPATTTASSSGGGTGGVGRLDLSNHIVAAAP  62

Query  197  FGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLI  376
            FGGPIA +RDD+KIVQL++E + R+L +F+S+G  +A + W     RL  ++++    L+
Sbjct  63   FGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPLASSPWTPHLPRLHSLAFSSSLNLL  122

Query  377  CITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDF  547
             +  DG++ R+   D+   P  S        +  V D VFW  GV  + E  +V    D 
Sbjct  123  ALLSDGSLLRFRLPDLNPMPSSSPVPLLPPASGGVADAVFWGGGVAILTEDNRVVVTTDI  182

Query  548  K--NPNPIKLADP--GLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLG-  712
            +  +P+P +LADP  G ++  L M V+EPQ+ MSG+ EVL+AVGD V+ V+EDG+Q LG 
Sbjct  183  EVDDPHPRELADPCVGEDEQVLCMAVVEPQFVMSGSPEVLLAVGDRVVAVDEDGVQVLGE  242

Query  713  -VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  243  TLEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  273



>ref|XP_005650736.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26192.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
Length=859

 Score =   191 bits (484),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 95/242 (39%), Positives = 149/242 (62%), Gaps = 3/242 (1%)
 Frame = +2

Query  83   SVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESA  262
            + A EW+   +R+Y K ELY M W  V L + +VAC+ +GGPIA++RDD K+V +     
Sbjct  3    AAAGEWEACGDRFYEKHELYTMAWSDVKLDQMRVACARYGGPIAMVRDDRKLVVVSGGIT  62

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL-ESL  439
               +RIF +AG  +A  +W +  GR+ GM WT+++ L+ I   G V+ Y +  + L  S 
Sbjct  63   KPVVRIFTAAGETLAAFLWDH--GRIAGMGWTNEEDLLIIEDGGEVHMYSMHGQKLPRSF  120

Query  440  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  619
            SLG +     V DCV + +G+V +  A +++ + + + P P KLA  GL + P    VIE
Sbjct  121  SLGAEVAAERVTDCVVYGDGLVALTGAHRLWTVSNLEEPRPQKLALSGLTEPPHCFAVIE  180

Query  620  PQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
            P++T+SG VEVL+A G+ V+LV+ D     G+  GP+ K+ V+ NG+ +A+FT +G+L+V
Sbjct  181  PRHTLSGCVEVLVAAGESVILVDADAANDAGLPNGPVTKLSVAPNGQFVAAFTGEGKLVV  240

Query  800  MT  805
             T
Sbjct  241  WT  242



>gb|EEE55144.1| hypothetical protein OsJ_02938 [Oryza sativa Japonica Group]
Length=988

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 162/280 (58%), Gaps = 37/280 (13%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK---------------------------HVDL  169
            S+VSVAAEW LL +R+YR+  +Y  + W                             +DL
Sbjct  3    SSVSVAAEWDLLSDRFYRRITVYSPLPWSPPSAAAASSSSTSGGGGGGGGSGGVLGRLDL  62

Query  170  TRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGM  349
            + + VA +PFGGPIA +RDD+KIVQL++E + R+L +++S+G  IA + W     RL  +
Sbjct  63   STHIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLYSSSGHPIASSPWPPQLPRLHSL  122

Query  350  SWTDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEA  520
            +++    L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E 
Sbjct  123  AFSSSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTED  182

Query  521  FQVFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVE  688
             +V    D    +P+P + ADP  G ++  L M V+EPQ+ MSG+ EVL+AVGD VL V+
Sbjct  183  NRVVVTTDIDAADPHPREFADPCVGQDEQVLCMAVVEPQFVMSGSPEVLLAVGDRVLAVD  242

Query  689  EDGIQQLG--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            ED +Q LG  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  243  EDDVQTLGLELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  282


 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 94/157 (60%), Gaps = 9/157 (6%)
 Frame = +2

Query  359  DDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQV  529
            D   L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E  +V
Sbjct  292  DSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTEDNRV  351

Query  530  FCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDG  697
                D    +P+P + ADP  G ++  L M V+EPQ+ MSG+ EVL+AVGD VL V+ED 
Sbjct  352  VVTTDIDAADPHPREFADPCVGQDEQVLCMAVVEPQFVMSGSPEVLLAVGDRVLAVDEDD  411

Query  698  IQQLG--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            +Q LG  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  412  VQTLGLELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  448



>gb|KFH65750.1| hypothetical protein MVEG_07854 [Mortierella verticillata NRRL 
6337]
Length=820

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/239 (39%), Positives = 149/239 (62%), Gaps = 4/239 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-  268
            A+W  L +R+YRK E+Y M W+ +DL++  +A +PFGGP+A+ RDD K++ L  +   + 
Sbjct  6    ADWIQLQDRFYRKQEIYTMVWEQIDLSKCMIAAAPFGGPLALARDDRKVLLLQKQQPAKP  65

Query  269  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  448
             + ++ S+G ++    W    GR++GM WTD + L+C+ +DG V  Y+I  E     SLG
Sbjct  66   SINLYTSSGKRMEPIQWDK--GRIIGMGWTDTEQLLCVLEDGLVRMYNILGE-YTQFSLG  122

Query  449  KDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQY  628
            K+   + V+D   W  G+V +  +FQ+  + +F  P P  LAD G+ + P S TVI P++
Sbjct  123  KEAKENKVIDVQIWGTGLVALTGSFQLIAVTNFDEPRPKVLADAGINEPPHSWTVIPPKF  182

Query  629  TMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            T+S +VEVL+A+   +L+V+    +   +  GP +KM VS +GK LA FT+DGRL V++
Sbjct  183  TLSRHVEVLLAINSTILVVDATEARDERLQEGPFKKMSVSPDGKYLALFTNDGRLWVVS  241



>dbj|BAB90498.1| vacuolar protein sorting-associated protein VPS16-like [Oryza 
sativa Japonica Group]
Length=892

 Score =   189 bits (480),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/278 (40%), Positives = 160/278 (58%), Gaps = 37/278 (13%)
 Frame = +2

Query  80   VSVAAEWQLLYNRYYRKPELYQ-MQWK---------------------------HVDLTR  175
            VSVAAEW LL +R+YR+  +Y  + W                             +DL+ 
Sbjct  53   VSVAAEWDLLSDRFYRRITVYSPLPWSPPSAAAASSSSTSGGGGGGGGSGGVLGRLDLST  112

Query  176  NKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSW  355
            + VA +PFGGPIA +RDD+KIVQL++E + R+L +++S+G  IA + W     RL  +++
Sbjct  113  HIVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLYSSSGHPIASSPWPPQLPRLHSLAF  172

Query  356  TDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQ  526
            +    L+ +  DG++ R+   D++  P  +        +  V D  FW  GV  + E  +
Sbjct  173  SSSLNLVALLSDGSLLRFRLPDLKPNPSPTPVPLLPTSSGGVADAAFWGGGVAVLTEDNR  232

Query  527  VFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEED  694
            V    D    +P+P + ADP  G ++  L M V+EPQ+ MSG+ EVL+AVGD VL V+ED
Sbjct  233  VVVTTDIDAADPHPREFADPCVGQDEQVLCMAVVEPQFVMSGSPEVLLAVGDRVLAVDED  292

Query  695  GIQQLG--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             +Q LG  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  293  DVQTLGLELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  330



>ref|XP_004969467.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Setaria italica]
Length=874

 Score =   186 bits (472),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 163/272 (60%), Gaps = 29/272 (11%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK-------------------HVDLTRNKVACS  193
            S+VSVAAEW LL +R+YR+  LY  + W                     +DL+ + VA +
Sbjct  3    SSVSVAAEWDLLSDRFYRRLTLYSPLPWSAPAPTSTSSSSGVGGPVIGRLDLSTHIVAAA  62

Query  194  PFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTL  373
            PFGGPIA +RDD+KIVQL++E + R+L +F+S+G  IA   W     RL  ++++   +L
Sbjct  63   PFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPIASAPWPPMLPRLHSLAFSSSLSL  122

Query  374  ICITQDGTVYRYDIRAEPLESLSLGKDCFTHS---VVDCVFWHNGVVCINEAFQVFCIPD  544
            + +  DG++ R+ +        S        +   V D VFW  GV  + E  +V    D
Sbjct  123  LGLISDGSLLRFRLPDLQPSPSSSPMPLLPPASGGVADAVFWGGGVAILTEDNRVVVATD  182

Query  545  FK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLG  712
             +  +P+P  LADPG+  E+  L M V+EPQ+ MSG+ EVL+AVGD V+ V+EDG+Q LG
Sbjct  183  IEADDPHPRDLADPGVGDEEHVLCMAVVEPQFVMSGSPEVLLAVGDRVVAVDEDGVQVLG  242

Query  713  --VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
              + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  243  EELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  274



>ref|XP_004345413.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE95370.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
Length=835

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 154/257 (60%), Gaps = 14/257 (5%)
 Frame = +2

Query  65   LRMSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKV-------ACSPFGGPIAVIR  223
            + +  ++ AA W  L +R+YRK E+Y M W+ +DL    +       + +PFGGPIA++R
Sbjct  1    MELEEINPAASWSPLQDRFYRKLEMYDMAWRSIDLAWRSIDLAMYVISAAPFGGPIALMR  60

Query  224  DDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY  403
            D++KI++  A+   R + I+N+AG   A+  W   G R+VG+ W++ + LIC+ +DGTV 
Sbjct  61   DNSKIIR--AQRTKRDIFIYNAAGTPFAQIPWD--GARIVGLGWSEQEELICVLEDGTVR  116

Query  404  RYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLAD  577
             +D++ EP+ + + G +    +V++C F+ +GVV +  AF  + I  F    P P +LA+
Sbjct  117  IFDVQGEPIRTFTFGHEVKDQTVIECKFYGSGVVILTGAFVFYAITTFSEEAPQPRRLAE  176

Query  578  -PGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRN  754
             P +   P S  VIEPQ++++  VEVL AVG+ + +V+    Q   +  GP   + VS N
Sbjct  177  IPEMTAAPTSWVVIEPQFSINHGVEVLAAVGNTIYVVDAADAQDQMLTDGPYTALTVSPN  236

Query  755  GKLLASFTHDGRLLVMT  805
            G+LLA F+  G L V++
Sbjct  237  GRLLAMFSETGVLWVVS  253



>emb|CEG71651.1| hypothetical protein RMATCC62417_07353 [Rhizopus microsporus]
Length=820

 Score =   182 bits (463),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 88/240 (37%), Positives = 146/240 (61%), Gaps = 4/240 (2%)
 Frame = +2

Query  89   AAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
             A+W  L++R+Y+K E+Y + W   DL++  +A + +GGPIA+IRDD K++ L  +  ++
Sbjct  6    TADWTELHDRFYKKQEIYSLSWNQSDLSKFMIAGAQYGGPIAMIRDDRKVLLLQKQQPIK  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + ++ SAG  I +  W    G++VG+ WT+ + L+ +T+DG+V  Y +  +     SL
Sbjct  66   PTIYMYTSAGKLIEQIQWDK--GKIVGLGWTEQEQLVVVTEDGSVRLYTLHGQ-FSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            GK+     ++DC  W  G+V +   +Q+  + +F  P P  LAD  L++ P S T++ PQ
Sbjct  123  GKEAKDDGIIDCQIWGGGLVAMTSKYQLISVTNFLEPQPKPLADIRLDEPPHSWTIVPPQ  182

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+A G  +L+V+ +      +  GP  KM VS NGK LA FT DG+L V++
Sbjct  183  FTLSRHVEVLIATGSTILVVDSNEATDEHLTQGPFTKMAVSPNGKFLALFTADGKLWVVS  242



>emb|CEP18375.1| hypothetical protein [Parasitella parasitica]
Length=820

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 144/240 (60%), Gaps = 4/240 (2%)
 Frame = +2

Query  89   AAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
             ++W  L++R+YRK E+Y + W   DL++  +A + +GGPIA+IRDD K++ L  +  ++
Sbjct  6    TSDWTELHDRFYRKQEIYSLTWNQTDLSKFMIAGAQYGGPIAMIRDDKKVLLLQKQQPIK  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + ++ SAG  I +  W    GR+VG+ WTD + L+ +T DG+V  Y +        SL
Sbjct  66   PTIYMYTSAGKLIEQIQWDK--GRIVGLGWTDQEQLVVVTDDGSVRLYALDGN-YTQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            GKD  +  ++DC  W  G++ +   +Q+  +  F  P P  +A+  L++   S TV+ PQ
Sbjct  123  GKDAKSDGIIDCQIWGGGLIAMTGKYQLISLTKFDEPQPRMMAELKLDEPFHSWTVVPPQ  182

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+A G  +L+V+   +    +  GP  KMVVS NGK LA FT DG+L V++
Sbjct  183  FTLSRHVEVLIATGSTILVVDGKEVTDQHLNQGPFTKMVVSPNGKFLALFTSDGKLWVVS  242



>dbj|GAN01171.1| vacuolar protein sorting vps16 protein [Mucor ambiguus]
Length=820

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 144/240 (60%), Gaps = 4/240 (2%)
 Frame = +2

Query  89   AAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
             ++W  L++R+YRK E+Y + W   DL++  ++ + +GGPIA+IRDD K++ L  +  ++
Sbjct  6    TSDWTELHDRFYRKQEIYTLSWNQTDLSKFMISGAQYGGPIAMIRDDKKVLLLQKQQPIK  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + ++ SAG  + +  W    GR+V + WTD + L+ +T DG+V  Y +        SL
Sbjct  66   PTIYMYTSAGKLMEQIQWDK--GRIVALGWTDQEQLVVVTDDGSVRLYTLHGH-YTQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            GKD     ++DC  W  G+V +   +Q+  + +F+ P P  +A+  L++   S TV+ PQ
Sbjct  123  GKDAKNDGIIDCQIWGGGLVAMTGKYQLISLTNFEEPQPKMMAELRLDEPLHSWTVVPPQ  182

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+A G  +L+V+   +    +  GP  KMVVS NGK LA FT DG+L V++
Sbjct  183  FTLSRHVEVLIATGSTILVVDSKEVTDQHLNQGPFTKMVVSPNGKFLALFTSDGKLWVVS  242



>gb|AFW83494.1| hypothetical protein ZEAMMB73_114694 [Zea mays]
Length=726

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 164/273 (60%), Gaps = 30/273 (11%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK--------------------HVDLTRNKVAC  190
            S+VS+AAEW LL +R+YR+  LY  + W                      +DL+ + VA 
Sbjct  3    SSVSIAAEWDLLSDRFYRRLTLYSPLPWSTPAAAGATSSSSGVSGAVIGRLDLSTHIVAA  62

Query  191  SPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQT  370
            +PFGGPIA +RDD+KIVQL++E + R++ +F+S+G  IA   W     RL  + ++   +
Sbjct  63   APFGGPIAAVRDDSKIVQLHSEPSRRRVLLFSSSGHPIASAPWPPLLPRLHSLGFSSSLS  122

Query  371  LICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP  541
            L+ +  DG++ R+   D++  P  S        +  V D +FW  GV  + E  +V    
Sbjct  123  LLALLSDGSLLRFRLPDLQPSPCSSPVPLLPPASGGVADALFWGGGVAILTEDNRVVVAT  182

Query  542  DFK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL  709
            D +  +P+P  LADPG+  E+  L M V+E Q+ MSG+ EVL+AVGD V+ V+EDG+Q L
Sbjct  183  DIEVDDPHPRHLADPGIGDEEHVLCMAVVEAQFVMSGSPEVLLAVGDRVIAVDEDGVQVL  242

Query  710  G--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            G  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  243  GEELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  275



>ref|XP_006646183.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog, 
partial [Oryza brachyantha]
Length=825

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 142/223 (64%), Gaps = 9/223 (4%)
 Frame = +2

Query  161  VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRL  340
            +DL+ + VA +PFGGPIA +RDD+KIVQL++E + R+L +F+S+G  IA + W     RL
Sbjct  1    LDLSTHVVAAAPFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSGHPIASSPWPPQLPRL  60

Query  341  VGMSWTDDQTLICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCI  511
              ++++    L+ +  DG++ R+   D++  P           +  V D  FW  GVV +
Sbjct  61   HSLAFSSSLNLVALLSDGSLLRFRLPDLKPNPSSIPVPLLPPSSGGVADAAFWGGGVVVL  120

Query  512  NEAFQVFCIPDFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVL  679
             E  +V    D    +P+P +L DP  G ++  L M V+EPQ+ MSG+ EVL+AVG  VL
Sbjct  121  TEDNRVVVTTDIDAADPHPRELPDPSVGPDEQVLCMAVVEPQFVMSGSPEVLLAVGGRVL  180

Query  680  LVEEDGIQQLGVG--IGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            +V+EDG+Q LG G  IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  181  VVDEDGVQTLGEGLEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  223



>ref|XP_008656726.1| PREDICTED: protein VACUOLELESS1 [Zea mays]
Length=877

 Score =   178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 164/273 (60%), Gaps = 30/273 (11%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK--------------------HVDLTRNKVAC  190
            S+VS+AAEW LL +R+YR+  LY  + W                      +DL+ + VA 
Sbjct  3    SSVSIAAEWDLLSDRFYRRLTLYSPLPWSTPAAAGATSSSSGVSGAVIGRLDLSTHIVAA  62

Query  191  SPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQT  370
            +PFGGPIA +RDD+KIVQL++E + R++ +F+S+G  IA   W     RL  + ++   +
Sbjct  63   APFGGPIAAVRDDSKIVQLHSEPSRRRVLLFSSSGHPIASAPWPPLLPRLHSLGFSSSLS  122

Query  371  LICITQDGTVYRY---DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP  541
            L+ +  DG++ R+   D++  P  S        +  V D +FW  GV  + E  +V    
Sbjct  123  LLALLSDGSLLRFRLPDLQPSPCSSPVPLLPPASGGVADALFWGGGVAILTEDNRVVVAT  182

Query  542  DFK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL  709
            D +  +P+P  LADPG+  E+  L M V+E Q+ MSG+ EVL+AVGD V+ V+EDG+Q L
Sbjct  183  DIEVDDPHPRHLADPGIGDEEHVLCMAVVEAQFVMSGSPEVLLAVGDRVIAVDEDGVQVL  242

Query  710  G--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            G  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  243  GEELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  275



>ref|XP_002456108.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
 gb|EES01228.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
Length=825

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 160/273 (59%), Gaps = 30/273 (11%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELYQ-MQWK--------------------HVDLTRNKVAC  190
            S+VS+AAEW LL +R+YR+  LY  + W                      +DL+ + VA 
Sbjct  86   SSVSIAAEWDLLSDRFYRRLTLYSPLPWSAPAAAGATSSSSGVGGAVIGRLDLSTHIVAA  145

Query  191  SPFGGPIAVIRDDAKIVQLYAESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQT  370
            +PFGGPIA +RDD+KIVQL++E + R+L +F+S+   IA   W     RL  ++++   +
Sbjct  146  APFGGPIAAVRDDSKIVQLHSEPSRRRLLLFSSSAHPIASAPWPPLLPRLHSLAFSSSLS  205

Query  371  LICITQDGTVYRYDIRAEPLESLSLGKDCF---THSVVDCVFWHNGVVCINEAFQVFCIP  541
            L+ +  DG++ R+ +        S         +  V D  FW  GV  + E  +V    
Sbjct  206  LLALLSDGSLLRFRLPDLQPSPSSSPVPLLPPDSGGVADAQFWGGGVAILTEDNRVVVAT  265

Query  542  DFK--NPNPIKLADP--GLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQL  709
            D +  +P+P  LADP  G E+  L M V+EPQ+ MSG+ EVL+AVGD V+ V+EDG+Q L
Sbjct  266  DIEADDPHPRDLADPDIGDEEHVLCMAVVEPQFVMSGSPEVLLAVGDRVIAVDEDGVQVL  325

Query  710  GV--GIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            GV   IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  326  GVELEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  358



>ref|XP_005839798.1| hypothetical protein GUITHDRAFT_161084 [Guillardia theta CCMP2712]
 gb|EKX52818.1| hypothetical protein GUITHDRAFT_161084 [Guillardia theta CCMP2712]
Length=824

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 138/231 (60%), Gaps = 5/231 (2%)
 Frame = +2

Query  89   AAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A  W  L++RYYRK E+Y+M W  VDL++  VA SPF GP A++RDD KI  + A S   
Sbjct  9    AGGWNKLFDRYYRKQEIYEMSWSDVDLSKMIVAGSPFAGPFAMLRDDKKISLISAGSLRP  68

Query  269  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  448
             L I++S+G  +A    +   GR+V M WT D+ LI +  DGTV ++      +++ S+G
Sbjct  69   TLNIYSSSGSLLASIPAQWKTGRVVEMGWTSDEKLIVVLDDGTVMQFSAVGRLIQTFSMG  128

Query  449  KDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDF---PLSMTVIE  619
            ++  T  V+ C  W +GVVC++ +  +  + +F+ P P ++  P L D    P  M +IE
Sbjct  129  EEFRTDRVLLCCIWGSGVVCLSRSHSLVFVDNFEEPIPRRM--PRLGDIASSPTCMVIIE  186

Query  620  PQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLAS  772
            P  T S  +EVL+AV   +L+V+  G++   +  GP+++M V  NGK+LA+
Sbjct  187  PSMTQSKGLEVLLAVDKTILVVDMTGVEDQKLTAGPIRRMSVCPNGKMLAA  237



>ref|XP_004340672.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18630.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
Length=861

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 142/238 (60%), Gaps = 5/238 (2%)
 Frame = +2

Query  98   WQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KL  274
            W+ L +R YRK ELY + W+ VDL+++ V  +P GG +AV RD+ KIV L    +L+ + 
Sbjct  35   WKPLGDRNYRKRELYDLNWE-VDLSKHVVTGAPCGGALAVARDERKIVLLANTESLKSQT  93

Query  275  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKD  454
             I+ S+GV I    W +  GR+V + WT D+ L+CI + G V  Y+++ E + + S+G +
Sbjct  94   HIYTSSGVLIKSFAWDSQKGRVVRLGWTADEKLVCIFESGAVMIYNVQGENVSAWSVGPE  153

Query  455  CFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTM  634
            C    + D +FW  G V +++A ++F + +  +P    L D  LE  P++  VI P  ++
Sbjct  154  C--GEIQDALFWGTGFVVLSKALRLFAVMNLADPKIRPLPDARLESAPVTWCVIGPDVSL  211

Query  635  SGNVEVLMAVGD-HVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            S  VEVL+A     VLLV  + ++ L +  GP  +M VSRNGKL+A FT  G L V++
Sbjct  212  SKGVEVLLATATGTVLLVTHEHVKDLLLQNGPFVRMTVSRNGKLIACFTEAGTLWVVS  269



>ref|XP_006682562.1| hypothetical protein BATDEDRAFT_14644 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76689.1| hypothetical protein BATDEDRAFT_14644 [Batrachochytrium dendrobatidis 
JAM81]
Length=749

 Score =   165 bits (417),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/249 (34%), Positives = 146/249 (59%), Gaps = 3/249 (1%)
 Frame = +2

Query  65   LRMSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQ  244
            + ++  S   +W  L +++YRK ELYQM W  VDL +  VA +PFGGPIA++R+D K+V 
Sbjct  1    MSLAYTSPCGDWNPLADKFYRKYELYQMIWNKVDLAKMTVAAAPFGGPIAMMRNDRKMVA  60

Query  245  LYAESALRKLRIFNSAGVQIAE--TVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  418
            + A S+   + I+ S+G  + +      +   R++ M WT  + L+C+ + G++  YD++
Sbjct  61   VAALSSKPVMHIYTSSGKLLTQFQASLNHRANRIIVMGWTLKERLVCVMEYGSLRLYDLQ  120

Query  419  AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFP  598
             + ++ ++LG++   + V+D   W N  V +    ++  + +   P PI LA+PGL   P
Sbjct  121  GDFVQ-ITLGEEAKENGVLDAHVWENSAVILTTNLKLILVANLDEPRPILLANPGLVQPP  179

Query  599  LSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFT  778
             S + I   Y++S +VE+L+AV + +++V+    Q   +  GP  +M VS N K LA FT
Sbjct  180  HSWSFISATYSLSKHVEILLAVNNTIVVVDAKNAQDQMLQQGPFTRMAVSPNAKFLALFT  239

Query  779  HDGRLLVMT  805
             +GRL V++
Sbjct  240  ANGRLWVVS  248



>emb|CDH59927.1| vacuolar protein sorting vps16 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=785

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 124/209 (59%), Gaps = 4/209 (2%)
 Frame = +2

Query  182  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  358
            +A S FGGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W+   GR++ + WT
Sbjct  2    IAGSQFGGPIAMIRDDKKVLLLQKQQPIKPTVYMYTSAGKLIEQIQWEK--GRIIALGWT  59

Query  359  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  538
              + L+ +T+DG V  Y +     +  SLGK+     ++DC  W  G+V +   +++  +
Sbjct  60   KHEELVIVTEDGFVRLYPLHGSYTQ-FSLGKEAKEQGILDCQIWSTGLVAMTNKYKLIAV  118

Query  539  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG  718
             DF  P P  +AD GL+D P S TVI PQYT+S +VEVL+A G  +++V+        + 
Sbjct  119  TDFYEPRPKLMADTGLDDKPHSWTVIPPQYTLSRHVEVLIATGSTIIVVDNKESVDQRLQ  178

Query  719  IGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
             GP  KM +S NGK LA FT DG+L V++
Sbjct  179  QGPFTKMAISPNGKFLALFTSDGKLWVVS  207



>emb|CEJ04541.1| Putative Vacuolar protein sorting vps16 [Rhizopus microsporus]
Length=608

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 126/209 (60%), Gaps = 4/209 (2%)
 Frame = +2

Query  182  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  358
            +A + +GGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W    G++VG+ WT
Sbjct  2    IAGAQYGGPIAMIRDDRKVLLLQKQQPIKPTIYMYTSAGKLIEQIQWDK--GKIVGLGWT  59

Query  359  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  538
            + + L+ +T+DG+V  Y +  +     SLGK+     ++DC  W  G+V +   +Q+  +
Sbjct  60   EQEQLVVVTEDGSVRLYTLHGQ-FSQFSLGKEAKDDGIIDCQIWGGGLVAMTSKYQLISV  118

Query  539  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG  718
             +F  P P  LAD  L++ P S T++ PQ+T+S +VEVL+A G  +L+V+ +      + 
Sbjct  119  TNFLEPQPKPLADIRLDEPPHSWTIVPPQFTLSRHVEVLIATGSTILVVDSNEATDEHLT  178

Query  719  IGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
             GP  KM VS NGK LA FT DG+L V++
Sbjct  179  QGPFTKMAVSPNGKFLALFTADGKLWVVS  207



>gb|EPB85961.1| hypothetical protein HMPREF1544_07293 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=760

 Score =   154 bits (389),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 125/209 (60%), Gaps = 4/209 (2%)
 Frame = +2

Query  182  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  358
            ++ +P+GGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W    GR+V + WT
Sbjct  2    ISGAPYGGPIAMIRDDKKVLLLQKQQPIKPTIYMYTSAGKLIEQIQWDK--GRIVALGWT  59

Query  359  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  538
            D + L+ +T DG+V  Y +        SLGKD     ++DC  W  G+V +   +Q+  +
Sbjct  60   DQEQLVVVTDDGSVRLYTLHGH-YTQFSLGKDAKNDGIIDCQIWGGGLVAMTGKYQLISL  118

Query  539  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG  718
             +F+ P P  +A+  L++   S TV+ PQ+T+S +VEVL+A G  +L+V+   +    + 
Sbjct  119  TNFEEPQPKMMAELKLDEPLHSWTVVPPQFTLSRHVEVLIATGSTILVVDSKEVTDQHLN  178

Query  719  IGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
             GP  KMVVS NGK LA FT DG+L V++
Sbjct  179  QGPFTKMVVSPNGKFLALFTSDGKLWVVS  207



>emb|CEI87038.1| hypothetical protein RMCBS344292_01458 [Rhizopus microsporus]
Length=733

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 126/209 (60%), Gaps = 4/209 (2%)
 Frame = +2

Query  182  VACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWT  358
            +A + +GGPIA+IRDD K++ L  +  ++  + ++ SAG  I +  W    G++VG+ WT
Sbjct  2    IAGAQYGGPIAMIRDDRKVLLLQKQQPIKPTIYMYTSAGKLIEQIQWDR--GKIVGLGWT  59

Query  359  DDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCI  538
            + + L+ +T+DG+V  Y +  +     SLGK+     ++DC  W  G+V +   +Q+  +
Sbjct  60   EQEQLVVVTEDGSVRLYTLHGQ-FSQFSLGKEAKDDGIIDCQIWGGGLVAMTSKYQLISV  118

Query  539  PDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG  718
             +F  P P  LAD  L++ P S T++ PQ+T+S +VEVL+A G  +L+V+ +      + 
Sbjct  119  TNFLEPQPKPLADIRLDEPPHSWTIVPPQFTLSRHVEVLIATGSTILVVDSNEATDEHLT  178

Query  719  IGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
             GP  KM VS NGK LA FT DG+L V++
Sbjct  179  QGPFTKMAVSPNGKFLALFTADGKLWVVS  207



>ref|XP_646623.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
 sp|Q55C58.2|VPS16_DICDI RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog [Dictyostelium discoideum]
 gb|EAL72727.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
Length=832

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/245 (32%), Positives = 140/245 (57%), Gaps = 8/245 (3%)
 Frame = +2

Query  86   VAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  265
            +AA+W+++ N  Y K E+Y M W  VDL +     SPF GPIAV+RD +K V++ +++  
Sbjct  2    IAAQWKIIGNSTYIKKEIYSMSW-DVDLKQQVSVGSPFAGPIAVMRDSSKFVEMNSQNMK  60

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              L+IF ++G  I++ +W +    +V M W + + L+ + Q+ TV  +++  E +   SL
Sbjct  61   PYLKIFTASGDLISQMIW-DSSKNIVAMDWIEKERLVIVLQNATVLIFNVFCEQMTQFSL  119

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP---DFKNPNPIKLADPGLEDFPLSM---  607
            G       +++C  W +G+V +  A Q++ +P   DF   +   +  P L + P +    
Sbjct  120  GDIVREEEILECKIWSDGIVVLTSASQLYSVPSINDFFVESGRVIRLPPLPEEPKARPEW  179

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
             ++EPQ+++S ++E+ M++   + L++ED ++       P+QKMVVS  GK LA F   G
Sbjct  180  AILEPQFSLSQSIEIFMSINGTLYLIDEDKVESQLEATEPIQKMVVSPCGKKLACFDTKG  239

Query  788  RLLVM  802
             LL++
Sbjct  240  TLLIL  244



>emb|CDS07252.1| hypothetical protein LRAMOSA01201 [Absidia idahoensis var. thermophila]
Length=773

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 115/198 (58%), Gaps = 4/198 (2%)
 Frame = +2

Query  215  VIRDDAKIVQLYAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQD  391
            +IRDD K++ L  +  ++  + ++ SAG  I +  W+   GR++ + WT  + L+ +T+D
Sbjct  1    MIRDDKKVLLLQKQQPIKPTVYMYTSAGKLIEQIQWEK--GRIIALGWTKQEELVIVTED  58

Query  392  GTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKL  571
            G V  Y +     +  SLGK+     ++DC  W  G+V +   +++  + DF  P P  +
Sbjct  59   GFVRLYPLHGSYTQ-FSLGKEAKEQGILDCQIWSTGLVAMTNNYKLIAVTDFYEPRPKLM  117

Query  572  ADPGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSR  751
            AD GL+D P S TVI PQYT+S +VEVL+A G  +++V+        +  GP  KM +S 
Sbjct  118  ADTGLDDKPHSWTVIPPQYTLSRHVEVLIATGSTIIVVDNKESVDQRLQQGPFTKMAISP  177

Query  752  NGKLLASFTHDGRLLVMT  805
            NGK LA FT DG+L V++
Sbjct  178  NGKFLALFTSDGKLWVVS  195



>ref|XP_002621281.1| vacuolar protein sorting vps16 [Blastomyces dermatitidis SLH14081]
 gb|EEQ74098.1| vacuolar protein sorting vps16 [Blastomyces dermatitidis SLH14081]
 gb|EEQ89941.1| vacuolar protein sorting vps16 [Blastomyces dermatitidis ER-3]
 gb|EGE80984.1| vacuolar sorting-associated protein [Blastomyces dermatitidis 
ATCC 18188]
Length=830

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 139/248 (56%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDRFYRKVRVYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+A   + I++ +G +I+   W++  G + G+ W DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISRINWEH--GSIRGLGWLDDERLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V  C FW +G V +    Q+  +  +  P P  LA P   D   
Sbjct  118  ADFTPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQLIAVSSYDEPRPKLLASPPEGDVS-  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + +V+    +   +  GP + + VS NG+ +A +T+
Sbjct  177  SWSLIPPNYTLSRSVEVLLAVDQTIYVVDATEAEDRMLQNGPFKHVSVSPNGRFVALYTN  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKVWVVS  244



>ref|XP_003287306.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
 gb|EGC36173.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
Length=831

 Score =   138 bits (347),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 135/246 (55%), Gaps = 9/246 (4%)
 Frame = +2

Query  86   VAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  265
            +AA W+ + N  Y K E+Y M+W  VDL +     +PF GPIAV+RD  K V++ +++  
Sbjct  2    IAAHWKNIGNSTYIKKEIYSMEW-DVDLKQQVAVAAPFAGPIAVMRDSTKFVEVNSQNMK  60

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              L+I+ +AG  +++ +W +   ++V M W + + L+ + QD TV  Y+I  E     +L
Sbjct  61   PYLKIYTAAGTLMSQMIW-DSSKKIVAMDWIEKERLVLVLQDATVLIYNIFCELKTQFTL  119

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIP---DFKNPNPIKLADPGL-EDFPLSM--  607
            G       +++C  W +G+V +  A +++ +P   DF   N   +  P + E+F      
Sbjct  120  GDVVRQEEILECKIWSDGIVVLTSAAKLYSVPSINDFFEENGKVIRLPQIPEEFGEKRPE  179

Query  608  -TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
              ++EPQ++++ ++E+ M++   + L++ED ++        L KM +S  GK LA F   
Sbjct  180  WAILEPQFSLTQSLEIYMSINGTLYLIDEDKVEAQLDSTDILLKMEISPCGKKLACFDRK  239

Query  785  GRLLVM  802
            G LL++
Sbjct  240  GTLLIL  245



>emb|CCJ28605.1| unnamed protein product [Pneumocystis jirovecii]
Length=825

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 128/237 (54%), Gaps = 6/237 (3%)
 Frame = +2

Query  101  QLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESALRKL  274
            QL   ++Y+K EL  M WK V+L+    A + +GG IA++RDD +++  Y   ++    +
Sbjct  10   QLSKEKFYQKIELSIMLWKGVELSGYISAGALYGGAIALVRDD-RVIHKYLGPDNTKSNI  68

Query  275  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKD  454
            RI+NS G  I E  W    G++ G+ W+D + LI +T+DG V  Y+I+ E     SLGK+
Sbjct  69   RIYNSYGAFIREIHW--DIGKIRGLGWSDSERLIVVTEDGIVRNYNIQGE-FTQFSLGKE  125

Query  455  CFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTM  634
               H V++C FW  G V + E      +  +  P P  L  P  ED   S T+I PQ++ 
Sbjct  126  INEHLVINCQFWGTGFVALLENNTFIAVNSYDEPRPRVLCSPEFEDIIHSWTIIAPQFSS  185

Query  635  SGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            + +VEVL++    + +++E       +  GP   M VS NG+ LA  T   ++ V++
Sbjct  186  NLHVEVLVSTKSTIYIIDEAENTDQCLQQGPFLDMSVSPNGQFLALHTFQNKIWVIS  242



>gb|EQL37787.1| hypothetical protein BDFG_00836 [Blastomyces dermatitidis ATCC 
26199]
Length=830

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 139/248 (56%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDRFYRKVRVYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+A   + I++ +G +I+   W++  G + G+ W DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISRINWEH--GSIRGLGWLDDERLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V  C FW +G V +    Q+  +  +  P P  LA P   D   
Sbjct  118  ADFTPFSLGTVVEEHGVKSCRFWSDGFVALLNNNQLIAVSSYDEPRPKLLASPPEGDVS-  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + +V+    +   +  GP + + VS NG+ +A +T+
Sbjct  177  SWSLIPPNYTLSRSVEVLLAVDQTIYVVDATEAEDRMLQNGPFKHVSVSPNGRFVALYTN  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKVWVVS  244



>ref|XP_007873550.1| hypothetical protein PNEG_01594 [Pneumocystis murina B123]
 gb|EMR10340.1| hypothetical protein PNEG_01594 [Pneumocystis murina B123]
Length=815

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 126/237 (53%), Gaps = 6/237 (3%)
 Frame = +2

Query  101  QLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRKL--  274
            QL  N++Y+K E  +M WK + L+   VA +  GG IA+++DD K++  Y      KL  
Sbjct  2    QLFKNKFYQKIEFSKMLWKDIQLSEYMVAGAKCGGAIALVKDD-KVIHKYLGPTNTKLSI  60

Query  275  RIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKD  454
            RI+NS G  I+E  W+    R  G+ WTD + LI +T++G V  Y+++ E     SLGK+
Sbjct  61   RIYNSYGSFISEINWELEKIR--GIGWTDSEKLIIVTENGVVRNYNMQGE-FTQFSLGKE  117

Query  455  CFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTM  634
               H VV+C FW  G V +        +  +  P P  L  P  ED   S  +I P ++ 
Sbjct  118  ANEHLVVNCQFWGTGFVALLGNNTFISVNQYSEPRPKLLCSPKFEDVIHSWAIIAPHFSS  177

Query  635  SGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            + +VEVL++    + L++E G +   +  GP   + VS NG+ LA  T   ++ V++
Sbjct  178  TFHVEVLVSTKSTIYLIDEAGNRDQYLYQGPFLNIRVSPNGQFLALHTFQNKIWVVS  234



>emb|CEG84394.1| hypothetical protein RMATCC62417_18203 [Rhizopus microsporus]
Length=282

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 103/176 (59%), Gaps = 3/176 (2%)
 Frame = +2

Query  278  IFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDC  457
            ++ SAG  I +  W    G++VG+ WT+ + L+ +T+DG+V  Y    +     SLGK+ 
Sbjct  1    MYTSAGKLIEQIQWDK--GKIVGLGWTEQEQLVVVTEDGSVRLYTFHGQ-FSQFSLGKEA  57

Query  458  FTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  637
                ++DC  W  G+V +   +Q+  + +F  P P  LAD  L++ P S T++ PQ+T+S
Sbjct  58   KDDGIIDCQIWGGGLVAMTSKYQLISVTNFLEPQPKPLADIRLDEPPHSWTIVPPQFTLS  117

Query  638  GNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
             +VEVL+A G  +L+V+ +      +  GP  KM VS NGK LA FT DG+L V++
Sbjct  118  RHVEVLIATGSTILVVDSNEATDEHLTQGPFTKMAVSPNGKFLALFTADGKLWVVS  173



>gb|KEQ63929.1| vacuolar protein sorting-associated protein 16 [Aureobasidium 
melanogenum CBS 110374]
Length=822

 Score =   134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 128/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IAV RDD+K+    +  A R
Sbjct  6    ADWERVGDRFYRKTQLYTSVFDPELELENHVLVGAPLAGAIAVYRDDSKLYAYRSTQAAR  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + ++  +G  I    W    G + G  W++D+ LI +T DGTV  Y+  +      SL
Sbjct  66   PSIDLYTCSGKLIHRINWDK--GAIQGCGWSEDERLIVVTNDGTVRIYNALSSDFIPFSL  123

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     H VV C FW +G V +    Q+ C+  +  P P  LA P  E   LS  VI P 
Sbjct  124  GHGADEHGVVSCRFWSSGFVALLGNNQLVCVSRYDEPRPTLLATPP-EGEILSWAVIPPA  182

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VE ++A+ D +++V+    Q   +  GP + + V+ N K +A +T DG++ V++
Sbjct  183  FTLSRSVEAILAIDDTIVIVDASEAQDRKLQNGPFKLVSVAPNAKFIALYTQDGKVWVIS  242



>gb|KIW64485.1| hypothetical protein PV04_09414 [Capronia semiimmersa]
Length=830

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 134/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  K+ + 
Sbjct  1    MTASNPRAGWEKVGDQFYRKVPLYEAVFDQDLELENYLVAGAPYGGALALWRDTTKVARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNISWER--GVIKGLGWSDDEKLLVVTEDGTVHCYFGLHS  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG     + VV C FW +G V +     +  +  F  P P +LA P  E    S
Sbjct  119  DFQPFSLGHGSEEYGVVSCRFWSHGFVALLSNNSLIAVSSFDEPRPRQLA-PTPEGQVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + +V+    +  G+  GP   + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAVNKTIFVVDATDSEDRGLSDGPFMHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|EER38773.1| vacuolar sorting protein [Histoplasma capsulatum H143]
Length=694

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 138/248 (56%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + +V+    +   +  GP + + VS NG+ +A +T 
Sbjct  177  SWSLIPPNYTLSRSVEVLLAVDQTIYVVDATDAEDRMLQNGPFKHVSVSPNGRFVALYTC  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKVWVIS  244



>ref|XP_007728315.1| hypothetical protein A1O1_09269 [Capronia coronata CBS 617.96]
 gb|EXJ78867.1| hypothetical protein A1O1_09269 [Capronia coronata CBS 617.96]
Length=830

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/246 (33%), Positives = 135/246 (55%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+T +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD AKI + 
Sbjct  1    MTTNNPRAGWEKVGDQFYQKVQLYESIFDPDLELENYLVAGAPYGGALALWRDAAKIARY  60

Query  248  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                A +  + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQATKPTIDIYSSSGKLISNINWEK--GPVRGLGWSDDERLLVVTEDGTVHCYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       V  C FW +G+V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFSLGHGAEEFGVKSCQFWSHGLVALLSNNALVAVSSFDEPRPRLLAQPP-EGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAVNKTIYVVDASEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|KFX91659.1| hypothetical protein V490_05796 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=880

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 131/251 (52%), Gaps = 5/251 (2%)
 Frame = +2

Query  59   NNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAK  235
            N +  S ++  A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+ K
Sbjct  53   NEVDASRMNPTADWERLGERYYRKVQLYTEVFDQDLELENHIVAGAPYGGAIALYRDETK  112

Query  236  IVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYD  412
            +       A +  + +++ AG  I    W    G + G+ W++D+ L+ ITQDGTV  Y 
Sbjct  113  LHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVITQDGTVRCYY  170

Query  413  IRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLED  592
                     SLG       VV C F+  G V +     +  +  ++ P P  LA P  + 
Sbjct  171  NLQGDFSQFSLGHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DG  229

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLAS  772
               S T++ P YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  A 
Sbjct  230  VVHSWTLVPPAYTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFAAL  289

Query  773  FTHDGRLLVMT  805
            +T  G+  V+T
Sbjct  290  YTESGKAYVIT  300



>gb|KIW86230.1| hypothetical protein Z517_01625 [Fonsecaea pedrosoi CBS 271.37]
Length=830

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/246 (32%), Positives = 136/246 (55%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+T +  A W+++ +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTTNNPRAGWEIVGDQFYRKVPLYESVFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  248  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                +++  + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSIKPTIDIYSSSGKLISNINWEK--GVIKGLGWSDDEKLLVVTEDGTVHCYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       VV C FW +G V +     +  +  F+ P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFEEPRPRLLAQ-APEGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAIDKTIYVVDVTEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>ref|XP_009153640.1| hypothetical protein HMPREF1120_01377 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY53179.1| hypothetical protein HMPREF1120_01377 [Exophiala dermatitidis 
NIH/UT8656]
Length=830

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 133/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD  K+ + 
Sbjct  1    MTNHNPRAGWEKIGDQFYQKVQLYESVFDPDLELENYLVAGAPYGGALALWRDSTKVARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++SAG  I+   W+   G + G+ W+DD+ L+ IT+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSAGKLISNIHWEK--GPIKGLGWSDDERLLVITEDGTVHCYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       VV C FW +G V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNALVAVSSFDEPRPRLLAQPP-EGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLALNKTIYVVDATDAEDRGLSDGPFKHVCVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|KFY40837.1| hypothetical protein V495_05238 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY58989.1| hypothetical protein V497_04533 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=821

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 127/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWERLGERYYRKVQLYTEVFDQDLELENHIVAGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  I    W    G + G+ W++D+ L+ ITQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVITQDGTVRCYYNLQGDFSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G       VV C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFAALYTESGKAYVIT  241



>gb|EGC44404.1| vacuolar sorting-associated protein [Histoplasma capsulatum H88]
Length=830

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 138/248 (56%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + +V+    +   +  GP + + VS NG+ +A +T 
Sbjct  177  SWSLIPPNYTLSRSVEVLLAVDQTIYVVDATDAEDRMLQNGPFKHVSVSPNGRFVALYTC  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKVWVIS  244



>ref|XP_007733017.1| hypothetical protein A1O3_04699 [Capronia epimyces CBS 606.96]
 gb|EXJ84032.1| hypothetical protein A1O3_04699 [Capronia epimyces CBS 606.96]
Length=830

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/246 (32%), Positives = 135/246 (55%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD AKI + 
Sbjct  1    MTNHNPRAGWEKIGDQFYQKIQLYESIFDPDLELENYLVAGAPYGGALALWRDPAKIARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +SA   + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSAKPTIDIYSSSGKLISNINWEK--GPIKGLGWSDDEKLLVVTEDGTVHCYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       V  C FW +G+V +     +  +  F  P P  LA P   +   S
Sbjct  119  DFQPFSLGHGAEEFGVKSCRFWSHGLVALLSNNALIAVSSFDEPRPRLLAQPPDGEVH-S  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAIDKTIFVVDATEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|KFY04377.1| hypothetical protein O988_00818 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=821

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 127/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWERLGERYYRKVQLYTEVFDQDLELENHIVAGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  I    W    G + G+ W++D+ L+ ITQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVITQDGTVRCYYNLQGDFSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G       VV C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFAALYTESGKAYVIT  241



>gb|EEH09936.1| vacuolar sorting-associated protein [Histoplasma capsulatum G186AR]
Length=830

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 138/248 (56%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDAVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + +V+    +   +  GP + + VS NG+ +A +T 
Sbjct  177  SWSLIPPNYTLSRSVEVLLAVDQTICVVDATDAEDRMLQNGPFKHVSVSPNGRFVALYTC  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKVWVIS  244



>gb|KIV93309.1| hypothetical protein PV10_04533 [Exophiala mesophila]
Length=830

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 135/246 (55%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M++ +  A W+ + N++Y+K +LY+  +   ++L    VA +P+GG +A+ RD +K+ + 
Sbjct  1    MTSTNPRAGWEKIGNQFYQKVQLYESIFDPDLELGNYLVAGAPYGGALALWRDKSKVARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DG V+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGQLISNINWEK--GAIKGLGWSDDEKLLVVTEDGIVHCYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG     + V  C FW +G V +     +  +  F  P P KL  P  E    S
Sbjct  119  DFNPFSLGHGAEEYGVQSCRFWSHGFVALLSNNALITVSSFDEPRP-KLLAPTPEGEIHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+++G+ + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLSIGNTIHVVDATEAEDRGLSDGPFKHVSVSPNGRFAALFTDD  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>ref|XP_001542324.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN05892.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=755

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 138/248 (56%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +++YRK  +Y   + + ++L    VA +P+GG IA+ RD++K+ Q 
Sbjct  1    MAPTNPLADWERVGDQFYRKVRIYDDVFDEELELENFIVAGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+A   + I++ +G +I++  W++  G + G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETAKSSIDIYSCSGKRISQINWEH--GSIRGLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V  C FW +G V +    Q   +  +  P P KL     E    
Sbjct  118  ADFVPFSLGTVAEEHGVKSCRFWSDGFVALLNNNQFIAVSRYDEPRP-KLLASTPEGEIS  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + +V+    +   +  GP + + VS NG+ +A +T 
Sbjct  177  SWSLIPPNYTLSRSVEVLLAVDQTIYVVDATDAEDRMLQNGPFKHVSVSPNGRFVALYTC  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKVWVIS  244



>gb|KFY19049.1| hypothetical protein V491_04616 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=834

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 132/253 (52%), Gaps = 5/253 (2%)
 Frame = +2

Query  53   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  229
            + N +  + ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+
Sbjct  5    NQNEVDATRMNPTADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDE  64

Query  230  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  406
            AK+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  65   AKLHTFRGSQASKSSIDVYSCAGKLIRRVNWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  122

Query  407  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  586
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  123  YYNLQGDFSQFSLGHGAEEFGVIACRFYSTGFVALLSNNHLISVARYEEPRPKLLAVPP-  181

Query  587  EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLL  766
            +    S T++ P YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  
Sbjct  182  DGVVHSWTLVPPAYTLSRSVEVLLAIGETIYVVDATETEDRMLDIGPFIHISVSPNGKFA  241

Query  767  ASFTHDGRLLVMT  805
            A +T  G+  V+T
Sbjct  242  ALYTESGKAYVIT  254



>ref|XP_008730333.1| hypothetical protein G647_07799 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21452.1| hypothetical protein G647_07799 [Cladophialophora carrionii CBS 
160.54]
Length=830

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 132/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTASNPRAGWEKVGDQFYRKVPLYESVFDQDLELGNYLVAGAPYGGALALWRDTTKIARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWER--GVIKGLGWSDDEKLLVVTEDGTVHCYFGLHS  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       VV C FW +G V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFSLGHGSEEFGVVSCRFWSHGFVALLSNNSLIAVSSFDEPRPRLLA-PTPEGQVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + +V+    +  G+  GP   + VS NG+  A FT +
Sbjct  178  WSLIPPAYTLSRSVEVLLAVDRTIFVVDASDAEDRGLSDGPFMHVSVSPNGRFAALFTEN  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|KIY03984.1| hypothetical protein Z520_00676 [Fonsecaea multimorphosa CBS 
102226]
Length=830

 Score =   129 bits (325),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 134/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M++ +  A W+++ +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTSNNPRAGWEIVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWEK--GVIKGLGWSDDEKLLVVTEDGTVHCYFELHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       VV C FW +G V +     +  +  F  P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFDEPRPRLLAQ-APEGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   V +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAIDKTVYVVDVTEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|KFY18957.1| hypothetical protein V493_08231 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=834

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 131/253 (52%), Gaps = 5/253 (2%)
 Frame = +2

Query  53   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  229
            + N    + ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+
Sbjct  5    TQNEADATRMNPTADWEKLGERYYRKIQLYTEVFDQDLELENHIVTGAPYGGAIALYRDE  64

Query  230  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  406
            AK+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  65   AKLHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  122

Query  407  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  586
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  123  YYNLQGDFSQFSLGHGAEDFGVIGCRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-  181

Query  587  EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLL  766
            +    S T++ P YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  
Sbjct  182  DGIVHSWTLVPPAYTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFA  241

Query  767  ASFTHDGRLLVMT  805
            A +T  G+  V+T
Sbjct  242  ALYTESGKAYVIT  254



>ref|XP_001259325.1| vacuolar protein sorting vps16, putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW17428.1| vacuolar protein sorting vps16, putative [Neosartorya fischeri 
NRRL 181]
Length=754

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 132/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  LY   + + VDL    VA +P+GG IA+ RD++K    
Sbjct  1    MAPSNPLANWERLGDSFYRKVSLYDAIFNEDVDLDNYIVAGAPYGGAIALHRDESKPYMF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A +A   + I++ +G  I    W++  G + G+ W++ + L+ IT+DGTV RY     
Sbjct  61   RDAHTARSSIDIYSCSGKHINRINWEH--GTIRGLGWSEKEELLVITEDGTVRRYFGLYG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW+NG V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACKFWNNGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEVSS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + L++    +   +  GP +   VS  G+ +A +T +
Sbjct  178  WSLIPPPYTLSRSVEVLLAVDKTIFLIDSSEAEDKVLQNGPFKHASVSPTGRFVALYTAE  237

Query  785  GRLLVMT  805
            G++ V++
Sbjct  238  GQVWVVS  244



>gb|KEY77885.1| vacuolar protein sorting vps16 [Aspergillus fumigatus var. RP-2014]
Length=752

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 132/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  LY   + + VDL    VA +P+GG IA+ RD++K    
Sbjct  1    MAPSNPLANWERLGDSFYRKVSLYDAIFDEDVDLDNYIVAGAPYGGAIALHRDESKPYMF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A +A   + I++ +G  I    W++  G + G+ W++ + L+ IT+DGTV RY     
Sbjct  61   RDAHTARSSIDIYSCSGKHINRINWEH--GTIRGLGWSEKEELLVITEDGTVRRYFGLYG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW+NG V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACKFWNNGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEISS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + L++    +   +  GP +   VS  G+ +A +T +
Sbjct  178  WSLIPPPYTLSRSVEVLLAVDKTIFLIDSSEAEDKVLQNGPFKHASVSPTGRFVALYTAE  237

Query  785  GRLLVMT  805
            G++ V++
Sbjct  238  GQVWVVS  244



>ref|XP_008712782.1| hypothetical protein HMPREF1541_09888 [Cyphellophora europaea 
CBS 101466]
 gb|ETN45012.1| hypothetical protein HMPREF1541_09888 [Cyphellophora europaea 
CBS 101466]
Length=831

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 132/246 (54%), Gaps = 4/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M++ +  A W+ + N++YRK  LY+  +   ++L    VA +P+ G +A+ R+++KI + 
Sbjct  1    MTSTNPRAGWERIDNQFYRKIRLYEQVFDPDLELENYLVAGAPYSGALALWRNESKISRY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++S+G  I+   W    G + G+ W+DD+ L+ IT+DGTV  Y    E
Sbjct  61   RVGGSAKPTIDIYSSSGKLISNISWDK--GSIRGLGWSDDEQLLVITEDGTVRCYFGLHE  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG +   H V  C FW +G V +     +  +  F+ P+ ++      +    +
Sbjct  119  DFTPFSLGLEAEEHGVASCRFWSHGFVALLSNNTLVAVSSFREPHSVQQLAAVPDGKVYA  178

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP   + VS NG+  A +T D
Sbjct  179  WSLIPPAYTLSRSVEVLLAIDKTIFVVDATEAEDRGLSDGPFSHVSVSPNGRFAALYTED  238

Query  785  GRLLVM  802
            G++ V+
Sbjct  239  GKVWVV  244



>gb|KEQ75501.1| vacuolar protein sorting-associated protein 16 [Aureobasidium 
pullulans var. namibiae CBS 147.97]
Length=822

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 127/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IA+ RDD+K+    +  A R
Sbjct  6    ADWERVGDRFYRKTQLYTSVFDPELELENHVLVGAPLAGAIALYRDDSKLYAYRSTQAAR  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + ++  +G  I    W    G + G +W++D+ LI +T DGTV  Y   +      SL
Sbjct  66   PSIDLYTCSGKLIHRINWDK--GAIQGCAWSEDERLIVVTNDGTVRIYHGLSGDFIPFSL  123

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     H VV C FW +G V +    Q+ C+  +  P P  LA P   +  LS  VI P 
Sbjct  124  GHGADEHGVVSCRFWSSGFVALLGNNQLVCVSRYDEPRPTLLATPPQGEI-LSWAVIPPA  182

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VE ++A+ D +++V+    Q   +  GP + + V+ N K +A +T D ++ V++
Sbjct  183  FTLSRSVEAILAIDDTIVIVDASEAQDRKLQNGPFKLVSVAPNAKFIALYTQDAKVWVIS  242



>gb|KEQ96076.1| hypothetical protein AUEXF2481DRAFT_64917 [Aureobasidium subglaciale 
EXF-2481]
Length=822

 Score =   129 bits (323),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 126/242 (52%), Gaps = 5/242 (2%)
 Frame = +2

Query  86   VAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AES  259
              A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IA+ RD+ K+     A++
Sbjct  4    ATADWERVGDRFYRKTQLYTSIFDPELELENHMLVGAPLSGAIAIYRDETKLYAYRNAQT  63

Query  260  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  439
            +   + I+  +G  I    W    G + G  W++D+ LI +T DGTV  Y   +      
Sbjct  64   SRPSIDIYTCSGKPIHRINWDK--GAIQGCGWSEDERLIVVTNDGTVRIYHDLSGDFIPF  121

Query  440  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  619
            SLG     H VV C FW +G V +     + C+  +  P P  LA P   D  LS  VI 
Sbjct  122  SLGHGAEEHGVVSCRFWSSGFVALLGNKHLVCVSRYDEPRPTLLATPPEGDI-LSWAVIP  180

Query  620  PQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
            P +T+S +VE ++A+ D +++V+    Q   +  GP + + V+ N K +A +T DG++ V
Sbjct  181  PAFTLSRSVEAILAIDDTIVIVDASEAQDRKLQNGPFKLVSVAPNAKFIALYTQDGKVWV  240

Query  800  MT  805
            ++
Sbjct  241  IS  242



>gb|KIW38854.1| hypothetical protein PV06_08684 [Exophiala oligosperma]
Length=830

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/246 (30%), Positives = 136/246 (55%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+T +  + W+ + +++Y+K +LY+  + + ++L    VA +P+GG +A+ RD +KI + 
Sbjct  1    MTTTNPRSGWEKIGDQFYQKIQLYESIFDQDLELENYLVAGAPYGGALALWRDSSKIARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++++G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKSTIDIYSTSGKLISNINWEK--GPIKGLGWSDDEKLLVVTEDGTVHCYFGLYG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +   LG     + VV C FW +G V +     +  +  F  P P  LA P   +   S
Sbjct  119  DFQPFLLGHGAEEYGVVSCRFWSHGFVALLSNNTLVAVSSFDEPRPRLLAQPPEGEIS-S  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   +++++       G+  GP + + VS NG+  A +T D
Sbjct  178  WSLIPPAYTLSRSVEVLLAIDKTIVVIDASEADDRGLSDGPFKHVSVSPNGRFAALYTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>ref|XP_753294.1| vacuolar protein sorting vps16 [Aspergillus fumigatus Af293]
 gb|EAL91256.1| vacuolar protein sorting vps16, putative [Aspergillus fumigatus 
Af293]
 gb|EDP52096.1| vacuolar protein sorting vps16, putative [Aspergillus fumigatus 
A1163]
Length=828

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 132/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  LY   + + VDL    VA +P+GG IA+ RD++K    
Sbjct  1    MAPSNPLANWERLGDSFYRKVSLYDAIFDEDVDLDNYIVAGAPYGGAIALHRDESKPYMF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A +A   + I++ +G  I    W++  G + G+ W++ + L+ IT+DGTV RY     
Sbjct  61   RDAHTARSSIDIYSCSGKHINRINWEH--GTIRGLGWSEKEELLVITEDGTVRRYFGLYG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW+NG V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACKFWNNGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEISS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + L++    +   +  GP +   VS  G+ +A +T +
Sbjct  178  WSLIPPPYTLSRSVEVLLAVDKTIFLIDSSEAEDKVLQNGPFKHASVSPTGRFVALYTAE  237

Query  785  GRLLVMT  805
            G++ V++
Sbjct  238  GQVWVVS  244



>gb|KFZ12341.1| hypothetical protein V502_07139 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=881

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 132/253 (52%), Gaps = 5/253 (2%)
 Frame = +2

Query  53   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  229
            + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+
Sbjct  52   NQNEADVARMNPTADWEKLGERYYRKIQLYTEVFDQDLELENHIVAGAPYGGAIALYRDE  111

Query  230  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  406
             K+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  112  TKLHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  169

Query  407  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  586
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  170  YYNLQGDFSQFSLGHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-  228

Query  587  EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLL  766
            +    S T++ P YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  
Sbjct  229  DGVVHSWTLVPPAYTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFA  288

Query  767  ASFTHDGRLLVMT  805
            A +T  G+  V+T
Sbjct  289  ALYTESGKAYVIT  301



>gb|KFY86286.1| hypothetical protein V500_07738 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=834

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 132/253 (52%), Gaps = 5/253 (2%)
 Frame = +2

Query  53   SSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDD  229
            + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + VA +P+GG IA+ RD+
Sbjct  5    NQNEADVARMNPTADWEKLGERYYRKIQLYTEVFDQDLELENHIVAGAPYGGAIALYRDE  64

Query  230  AKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYR  406
             K+       A +  + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  
Sbjct  65   TKLHTFRGSQASKSSIDVYSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRC  122

Query  407  YDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL  586
            Y          SLG       V+ C F+  G V +     +  +  ++ P P  LA P  
Sbjct  123  YYNLQGDFSQFSLGHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-  181

Query  587  EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLL  766
            +    S T++ P YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  
Sbjct  182  DGVVHSWTLVPPAYTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFA  241

Query  767  ASFTHDGRLLVMT  805
            A +T  G+  V+T
Sbjct  242  ALYTESGKAYVIT  254



>gb|KIW33525.1| hypothetical protein PV07_00366 [Cladophialophora immunda]
Length=830

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/246 (32%), Positives = 133/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+++ +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTNNNPRAGWEIVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWEK--GVIKGLGWSDDEKLLVVTEDGTVHCYFELHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       VV C FW +G V +     +  +  F  P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFDEPRPRLLAQ-APEGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAIDKTIYVVDVTEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|KFY99509.1| hypothetical protein V498_00707 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=821

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 126/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGQLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFAALYTESGKAYVIT  241



>gb|KFY51994.1| hypothetical protein V496_08707 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=821

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 126/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+AK+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDEAKLHTFRGSQASK  64

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGQLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFAALYTESGKAYVIT  241



>gb|KIW21568.1| hypothetical protein PV08_02148 [Exophiala spinifera]
Length=830

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 131/237 (55%), Gaps = 5/237 (2%)
 Frame = +2

Query  98   WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESALRK  271
            W+ + +++Y+K +LY+  + + ++L    VA +P+GG +A+ RD +KI +    +S    
Sbjct  10   WEKIGDQFYQKIQLYESVFDRDLELENYLVAGAPYGGALALWRDSSKIARYRTGQSTKST  69

Query  272  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  451
            + I++++G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y       +   LG 
Sbjct  70   IDIYSTSGKLISNINWEK--GPIKGLGWSDDEKLLVVTEDGTVHCYFGLYGDFQPFLLGH  127

Query  452  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  631
                + VV C FW +G V +     +  +  F  P P  LA P  E    S ++I P YT
Sbjct  128  GAEEYGVVSCRFWSHGFVALLSNNALIAVSSFDEPRPRLLAQPP-EGEIHSWSLIPPAYT  186

Query  632  MSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            +S +VEVL+A+   +++V+       G+  GP + + VS NG+  A +T DG++ V+
Sbjct  187  LSRSVEVLLAIDKTIIVVDASEADDRGLSDGPFKHVSVSPNGRFAALYTEDGKVWVV  243



>gb|KIW03814.1| hypothetical protein PV09_05114 [Verruconis gallopava]
Length=825

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 126/241 (52%), Gaps = 5/241 (2%)
 Frame = +2

Query  89   AAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  265
             A W  + +R+YR+ +LY   +   ++L    +A +P+ G +A  RD+ K+         
Sbjct  5    TANWDKVGDRFYRRVQLYTSVFDPDLELENYTIAGAPYSGALAFHRDETKLQTYRGTQTT  64

Query  266  RK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
            R  + I++SAG  I   +W    G + G+ W++D+ LI +T+DGTV  Y+         S
Sbjct  65   RSTIDIYSSAGKLIRRLIWDQ--GNIKGLGWSEDEKLITVTEDGTVRVYEGLQSDFVPFS  122

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     H V+ C F  NG V +     +  +P + +P P++LA P  +    S  +I P
Sbjct  123  LGHGAEEHGVISCRFHANGFVALLGNNHLVSVPRYNDPRPLELAVPP-DQLVTSWAIISP  181

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
              ++S +VEVL+A+   + +V+    +  G+  GP   + VS NGK +A +T DG++ ++
Sbjct  182  GDSLSRSVEVLLAIDKTIYVVDATEAEDRGLDKGPFHHISVSPNGKYMALYTGDGQVWII  241

Query  803  T  805
            +
Sbjct  242  S  242



>ref|XP_002848487.1| vacuolar protein sorting-associated protein [Arthroderma otae 
CBS 113480]
 gb|EEQ31174.1| vacuolar protein sorting-associated protein [Arthroderma otae 
CBS 113480]
Length=830

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 132/241 (55%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ + +++YRK  +Y   + + V+L       +P+GG IA+ RDD ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKSRIYDAVFDEDVELENYIAVGAPYGGAIALYRDDRRL-QRYRDAQTS  66

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
               + I++ +G +I    W +  G + G+ W+DD+ L+ IT+DGTV  Y   +      S
Sbjct  67   KSSIDIYSCSGHRICRINWDH--GSIRGLGWSDDEKLLAITEDGTVRCYYGLSGDFTPFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSAAEEYGVVACRFWSTGFVALLSNNQLVAVSHYDEPRP-KLLAQSPEGGISSWSLIPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+A+   + +V+E   +   +  GP +++ VS NG  +A FT DG+L V+
Sbjct  184  NYTLSRSVEVLLAIDKTIYVVDEADSEDRMLQNGPFKQVSVSPNGLFVALFTGDGKLWVV  243

Query  803  T  805
            +
Sbjct  244  S  244



>gb|KEQ80575.1| vacuolar protein sorting-associated protein 16 [Aureobasidium 
pullulans EXF-150]
Length=822

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 126/242 (52%), Gaps = 5/242 (2%)
 Frame = +2

Query  86   VAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESA  262
              A+W+ + +R+YRK +LY   +   ++L  + +  +P  G IA+ RD+ K+    + +A
Sbjct  4    ATADWERVGDRFYRKTQLYTSVFDPELELENHVLVGAPLSGAIAIYRDENKLYAYRSSNA  63

Query  263  LR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  439
             R  + I+  +G  I    W    G + G  W++D+ LI +T DGTV  Y   +      
Sbjct  64   ARPSIDIYTCSGKLIHRINWDK--GSIHGCGWSEDERLIVVTNDGTVRIYHDLSGDFIPF  121

Query  440  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  619
            SLG     H VV C FW +G V +    Q+  +  +  P P  LA P  E   LS  VI 
Sbjct  122  SLGHGADQHGVVSCRFWSSGFVALLGNNQLVSVSRYDEPRPTLLATPP-EGEILSWAVIP  180

Query  620  PQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
            P +T+S +VE ++A+ D +++++    Q   +  GP + + V+ N K +A +T DG++ V
Sbjct  181  PAFTLSRSVEAILAIDDTIVIIDASEAQDRKLQNGPFKHISVAPNAKFIALYTQDGKVWV  240

Query  800  MT  805
            ++
Sbjct  241  IS  242



>ref|XP_007750426.1| hypothetical protein A1O5_11664 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ63343.1| hypothetical protein A1O5_11664 [Cladophialophora psammophila 
CBS 110553]
Length=830

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/246 (32%), Positives = 133/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KI + 
Sbjct  1    MTANNPRAGWEKVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISTINWEK--GVIRGLGWSDDEKLLVVTEDGTVHCYFELHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       VV C FW +G V +     +  +  F+ P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLIAVSSFEEPRPRLLAQ-APEGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPVYTLSRSVEVLLAIDKTIYVVDVTEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|KFZ05975.1| hypothetical protein V501_07859 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=1847

 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 132/256 (52%), Gaps = 5/256 (2%)
 Frame = +2

Query  44   GAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVI  220
            G  + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ 
Sbjct  38   GKDNQNEADIARMNPTADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALY  97

Query  221  RDDAKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGT  397
            RD+ K+       A +  + +++ +G  I    W    G + G+ W++D+ L+ +TQDGT
Sbjct  98   RDETKLHTFRGSQASKSSIDVYSCSGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGT  155

Query  398  VYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD  577
            V  Y          SLG       VV C F+  G V +     +  +  ++ P P  LA 
Sbjct  156  VRCYYNLQGDFSQFSLGHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAV  215

Query  578  PGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNG  757
            P  +    S T++ P YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NG
Sbjct  216  P-PDGVVHSWTLVPPAYTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNG  274

Query  758  KLLASFTHDGRLLVMT  805
            K  A +T  G+  V+T
Sbjct  275  KFAALYTESGKAYVIT  290



>gb|KFY11799.1| hypothetical protein V492_04262 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=821

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 125/240 (52%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+ K+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDETKLHTFRGSQASK  64

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRVNWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFAALYTESGKAYVIT  241



>gb|KFY39836.1| hypothetical protein V494_03792 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=821

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 125/240 (52%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ RD+ K+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYRDETKLHTFRGSQASK  64

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVYSCAGKLIRRVNWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G       V+ C F+  G V +     +  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NGK  A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLAIGETIYVVDATESEDRMLDIGPFIHISVSPNGKFAALYTESGKAYVIT  241



>dbj|GAD99952.1| vacuolar protein sorting vps16 [Byssochlamys spectabilis No. 
5]
Length=829

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 135/247 (55%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + + +YRK  +Y   + + ++L    VA +P GG IA+ RD +K+ + 
Sbjct  1    MAPSNPLADWERVGDSFYRKVRVYDAVFDEDLELENYIVAGAPHGGAIALYRDQSKLYRY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A++A   + I++ +G  I++  W+   G + G+ W+DD+ L+ +T+DGTV RY     
Sbjct  61   RDAQTAKSSIDIYSCSGKLISKINWEY--GSIRGLGWSDDEDLLVVTEDGTVRRYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG     + V +C FW +G V +    Q+  +  +  P P KL     E   LS
Sbjct  119  DFSPFSLGNGAEEYGVRECRFWSSGFVALLSNNQLVAVSQYNEPRP-KLLATCPEGEVLS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   V +V+    +   +  GP + + VS  G+ +A FT +
Sbjct  178  WSLIAPAYTLSRSVEVLLAVDKTVYMVDATEAEDRMLQNGPFKHVSVSPTGRFVALFTGE  237

Query  785  GRLLVMT  805
            G+L V++
Sbjct  238  GKLWVVS  244



>gb|KFY80059.1| hypothetical protein V499_01034 [Pseudogymnoascus pannorum VKM 
F-103]
Length=1834

 Score =   127 bits (320),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 132/256 (52%), Gaps = 5/256 (2%)
 Frame = +2

Query  44   GAPSSNNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVI  220
            G  + N   ++ ++  A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+ 
Sbjct  38   GKDNQNEADVARMNPTADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALY  97

Query  221  RDDAKIVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGT  397
            RD+ K+       A +  + +++ +G  I    W    G + G+ W++D+ L+ +TQDGT
Sbjct  98   RDETKLHTFRGSQASKSSIDVYSCSGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGT  155

Query  398  VYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD  577
            V  Y          SLG       VV C F+  G V +     +  +  ++ P P  LA 
Sbjct  156  VRCYYNLQGDFSQFSLGHGAEEFGVVACRFYSTGFVALLSNNHLISVSRYEEPRPKLLAV  215

Query  578  PGLEDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNG  757
            P  +    S T++ P YT+S +VEVL+A+G+ + +V+    +   + IGP   + VS NG
Sbjct  216  PP-DGVVHSWTLVPPAYTLSRSVEVLLAIGETIYVVDATECEDRMLDIGPFIHISVSPNG  274

Query  758  KLLASFTHDGRLLVMT  805
            K  A +T  G+  V+T
Sbjct  275  KFAALYTESGKAYVIT  290



>gb|KEF53480.1| hypothetical protein A1O9_10455 [Exophiala aquamarina CBS 119918]
Length=830

 Score =   126 bits (317),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 133/247 (54%), Gaps = 7/247 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+ V+  A W+ + +++Y+K ++Y+  + + ++L    V  +P+GG +A+ RD  KI + 
Sbjct  1    MTGVNPRAGWEKIGDQFYQKAQVYESVFDQDLELENYLVVGAPYGGALALWRDANKITRY  60

Query  248  YAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                +L+  + I++S+G  I+   W+   G + G+ W DD+ LI +T+DGTV+ Y     
Sbjct  61   RTGQSLKSTIDIYSSSGRLISNINWEK--GSIKGLGWLDDERLIVVTEDGTVHCYYGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     + V  C FW +G V +     +  +  F  P P  LA  P  E    
Sbjct  119  DFNPFSLGHGAEEYGVKSCRFWSHGFVALLTNNSLVAVSSFDEPRPRLLARAPDGEVH--  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A FT 
Sbjct  177  SWSLIPPAYTLSRSVEVLLAIDKTIFMVDASEAEDRGLSDGPFKHVSVSPNGRFAALFTE  236

Query  782  DGRLLVM  802
            DG++ V+
Sbjct  237  DGKVWVV  243



>ref|XP_007839731.1| hypothetical protein PFICI_12959 [Pestalotiopsis fici W106-1]
 gb|ETS76015.1| hypothetical protein PFICI_12959 [Pestalotiopsis fici W106-1]
Length=827

 Score =   126 bits (317),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 133/248 (54%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M      A W+ + +R+YRK +LY   + + +DL    VA +P+GG IA+ RD+ K+  L
Sbjct  1    MEAAHPTAGWEKVGDRFYRKTQLYTAVFDRDLDLENYIVAGAPYGGAIALYRDETKLQTL  60

Query  248  YA-ESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRA  421
             A +S+   + I++ AG  +    W    G + G+ W++D+ L+ ++ DGTV   YD++ 
Sbjct  61   RAAKSSKPSIEIYSCAGKLLKSIAWDK--GSIKGLGWSEDEKLLVVSYDGTVRCYYDLQG  118

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            +     SLG+      V  C F++ G+V +     +  +  +  P P +L  P  E    
Sbjct  119  D-FTQFSLGRGAEDFGVHSCKFYNTGMVALLSNNALISVASYDEPRPKQLVSPP-EGEVH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            + T++ P++T+S +VEVL+++   + +V+    +   + IGP  ++ VS NGK  A +  
Sbjct  177  AWTLVSPRFTLSRSVEVLLSINKTIYVVDATDCEDRYLDIGPFTQISVSPNGKFAALYAA  236

Query  782  DGRLLVMT  805
            DGR  V+T
Sbjct  237  DGRAHVIT  244



>dbj|GAM90669.1| hypothetical protein ANO11243_087140 [fungal sp. No.11243]
Length=823

 Score =   126 bits (317),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 132/241 (55%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ + +R+YRK +LY   + + ++L    +  +PF G +A+ RD+++I      +  +
Sbjct  6    ADWERVGDRFYRKIQLYTSVFDQDLELENYNLVGAPFSGAVAIYRDESRIHSFTGSATAK  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRY-DIRAEPLESLS  442
              + I++ +G  I    W    G++ G+ W++D+ LI ++QDGTV  Y D++ + +   +
Sbjct  66   PTIDIYSCSGQLINRINWDK--GQIQGLGWSEDERLIVVSQDGTVRLYFDLQGDFI-PFT  122

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + V  C FW  G V +    Q+  +  +  P P  LA P   D  +S  +I P
Sbjct  123  LGYGAEEYGVQSCKFWSTGFVALLGNNQLVAVTRYDEPRPSLLATPP-SDNVVSWAIIPP  181

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VE L+A+G  ++ V+    +   +  GP + + VS NGK +A +T DG++ V+
Sbjct  182  AYTLSRSVEALLAIGKSIMTVDASEAEDRMLQNGPFRHISVSPNGKFVAVYTEDGKVWVV  241

Query  803  T  805
            T
Sbjct  242  T  242



>gb|KIW90849.1| hypothetical protein Z519_08632 [Cladophialophora bantiana CBS 
173.52]
Length=830

 Score =   126 bits (317),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/246 (32%), Positives = 134/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++YRK  LY+  + + ++L    VA +P+GG +A+ RD  KIV+ 
Sbjct  1    MTANNPRAGWEKVGDQFYRKVPLYESIFDQDLELENYLVAGAPYGGALALWRDTTKIVRY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T++GTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWEK--GVIRGLGWSDDEKLLVVTEEGTVHCYFELHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       VV C FW +G V +     +  +  F+ P P  LA    E    S
Sbjct  119  DFQPFSLGHGAEEFGVVSCRFWSHGFVALLSNNSLVAVSSFEEPRPRLLAQVP-EGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAIDKTIYVVDVTEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>ref|XP_007674604.1| hypothetical protein BAUCODRAFT_66530 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97761.1| hypothetical protein BAUCODRAFT_66530 [Baudoinia compniacensis 
UAMH 10762]
Length=823

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 129/241 (54%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  265
            A W+ + +R+YRK +LY   + + ++L    V  +P+ G +A+ RD +KI  L  A+SA 
Sbjct  6    AGWEPVGDRFYRKTQLYTSVFDQDLELENYVVTGAPYSGAVALYRDASKIFSLRGAQSAK  65

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + I++ AG  I +  W+    + VG  W++D+ L+ IT DGTV  Y          ++
Sbjct  66   SSIDIYSCAGKLIRQIPWERQTVKAVG--WSEDERLLVITNDGTVRSYADLHGDFTPFNI  123

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTVIEP  622
            G     H V  C FW NG V +    ++  +  ++ P P  LA  P  E   +S TVI P
Sbjct  124  GHGAEEHGVKGCKFWSNGFVALLGNNRLVAVTRYEEPRPQLLASTPSGE--VMSWTVIPP  181

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            +YT S  VEVL+A+   V +V+    +  G+  GP + + VS NGK +A +T D ++ V+
Sbjct  182  EYTSSRAVEVLLAINKTVYVVDPAECEDRGLEAGPFRHIGVSPNGKFIALYTDDSKVWVI  241

Query  803  T  805
            +
Sbjct  242  S  242



>ref|XP_007796791.1| putative vacuolar protein sorting-associated protein [Eutypa 
lata UCREL1]
 gb|EMR64106.1| putative vacuolar protein sorting-associated protein [Eutypa 
lata UCREL1]
Length=838

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 128/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYA-ESAL  265
            A W+ + +++YRK +LY   + + +DL    VA +P+GG IA+ RD+ KIV   A +S+ 
Sbjct  9    AGWEKVGDKFYRKTQLYTAIFDQDLDLDNYIVAGAPYGGAIAIYRDETKIVSFRASKSSK  68

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + I++ AG  +    W    G + G+ W++D+ L+ +  DGTV  Y          SL
Sbjct  69   PSIDIYSCAGKLLKSLAWDR--GSIKGLGWSEDEKLLVVGYDGTVRCYYGLQGDFTQFSL  126

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G++     V  C F+ +G+V +     +  +  +  P P  LA P  E    S T+I P 
Sbjct  127  GREAEDFGVQSCRFYDHGMVALLTNNTLISVTSYDEPRPKALASPP-EGEVHSWTIISPS  185

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+++G  + +V+    +   + IGP  ++ VS NGK  A +  DG+  V+T
Sbjct  186  FTLSRSVEVLLSIGKTIYVVDVTECEDRFLDIGPFSQISVSPNGKYAALYAVDGKAHVIT  245



>gb|KIV87870.1| hypothetical protein PV11_03388 [Exophiala sideris]
Length=830

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 134/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+T +  A W+ + +++Y+K +LY+  + + ++L    VA +P+GG +A+ RD +K+ + 
Sbjct  1    MTTNNSRAGWEKIGDQFYQKAQLYESVFDQDLELENYVVAGAPYGGALALWRDTSKVARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T++GTV+ Y     
Sbjct  61   RTGQSTKSTIDIYSSSGKLISNINWEK--GVIKGLGWSDDEKLLVVTEEGTVHCYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +   LG       V  C FW +G V +     +  +  F+ P P  LA    E    S
Sbjct  119  DFQPFLLGHGAEEFGVKSCRFWSHGFVALLSNNALVAVSSFEEPRPRLLAH-APEGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAVDKTIFVVDASEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>ref|XP_003855617.1| hypothetical protein MYCGRDRAFT_68201 [Zymoseptoria tritici IPO323]
 gb|EGP90593.1| hypothetical protein MYCGRDRAFT_68201 [Zymoseptoria tritici IPO323]
Length=824

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 126/242 (52%), Gaps = 9/242 (4%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ + +R+YR  +LY   +   ++L    V  +P+ G +A+ RD++KI  L   S  +
Sbjct  6    ADWRRIGDRFYRMVQLYTDVFDPSIELEHYTVTGAPYSGAVALRRDESKIYSLRGSSTAK  65

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + I++ AG  I +  W     + VG  W++D+ L+ +T+DGTV  Y          S+
Sbjct  66   STIDIYSCAGKLIRQIAWDKGNIKCVG--WSEDERLLVVTEDGTVRMYADLQGDFNPFSI  123

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD--PGLEDFPLSMTVIE  619
            G     H V DC FW NG V +     V  +  +  P P  LA   PG      S TV+ 
Sbjct  124  GHGAEEHGVQDCRFWSNGFVALLGNNAVVAVTRYDEPRPQLLASAPPGQ---VTSWTVVP  180

Query  620  PQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
            P+YT S +VEVL+A+   V +++    +  G+  GP + + VS NGK +A +T D ++ V
Sbjct  181  PEYTSSRSVEVLLAMEKTVYVIDAMECEDRGLEAGPFRHISVSPNGKFIALYTDDSKVWV  240

Query  800  MT  805
            ++
Sbjct  241  IS  242



>ref|XP_002678979.1| predicted protein [Naegleria gruberi]
 gb|EFC46235.1| predicted protein [Naegleria gruberi]
Length=846

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/257 (30%), Positives = 140/257 (54%), Gaps = 16/257 (6%)
 Frame = +2

Query  80   VSVAAEW-QLLYNR-----YYRKPELYQMQW--KHVDLTRNKVACSPFGGPIAVIRDDAK  235
            +SV+AEW QL   +     YYRK E+Y M+W   +++L+   +A + FGGPIA+ RD  K
Sbjct  1    MSVSAEWVQLGKGKKGVPVYYRKKEIYTMEWGDDNINLSECLIAAANFGGPIALTRDPKK  60

Query  236  IVQLYAESALRKLRIFNSAGVQIAETVWKNPGGR-LVGMSWTDDQTLICITQDGTVYRYD  412
            +++     + + + +F+S+G +I++  W     + L+ M WT +++LIC+T +  V+ +D
Sbjct  61   LLRFRGTDSKQYVHVFSSSGKRISKFEWNTQLNKSLLYMGWTQEESLICVTDEAHVFIFD  120

Query  413  IRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLA--DPGL  586
            I  + L+     ++  +  ++    W  G+  +   F V+ I D +  +  +LA  D  L
Sbjct  121  IFGKQLQQFPFPEEVKSAGILKVKHWETGIAILTRDFNVWVISDLEFIDCQQLASLDVPL  180

Query  587  E---DFPLSMTVIEPQYTMSGNVEVLMAV--GDHVLLVEEDGIQQLGVGIGPLQKMVVSR  751
            E   +  + M +++P    SG++EV+++V     V +V  +    LG+  GP  K+  S 
Sbjct  181  EFNDEKEIGMCILQPNIATSGDLEVIISVPQARTVYVVTSEECNNLGLDNGPFPKICASP  240

Query  752  NGKLLASFTHDGRLLVM  802
            +G+ LA+F   G L V+
Sbjct  241  SGEALATFNESGSLWVV  257



>gb|KIW59851.1| hypothetical protein PV05_00117 [Exophiala xenobiotica]
Length=830

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 133/246 (54%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M++ +  A W+ + +++Y+K +LY+  +   ++L    VA +P+GG +A+ RD +K+ + 
Sbjct  1    MTSNNPRAGWEKIGDQFYQKVQLYESVFDADLELENYFVAGAPYGGALALWRDTSKVARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DG V+ Y     
Sbjct  61   RTGQSTKSTIDIYSSSGKLISNINWEK--GLIKGLGWSDDEKLLVVTEDGVVHCYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +   LG     + VV C FW  G V +     +  +  F  P P  LA P  E    S
Sbjct  119  DFQPFLLGHGAEEYGVVSCRFWSQGFVALLGNNTLIAVSSFNEPRPRVLAQPP-EGEVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+A+   + +V+    +  G+  GP + + VS NG+  A +T D
Sbjct  178  WSLIPPAYTLSRSVEVLLAIDKTIYVVDASEAEDRGLSDGPFKHISVSPNGRFAALYTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>emb|CCL98206.1| predicted protein [Fibroporia radiculosa]
Length=895

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/246 (33%), Positives = 133/246 (54%), Gaps = 13/246 (5%)
 Frame = +2

Query  92   AEWQLLYNR--YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES--  259
            A WQ + +   +Y++ +LY +  K   L    +A   +GGPIA++RD  K++ L   +  
Sbjct  7    ATWQAMQDGTVFYKRHQLYSIPGKFPPLNDFVIAGCRYGGPIALMRDTTKVIALGTAAPS  66

Query  260  -ALRKLRIFNSAG-VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE  433
             +  ++ +F+SAG V +  +VW +  G++V   WT D+ L+ + ++G    YD++ E  +
Sbjct  67   FSKAQIHVFSSAGDVMLVFSVWDH--GKIVRFGWTADERLVVLNEEGVYRLYDLQGE-YQ  123

Query  434  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  613
              SLG D     ++D     NG+V +  +  +  I ++    P+ LA+PGL   P S  V
Sbjct  124  QYSLGSDAGELGIIDARIHENGIVALTGSLTLLEIKEWNGGKPLTLANPGLSQPPHSWAV  183

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVE--EDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
            I P +T+S +VEVLM+V   +  V+  E   QQL    GP  +M  S NGK LA  T+ G
Sbjct  184  IPPDFTISRHVEVLMSVESSIYSVDNLESVDQQLSR--GPFTRMSPSPNGKSLALLTYSG  241

Query  788  RLLVMT  805
             L V++
Sbjct  242  LLWVVS  247



>ref|XP_003655439.1| hypothetical protein THITE_2119126 [Thielavia terrestris NRRL 
8126]
 gb|AEO69103.1| hypothetical protein THITE_2119126 [Thielavia terrestris NRRL 
8126]
Length=834

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 129/248 (52%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M      A W+ L +R+YRK +LY Q+  + +DL    VA +P+GG IA+ RD+ K++  
Sbjct  1    MDVAHPTAGWEQLGDRFYRKTQLYAQVFDQDLDLDNYLVAGAPYGGAIALYRDEDKLIAF  60

Query  248  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRA  421
             A    +  + I++ AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ 
Sbjct  61   QATHPSKPSIDIYSCAGKLIRRINWDQ--GSIKGLGWSEDEKLLVVTADGTVRCYYDLQG  118

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            E     SLG       V  C F+ +G+V + +   +  +  +  P P  LA P  E    
Sbjct  119  E-FTQFSLGNGADEAGVQSCRFYAHGLVALLKNNALVSVSSYDEPRPKLLASPP-EGQVH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P YT+S +VEVL+++G  + + +    +   + IGP   + VS NG+  A +T 
Sbjct  177  SWNIIPPAYTLSRSVEVLLSIGQTIYMCDASECEDRFLDIGPFSHIAVSPNGRFCALYTA  236

Query  782  DGRLLVMT  805
             G+  V+T
Sbjct  237  TGQAHVIT  244



>gb|KGO75736.1| Vps16, N-terminal [Penicillium italicum]
Length=828

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 129/240 (54%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  265
            A W  L + +YRK  +Y   ++  V+L    VA +P+GG IA+ RD++K  +L   + + 
Sbjct  7    ANWGKLADSFYRKIAIYDAIFEDDVELENYIVAGAPYGGAIALYRDESKPFRLRDGQGSR  66

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ +G +I    WK    R  G+ W+D + L+ +++DGTV RY        S SL
Sbjct  67   STIDVYSCSGQKINRINWKKATIR--GLGWSDKEELLVVSEDGTVRRYFGLDGEFTSFSL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     + V  C FW +G+V +    Q+  +  +  P P  LA P  E    S  +I P 
Sbjct  125  GNGAEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRLLA-PCPEGEVSSWALIPPA  183

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+AV   V L++    +   +  GP + ++VS  G+L+A FT +G+L V++
Sbjct  184  HTLSRSVEVLLAVDKTVFLIDSTEAEDKILQDGPFKHIIVSPTGRLVALFTAEGKLWVVS  243



>emb|CCX31232.1| Similar to Probable vacuolar protein sorting-associated protein 
16 homolog; acc. no. Q9UT38 [Pyronema omphalodes CBS 100304]
Length=833

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/249 (32%), Positives = 130/249 (52%), Gaps = 8/249 (3%)
 Frame = +2

Query  74   STVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            S VS  A+W+ L +R+YRK  LY ++     DL   ++A +PF G IA+ ++D  + +  
Sbjct  3    SAVSATADWEQLEDRFYRKILLYSELFGPDYDLNDYQIAGAPFSGAIALYKNDDVLQEFR  62

Query  251  AESALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
            + +A  K  + I++SAG  I    +    G + G+ W++D+ L+ I +DGTV  Y     
Sbjct  63   SGAAQTKPSIEIYSSAGKLIRRIAYDK--GPIRGLGWSEDEKLLVIAEDGTVRCYSDLQG  120

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPG--LEDFP  598
                 SLG       V +  FW  G V +    ++  +  +  P P  LADP   +ED  
Sbjct  121  DFTQFSLGHGVEMVRVKEVRFWSTGFVALLRTNRLVAVSRYDEPRPKYLADPSPYIEDAV  180

Query  599  L-SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASF  775
            + S  +I P YT+S +VEVL++ G  +++++    Q   +  GP   + VS NGK +A +
Sbjct  181  IHSWAIIPPAYTLSRHVEVLLSTGSTIIVLDPTDAQDQDLQNGPFTNISVSPNGKYVALY  240

Query  776  THDGRLLVM  802
            T  G+L V+
Sbjct  241  TTQGKLWVI  249



>gb|EFW19425.1| vacuolar protein sorting vps16 [Coccidioides posadasii str. Silveira]
Length=829

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 132/248 (53%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M++ +  A+W+ + ++ YRK  +Y   + + +DL       +P+GG IA+ RD++K+ Q 
Sbjct  1    MASTNPRADWEKVGDQLYRKIRIYDAVFDEDLDLENYIAVGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y   + A   + I++ +G +I    W +  G + G+ W++D+ L+ + +DGTV  Y    
Sbjct  60   YRDPQPAKSSIDIYSYSGQRINRINWDH--GSIRGLGWSEDEKLLVVAEDGTVRCYYGLN  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V DC FW  G V +    Q+  +  +  P P  LA P  E    
Sbjct  118  GDFSPFSLGAAAEEHRVKDCRFWSTGFVALLYNNQLVSVTSYNEPRPKLLALPP-EGEIH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++  P YT+S +VEVL+++G  + +V+    +   +  GP + + VS NG+ +A FT 
Sbjct  177  SWSITPPSYTLSRSVEVLLSIGQTIYVVDVTDAEDRVLQNGPFKHISVSSNGRFVALFTG  236

Query  782  DGRLLVMT  805
            DG+L V++
Sbjct  237  DGKLWVVS  244



>ref|XP_003712813.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
70-15]
 gb|EHA53006.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
70-15]
 gb|ELQ35378.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
Y34]
 gb|ELQ63175.1| vacuolar protein sorting-associated protein [Magnaporthe oryzae 
P131]
Length=829

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/244 (32%), Positives = 127/244 (52%), Gaps = 5/244 (2%)
 Frame = +2

Query  80   VSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  256
            +S  A W+ + ++YYRK +LY   +   +DL    VA +P GG +A+  D+ K+V+  A 
Sbjct  3    LSPTAGWEQVGDKYYRKVQLYTEVFDLDLDLDNYVVAGAPDGGAVALYLDENKLVEYRAG  62

Query  257  SALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLE  433
             A +  + I++ AG  I    W    G + G+ W++D+ L+ +T+DGTV  Y    E   
Sbjct  63   KARKPSIDIYSCAGKLIRSINWDK--GSIRGLGWSEDEKLLVVTKDGTVRCYYGLQEDFT  120

Query  434  SLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTV  613
              SLG     + V  C F+  G+V +     +  +  ++ P P  L  P  E    S T+
Sbjct  121  QFSLGHGAEEYGVHSCRFYETGMVALLTNNTLVTVSSYEEPRPKPLVSPP-EGEVHSWTI  179

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRL  793
            I P+YT+S +VEVL+++G  + + +    +   + IGP   M VS NGK  A +T  G +
Sbjct  180  IAPRYTLSRSVEVLLSIGQTIYVTDASECEDRYLDIGPFTHMAVSPNGKFAALYTPAGEV  239

Query  794  LVMT  805
             V+T
Sbjct  240  HVIT  243



>gb|EMF15307.1| vacuolar protein sorting-associated protein [Sphaerulina musiva 
SO2202]
Length=828

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 125/249 (50%), Gaps = 7/249 (3%)
 Frame = +2

Query  71   MSTVSVAAE--WQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIV  241
            MS V   A   W+ + +R+YRK ELY+  +   ++L    V  +PF G +A+ RD  K  
Sbjct  2    MSEVEKKATFGWERIGDRFYRKTELYRDIFDPDLELENFTVTGAPFSGAVALRRDTTKAS  61

Query  242  QLYA-ESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  418
                  SA   + I + AG  I +  W    G +V + W++D+ L+ +T DG V  Y   
Sbjct  62   TFRGPHSAKPTIDIHSCAGKLIRQIQWDR--GNIVCLGWSEDEKLLVVTDDGAVRVYSDL  119

Query  419  AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFP  598
                   SLG     H V+ C FW +G V +     +  +  +  P P  LA     D  
Sbjct  120  QADFTPFSLGHGAEDHGVLACRFWSSGFVALLGNNNLVVVARYDEPRPQLLASAPAGDV-  178

Query  599  LSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFT  778
            +S TVI P+YT S +VEVL+AV   V +V+    +  G+  GP + + VS NGK +A +T
Sbjct  179  ISWTVIAPEYTSSRSVEVLLAVDQTVYVVDAVECEDRGLQAGPFRHIAVSPNGKFVALYT  238

Query  779  HDGRLLVMT  805
             DG++ V++
Sbjct  239  DDGKVWVIS  247



>emb|CCD43976.1| similar to vacuolar protein sorting vps16 [Botrytis cinerea T4]
Length=852

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 130/252 (52%), Gaps = 9/252 (4%)
 Frame = +2

Query  59   NNLRMSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAK  235
            +N+ M+  S  AEW+ + ++YYRK +LY   + + ++L    V    +GG IA+ RD+ K
Sbjct  21   SNIEMT--SPTAEWEKVGDKYYRKTQLYTAVFDQDLELENYVVTGCSYGGAIALYRDETK  78

Query  236  IVQLYAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RY  409
            +       A +  + I++ AG  I    W      + G+ WT+D+ LI +T DGTV   Y
Sbjct  79   LQTFRGSQASKSSIDIYSCAGKLIRRINWDQSS--IKGLGWTEDEKLIVVTADGTVRCYY  136

Query  410  DIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLE  589
            D++ +     SLG       V+DC F+  G V +     +  +  ++ P P  LA P   
Sbjct  137  DLQGD-FNQFSLGNGAEEFGVIDCRFYGTGFVALLSNNHLISVSRYEEPRPKLLATPPEG  195

Query  590  DFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLA  769
            D   S T+I P YT+S +VEVL+++G  + + +    +   + IGP   + VS NGK +A
Sbjct  196  DVH-SWTLIPPTYTLSRSVEVLLSIGQTIHVADAAESEDRFLDIGPFTHISVSPNGKFVA  254

Query  770  SFTHDGRLLVMT  805
             +T  G   V+T
Sbjct  255  LYTEKGNAYVIT  266



>gb|KIX08743.1| hypothetical protein Z518_03400 [Rhinocladiella mackenziei CBS 
650.93]
Length=830

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 131/246 (53%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++YRK  LY+  +   ++L    VA + +GG +A+ RD  KI + 
Sbjct  1    MTNNNPRAGWEKIGDQFYRKLPLYESIFDPDLELENYLVAGASYGGALALWRDTTKIARY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
               +S    + I++S+G  I+   W+   G + G+ W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGQSTKPTIDIYSSSGKLISNINWEK--GSIKGLGWSDDEKLLVVTEDGTVHCYLGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG     + V  C FW +G V +     +  +  F+ P P  LA     D   S
Sbjct  119  DFQPFSLGHGAEEYGVKSCRFWSHGFVALLANNALIAVSSFEEPRPRLLAPAPAGDVH-S  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + +V+    +  G+  GP + + VS NG+  A FT D
Sbjct  178  WSLIPPAYTLSRSVEVLLAVHKTIYVVDVTEAEDRGLSDGPFKHVSVSPNGRFAALFTED  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>ref|XP_007761004.1| hypothetical protein A1O7_08825 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ55894.1| hypothetical protein A1O7_08825 [Cladophialophora yegresii CBS 
114405]
Length=830

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 130/246 (53%), Gaps = 5/246 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + +++YRK  +Y+  + + ++L    VA +P+GG +A+ RD AKI + 
Sbjct  1    MTASNPRAGWEKVGDQFYRKVPVYESVFDQDLELENYLVAGAPYGGALALWRDTAKIAKY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                S    + I++S+G  I+   W+   G +  + W+DD+ L+ +T+DGTV+ Y     
Sbjct  61   RTGHSTKPTIDIYSSSGKLISNINWER--GVIKALGWSDDEKLLVVTEDGTVHCYFGLHS  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
              +  SLG       V+ C FW +G V +     +  +  F  P P  LA    E    S
Sbjct  119  DFQPFSLGHGSEEFGVLSCRFWSHGFVALLSNNSLIAVSSFDEPRPRLLAQTP-EGQVHS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + +V+    +  G+  GP   + VS NG+  A FT +
Sbjct  178  WSLIPPAYTLSRSVEVLLAVDKTIFVVDASDAEDRGLSDGPFMHVSVSPNGRFAALFTEN  237

Query  785  GRLLVM  802
            G++ V+
Sbjct  238  GKVWVV  243



>gb|EPS32356.1| hypothetical protein PDE_07316 [Penicillium oxalicum 114-2]
Length=829

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/247 (31%), Positives = 130/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ + + +YRK  +Y   + +  +L    V  +P+GG IA+ RD++K  QL
Sbjct  1    MAPANPLANWEKVDDSFYRKIPVYDAVFDEDTELENYIVVGAPYGGAIALYRDESKPFQL  60

Query  248  YAESALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                A R  + I++ +G QI    W+    R  G+ W+D + L+ +++DGTV RY     
Sbjct  61   RDSQASRSCIEIYSCSGKQITRINWEQATIR--GLGWSDKEELLVVSEDGTVRRYFGLDG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW +G+V +    Q+  +  +  P P  LA P  E    S
Sbjct  119  EFTSFSLGNGAEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRALA-PCPEGEVSS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P +T+S +VEVL+AV   V  ++    +   +  GP + + VS +G+ +A FT +
Sbjct  178  WSLIPPAHTLSRSVEVLLAVDKTVYSIDSTEAEDKILQDGPFKNLAVSPSGRFVALFTAE  237

Query  785  GRLLVMT  805
            G+L +++
Sbjct  238  GKLWIVS  244



>ref|XP_010762126.1| hypothetical protein PADG_06891 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH50812.2| hypothetical protein PADG_06891 [Paracoccidioides brasiliensis 
Pb18]
Length=830

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 136/248 (55%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD+ K+ Q 
Sbjct  1    MAPTNPLADWEKVGDRFYRKIRVYDAVFDEDLELENFIVAGAPYGGSIALYRDENKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+    + I++ +G +I+    ++   R  G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETGKSYIDIYSCSGQRISRINGEHAAIR--GLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     + V  C FW +G V +    Q+  +  +  P P  LA P   +   
Sbjct  118  GDFTPFSLGTTAEENGVKACRFWSDGFVALLYNNQLIAVSRYDEPRPKLLASPPAGEVS-  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+A+ + + +V+    +   +  GP + + VS NG+ +A +T 
Sbjct  177  SWSLIPPNYTLSRSVEVLLAIDETIYVVDATEAEDRMLQNGPFKHVSVSPNGRFVALYTG  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKMWVVS  244



>gb|EEH15770.1| hypothetical protein PABG_05857 [Paracoccidioides brasiliensis 
Pb03]
Length=830

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 136/248 (55%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD+ K+ Q 
Sbjct  1    MAPTNPLADWEKVGDRFYRKIRVYDAVFDEDLELENFIVAGAPYGGSIALYRDENKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+    + I++ +G +I+    ++   R  G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETGKSYIDIYSCSGQRISRINGEHAAIR--GLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     + V  C FW +G V +    Q+  +  +  P P  LA P   +   
Sbjct  118  GDFTPFSLGTAAEENGVKACRFWSDGFVALLYNNQLIAVSRYDEPRPKLLASPPAGEVS-  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+A+ + + +V+    +   +  GP + + VS NG+ +A +T 
Sbjct  177  SWSLIPPNYTLSRSVEVLLAIDETIYVVDATEAEDRMLQNGPFKHVSVSPNGRFVALYTG  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKMWVVS  244



>ref|XP_003067206.1| Vps16 family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EER25061.1| Vps16 family protein [Coccidioides posadasii C735 delta SOWgp]
Length=829

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 131/248 (53%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVAC-SPFGGPIAVIRDDAKIVQL  247
            M++ +  A+W+ + ++ YRK  +Y   +       N +A  +P+GG IA+ RD++K+ Q 
Sbjct  1    MASTNPRADWEKVGDQLYRKIRIYDAVFDEDLELENYIAVGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y   + A   + I++ +G +I    W +  G + G+ W++D+ L+ + +DGTV  Y    
Sbjct  60   YRDPQPAKSSIDIYSYSGQRINRINWDH--GSIRGLGWSEDEKLLVVAEDGTVRCYYGLN  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V DC FW  G V +    Q+  +  +  P P  LA P  E    
Sbjct  118  GDFSPFSLGAAAEEHRVKDCRFWSTGFVALLYNNQLVSVTSYNEPRPKLLALPP-EGEIH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++  P YT+S +VEVL+++G  + +V+    +   +  GP + + VS NG+ +A FT 
Sbjct  177  SWSITPPSYTLSRSVEVLLSIGQTIYVVDVTDAEDRVLQNGPFKHISVSSNGRFVALFTG  236

Query  782  DGRLLVMT  805
            DG+L V++
Sbjct  237  DGKLWVVS  244



>ref|XP_007869321.1| vacuolar assembling/sorting protein VPS16 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ52133.1| vacuolar assembling/sorting protein VPS16 [Gloeophyllum trabeum 
ATCC 11539]
Length=846

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 126/243 (52%), Gaps = 8/243 (3%)
 Frame = +2

Query  92   AEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES--  259
            A WQ +   N +YR+ ++Y +  K  +L   KVA   +GGP+A++RD+ K+V L   +  
Sbjct  7    ASWQAMQDANVFYRRQQIYSIPGKLPNLDDYKVAACRYGGPLALMRDNDKLVALGRATPV  66

Query  260  -ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  436
             A  ++++F+ AG  +    W+    R+V   WT D+ L+ + ++G    YD++ E  E 
Sbjct  67   FAKAQIQVFSPAGEGLLIFSWEQ--ARIVRFGWTGDERLVVLNEEGVYRIYDLQGE-YEQ  123

Query  437  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  616
             SLG +     V D     NG+V +  +     +  +    P+ LA+PGL   P S T+I
Sbjct  124  YSLGSEVAEIGVEDAKIHDNGLVALTNSLTFLEVRGWSGGKPVTLANPGLSQPPSSWTII  183

Query  617  EPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLL  796
             P+ T+S +VEVL++V   +  V+        +  GP   M  S NGK LA  T  G LL
Sbjct  184  PPELTISRHVEVLLSVESTIYTVDNLENTDQRISRGPFTHMASSPNGKSLALLTFAGLLL  243

Query  797  VMT  805
            V++
Sbjct  244  VVS  246



>ref|XP_002598771.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
 gb|EEN54783.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
Length=761

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 136/251 (54%), Gaps = 23/251 (9%)
 Frame = +2

Query  86   VAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL  265
            V  +W  L   +YRK E+Y M W+ +DL +  VA +P+GGPIA+IRD+ K+V++  + ++
Sbjct  4    VTGDWNPLGQVFYRKQEIYSMGWRDIDLDKFVVAAAPYGGPIALIRDETKLVRV--QGSI  61

Query  266  RK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
            R  + I+ S+G +I+   W +  G ++ + W+  + L+C+ +DG+V  YDI  +   + S
Sbjct  62   RPVIYIYTSSGREISSIRWNS--GHVIHLGWSCSEELLCVQEDGSVLVYDIFGQFKRTFS  119

Query  443  LGKDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSM  607
            +G +     V DC  +++    G+  +  ++++F + +   P   ++AD PGL+  P S 
Sbjct  120  MGTEAKEMKVRDCRIFNSHQGTGLAVMTSSYRIFMVNNVDEPRIRRMADVPGLDAPPSSW  179

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQK-------MVVSRNGKLL  766
             VI    +      VL+A  + + L++  G  Q    + P+ +       M VS N K L
Sbjct  180  VVI----SQDRQSRVLLARENDLYLLDHGG--QYSRQLAPVSQQVEAYTEMAVSFNNKYL  233

Query  767  ASFTHDGRLLV  799
            A FT+ G L +
Sbjct  234  ALFTNTGLLWI  244



>gb|ELR08066.1| hypothetical protein GMDG_02893 [Pseudogymnoascus destructans 
20631-21]
Length=821

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 124/240 (52%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W+ L  RYYRK +LY   + + ++L  + V  +P+GG IA+  D+AK+       A +
Sbjct  5    ADWEKLGERYYRKVQLYTEVFDQDLELENHIVTGAPYGGAIALYHDEAKLHTFRGSQASK  64

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + + + AG  I    W    G + G+ W++D+ L+ +TQDGTV  Y          SL
Sbjct  65   SSIDVCSCAGKLIRRINWDK--GSIKGLGWSEDEKLLVVTQDGTVRCYYNLQGDFSQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G       V+ C F+  G V +    ++  +  ++ P P  LA P  +    S T++ P 
Sbjct  123  GHGAEEFGVIACRFYSTGFVALLSNNRLISVSRYEEPRPKLLAVPP-DGVVHSWTLVPPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+A+G+ + +V+        + IGP   + VS NGK  A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLAIGETIYVVDATESDDRMLDIGPFIHISVSPNGKFAALYTESGKAYVIT  241



>gb|EMT03828.1| Vacuolar sorting-associated protein 16-like protein [Aegilops 
tauschii]
Length=335

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 6/128 (5%)
 Frame = +2

Query  437  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFK--NPNPIKLADPGL--EDFPLS  604
            L+L    +   V D VFW  GV  + E  +V    D +  +P+P +LADPG+  ++  L 
Sbjct  12   LTLPLSVYEGGVADAVFWGGGVAILTEDNRVVVTTDIEVDDPHPRELADPGVAEDEQVLC  71

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLG--VGIGPLQKMVVSRNGKLLASFT  778
            M V+EPQ+ MSG+ EVL+AVGD V+ V+EDG+Q LG  + IGP+QKM VS NGKLLA+F 
Sbjct  72   MAVVEPQFVMSGSPEVLLAVGDRVVAVDEDGVQVLGEALEIGPVQKMAVSPNGKLLAAFA  131

Query  779  HDGRLLVM  802
            HDGRLLV+
Sbjct  132  HDGRLLVI  139



>ref|XP_007785089.1| hypothetical protein W97_09035 [Coniosporium apollinis CBS 100218]
 gb|EON69772.1| hypothetical protein W97_09035 [Coniosporium apollinis CBS 100218]
Length=835

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 130/241 (54%), Gaps = 9/241 (4%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ +  R+YRK +LY   + + ++L    VA +P+ G +A+ RD+ K V  Y  A +A
Sbjct  6    ADWEKVGTRFYRKVQLYTAVFDQDLELENYLVAGAPYSGALALHRDEEK-VHAYRGARAA  64

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESL  439
               + +++ AG  I    W+   G + G+ W++D+ L+ +T+DGTV   YD++ +     
Sbjct  65   KPSIDVYSCAGKLIRRINWEK--GSIKGLGWSEDEKLLVVTEDGTVRCYYDLQGD-FVPF  121

Query  440  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  619
            +LG     H V  C FW NG V +     +  +  +  P P  LA P  E    S T+I 
Sbjct  122  TLGHGAEEHGVKACRFWSNGFVALLNNNHLISVARYDEPRPKLLAIPP-EGEIHSWTLIP  180

Query  620  PQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
            P YT+S +VEVL++    + +++    +      GP   M VS NGKL+A +T++G+L V
Sbjct  181  PAYTLSRSVEVLLSTDKTIYVIDASDSEDRNYSEGPFVHMSVSPNGKLVALYTNNGKLWV  240

Query  800  M  802
            +
Sbjct  241  V  241



>ref|XP_002584341.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP80188.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=697

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 130/248 (52%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVAC-SPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + ++ Y+K  +Y   +       N +A  +P+GG IA+ RD+ K+ Q 
Sbjct  1    MAPANPRADWEKVGDQLYQKVRIYDAVFDEDLELENYIAVGAPYGGAIALYRDETKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y   ++A   + I++ +G +I+   W +  G + G+ W++D+ L+ +T+DGT   Y    
Sbjct  60   YRDPQTAKSSIDIYSYSGQRISRINWDH--GSIRGLGWSEDEKLLVVTEDGTARCYYGLN  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V DC FW  G V +    Q   +  +  P P  LA P  E    
Sbjct  118  GDFSPFSLGSAAEEHGVKDCRFWPTGFVALLYNNQFISVTRYDEPRPKLLASPP-EGEIH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+A+   + +V+    +   +  GP + + VS NG+ +A FT 
Sbjct  177  SWSLIPPSYTLSRSVEVLLAIERTIYVVDATDAEDRVLQNGPFKHISVSPNGRFVALFTQ  236

Query  782  DGRLLVMT  805
            DG+L V++
Sbjct  237  DGKLWVVS  244



>ref|XP_001239640.1| hypothetical protein CIMG_09261 [Coccidioides immitis RS]
Length=834

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 130/248 (52%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVAC-SPFGGPIAVIRDDAKIVQL  247
            M++ +  A+W+ + ++ YRK  +Y   +       N +A  +P+GG IA+ RD++K+ Q 
Sbjct  1    MASTNPRADWEKVGDQLYRKIRIYDAVFDEDLELENYIAVGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y   + A   + IF+ +G +I    W +  G + G+ W++D+ L+ + +DGTV  Y    
Sbjct  60   YRDPQPAKSSIDIFSYSGQRINRINWDH--GSIRGLGWSEDEKLLVVAEDGTVRCYYGLN  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V DC FW  G V +    Q+  +  +  P P  LA P  E    
Sbjct  118  GDFSPFSLGAAAEEHRVKDCRFWSTGFVALLYNNQLVSVTSYNEPRPKLLALPP-EGEIH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++  P YT+S +VEVL+++   + +V+    +   +  GP + + VS NG+ +A FT 
Sbjct  177  SWSITPPSYTLSRSVEVLLSISQTIYVVDVTDAEDRVLQNGPFKHISVSSNGRFVALFTG  236

Query  782  DGRLLVMT  805
            DG+L V++
Sbjct  237  DGKLWVVS  244



>gb|EEH40515.2| vacuolar protein sorting-associated protein [Paracoccidioides 
sp. 'lutzii' Pb01]
Length=830

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 136/248 (55%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG IA+ RD+ K+ Q 
Sbjct  1    MAPTNPLADWEKVGDRFYRKIRVYDAVFDEDLELENFIVAGAPYGGSIALYRDENKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y  AE+    + I++ +G +I+    ++   R  G+ W+DD+ L+ +TQDGTV  Y    
Sbjct  60   YRDAETGKSYIDIYSCSGQRISRINGEHAAIR--GLGWSDDEKLLVVTQDGTVRCYYGLH  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     + V  C FW +G V +    Q+  +  +  P P  LA P   +   
Sbjct  118  GDFTPFSLGTAAEENGVKACRFWSDGFVALLYNNQLIAVSRYDEPRPKLLASPPAGEVS-  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P Y++S +VEVL+A+ + + +V+    +   +  GP + + VS NG+ +A +T 
Sbjct  177  SWSLIPPNYSLSRSVEVLLAIDETIYVVDATEAEDRMLQNGPFKHVSVSPNGRFVALYTG  236

Query  782  DGRLLVMT  805
            DG++ V++
Sbjct  237  DGKMWVVS  244



>gb|EAS28057.3| vacuolar protein sorting vps16 [Coccidioides immitis RS]
Length=829

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 130/248 (52%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKHVDLTRNKVAC-SPFGGPIAVIRDDAKIVQL  247
            M++ +  A+W+ + ++ YRK  +Y   +       N +A  +P+GG IA+ RD++K+ Q 
Sbjct  1    MASTNPRADWEKVGDQLYRKIRIYDAVFDEDLELENYIAVGAPYGGAIALYRDESKL-QR  59

Query  248  Y--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
            Y   + A   + IF+ +G +I    W +  G + G+ W++D+ L+ + +DGTV  Y    
Sbjct  60   YRDPQPAKSSIDIFSYSGQRINRINWDH--GSIRGLGWSEDEKLLVVAEDGTVRCYYGLN  117

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
                  SLG     H V DC FW  G V +    Q+  +  +  P P  LA P  E    
Sbjct  118  GDFSPFSLGAAAEEHRVKDCRFWSTGFVALLYNNQLVSVTSYNEPRPKLLALPP-EGEIH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++  P YT+S +VEVL+++   + +V+    +   +  GP + + VS NG+ +A FT 
Sbjct  177  SWSITPPSYTLSRSVEVLLSISQTIYVVDVTDAEDRVLQNGPFKHISVSSNGRFVALFTG  236

Query  782  DGRLLVMT  805
            DG+L V++
Sbjct  237  DGKLWVVS  244



>ref|XP_003009824.1| vacuolar protein sorting-associated protein [Verticillium alfalfae 
VaMs.102]
 gb|EEY24086.1| vacuolar protein sorting-associated protein [Verticillium alfalfae 
VaMs.102]
Length=441

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 128/238 (54%), Gaps = 6/238 (3%)
 Frame = +2

Query  98   WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE-SALRK  271
            W+ + ++++RK +LY   + + +DL  + VA +P GG +A+ RDD KI    A+ SA   
Sbjct  10   WESVGDKWFRKTQLYTEVFDQDLDLDNHIVAGAPNGGALAIYRDDTKIQAYRAQKSAKPS  69

Query  272  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  451
            + I++ AG ++    W    G + G+ W++D++L+ +T DGTV  YD++ E     SLG 
Sbjct  70   IDIYSYAGKKLRSIAWDK--GSIKGIGWSEDESLLIVTADGTVRVYDLQGE-FTQFSLGN  126

Query  452  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  631
                + V  C F+ +G+V +     +  +  +  P P  LA P  E       ++ P +T
Sbjct  127  GADNYGVTSCRFYDHGMVALLTNNALISVTSYSEPRPKLLASPP-EGEIHGWAIMTPAHT  185

Query  632  MSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +S ++EVL+++G  + + +    +   + IGP   + VS +G L+A +T  G   V++
Sbjct  186  LSRSIEVLLSIGQTLYVADATECEDRFLDIGPFSHVSVSPDGGLIALYTESGIAHVIS  243



>ref|XP_007290703.1| vacuolar protein sorting [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD19577.1| vacuolar protein sorting [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=825

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 124/240 (52%), Gaps = 6/240 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            AEW+ + +++YRK +LY   + + ++L    VA   +GG IA+ RD+ K+       A +
Sbjct  6    AEWEKVGDKFYRKIQLYTAVFDQDLELENYIVAGCSYGGAIALHRDETKLHSFRGTQASK  65

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  I    W    G + G+ W++++ LI +T DG    YDI+ +     SL
Sbjct  66   SSIDLYSCAGKLIRSINWDK--GSIRGLGWSEEEKLIVVTADGMFRCYDIQGD-FAQFSL  122

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     H V  C F+  G V +     +  +  +  P P  LA P   D   S T+I P 
Sbjct  123  GHGAEEHGVTACRFYGGGFVALLSNNHLISVSRYDEPRPKLLAPPPEGDVH-SWTLIAPA  181

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+++G  + +V+    +   + IGP   + VS NG+ +A +T  G+  V+T
Sbjct  182  YTLSRSVEVLLSIGQTIYVVDATEAEDRMLDIGPFTHISVSPNGRFVALYTETGKAYVIT  241



>dbj|GAA90716.1| vacuolar protein sorting vps16 [Aspergillus kawachii IFO 4308]
Length=829

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 130/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  +Y   +   V+L    +A +P+GG IA+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVPIYDAIFDDDVELENYIIAGAPYGGAIALHRDESKPYRF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A++A   + I++ +G  I    W+   G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTAKSSIDIYSCSGKHINRINWEY--GTIRGLGWSDKEELLVITEDGTVRRYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW +G V +    Q+  + ++  P P  LA P  E    S
Sbjct  119  DFTSFSLGNGAEDYGVRACRFWTSGFVALLSNNQLVAVSNYDEPRPRLLA-PCPEGEVSS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   V LV+    +   +  GP +   VS  G+ +A  T +
Sbjct  178  WSLIPPAYTLSRSVEVLLAVDKTVYLVDPTEAEDKVLQNGPFKHASVSPTGRFVALITAE  237

Query  785  GRLLVMT  805
            G++ V++
Sbjct  238  GKVWVVS  244



>ref|XP_001401136.1| vacuolar protein sorting vps16 [Aspergillus niger CBS 513.88]
 emb|CAK42074.1| unnamed protein product [Aspergillus niger]
Length=829

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 130/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  +Y   +   V+L    +A +P+GG IA+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVPIYDAIFDDDVELENYIIAGAPYGGAIALHRDESKPYRF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A++A   + I++ +G  I    W+   G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTAKSSIDIYSCSGKHINRINWEY--GTIRGLGWSDKEELLVITEDGTVRRYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW +G V +    Q+  + ++  P P  LA P  E    S
Sbjct  119  DFTSFSLGNGAEDYGVRACRFWTSGFVALLSNNQLVAVSNYDEPRPRLLA-PCPEGEVSS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   V LV+    +   +  GP +   VS  G+ +A  T +
Sbjct  178  WSLIPPAYTLSRSVEVLLAVDKTVYLVDPTEAEDKVLQNGPFKHASVSPTGRFVALITAE  237

Query  785  GRLLVMT  805
            G++ V++
Sbjct  238  GKVWVVS  244



>gb|EHA27921.1| hypothetical protein ASPNIDRAFT_53870 [Aspergillus niger ATCC 
1015]
Length=829

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 130/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  +Y   +   V+L    +A +P+GG IA+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVPIYDAIFDDDVELENYIIAGAPYGGAIALHRDESKPYRF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A++A   + I++ +G  I    W+   G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTAKSSIDIYSCSGKHINRINWEY--GTIRGLGWSDKEELLVITEDGTVRRYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW +G V +    Q+  + ++  P P  LA P  E    S
Sbjct  119  DFTSFSLGNGAEDYGVRACRFWTSGFVALLSNNQLVAVSNYDEPRPRLLA-PCPEGEVSS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   V LV+    +   +  GP +   VS  G+ +A  T +
Sbjct  178  WSLIPPAYTLSRSVEVLLAVDKTVYLVDPTEAEDKVLQNGPFKHASVSPTGRFVALITAE  237

Query  785  GRLLVMT  805
            G++ V++
Sbjct  238  GKVWVVS  244



>ref|XP_664515.1| hypothetical protein AN6911.2 [Aspergillus nidulans FGSC A4]
 gb|EAA57594.1| hypothetical protein AN6911.2 [Aspergillus nidulans FGSC A4]
Length=774

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 132/248 (53%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  LY   + + V+L    VA +P+GG IA+ RD++K ++ 
Sbjct  1    MAPSNPLANWERLGSSFYRKVPLYHSVFGEDVELENYIVAGAPYGGAIALYRDESKPLRF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A++    + I++ +G  I    W++  G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTGKSNIDIYSRSGKLINRLNWEH--GTIRGLGWSDQEELLVITEDGTVRRYFGLYG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
               S SLG     + V  C FW++G V +    Q+  +  +  P P  LA  P  E    
Sbjct  119  DFTSFSLGNGAEEYGVRACRFWNSGFVALLANNQLIAVSSYNEPRPRLLAQCP--EGEVA  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + LV+    +   +  GP +   VS  G+ +A  T 
Sbjct  177  SWSLIPPAYTLSRSVEVLLAVDKTIYLVDPTEAEDKVLQNGPFKHASVSPTGQFVALLTA  236

Query  782  DGRLLVMT  805
            +G++ V++
Sbjct  237  EGKVWVVS  244



>tpe|CBF71716.1| TPA: vacuolar protein sorting vps16, putative (AFU_orthologue; 
AFUA_5G13600) [Aspergillus nidulans FGSC A4]
Length=829

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 132/248 (53%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  LY   + + V+L    VA +P+GG IA+ RD++K ++ 
Sbjct  1    MAPSNPLANWERLGSSFYRKVPLYHSVFGEDVELENYIVAGAPYGGAIALYRDESKPLRF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A++    + I++ +G  I    W++  G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTGKSNIDIYSRSGKLINRLNWEH--GTIRGLGWSDQEELLVITEDGTVRRYFGLYG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
               S SLG     + V  C FW++G V +    Q+  +  +  P P  LA  P  E    
Sbjct  119  DFTSFSLGNGAEEYGVRACRFWNSGFVALLANNQLIAVSSYNEPRPRLLAQCP--EGEVA  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S ++I P YT+S +VEVL+AV   + LV+    +   +  GP +   VS  G+ +A  T 
Sbjct  177  SWSLIPPAYTLSRSVEVLLAVDKTIYLVDPTEAEDKVLQNGPFKHASVSPTGQFVALLTA  236

Query  782  DGRLLVMT  805
            +G++ V++
Sbjct  237  EGKVWVVS  244



>ref|XP_001229607.1| hypothetical protein CHGG_03091 [Chaetomium globosum CBS 148.51]
 gb|EAQ91156.1| hypothetical protein CHGG_03091 [Chaetomium globosum CBS 148.51]
Length=834

 Score =   120 bits (302),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 125/248 (50%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M      A W+ L  R+YRK +LY Q+  + +DL    VA +P+GG IA+ RD+ K++  
Sbjct  1    MDVAHPTAGWEQLGERFYRKTQLYTQVFDQDLDLDNYLVAGAPYGGAIALYRDEEKLIAF  60

Query  248  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRA  421
                  +  + I++ AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ 
Sbjct  61   QPTRPSKPSIDIYSCAGKLIRRINWDQ--GSIKGLGWSEDEKLLVVTADGTVRCYYDLQG  118

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            E     SLG       V  C F+ +G+V +     +  +  +  P P  LA P       
Sbjct  119  E-FTQFSLGNGADEAGVKSCRFYAHGLVALLNNNGLISVSSYHEPRPKLLASPP-GGHVH  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P YT+S +VEVL+++   + + +    +   + IGP   + VS NG+ L+ +T 
Sbjct  177  SWNIIPPAYTLSRSVEVLLSISQTIFVSDATTCEDRFLDIGPFTHIAVSPNGRFLSLYTA  236

Query  782  DGRLLVMT  805
             GR  V+T
Sbjct  237  KGRAHVIT  244



>gb|EME47796.1| hypothetical protein DOTSEDRAFT_78000 [Dothistroma septosporum 
NZE10]
Length=834

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 122/240 (51%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ + +R+YRK +LY   +   ++L    V  +P+ G +A+ RD++ I  L    A++
Sbjct  9    ANWERIGDRFYRKIQLYDNLFDPDLELENYTVTGAPYSGAVALRRDESHIYSLRGSQAIK  68

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              +  ++ AG  I +  W    G +  + W++++ L+ +T DGTV  Y    +     SL
Sbjct  69   STIDTYSCAGKLIRQIPWDT--GSIKSVGWSEEERLLIVTDDGTVRVYADLQDDFAQFSL  126

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     H V  C FW  G V +     V  +  +  P P  L      D   S T+I P+
Sbjct  127  GHGAEEHGVQSCKFWSTGFVALLGNNSVVVVARYDEPRPQLLTSAPPGDVH-SWTLIPPE  185

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT S +VEVL+A+   V +V+    +  G+  GP + + VS NGK +A +T DG++ V++
Sbjct  186  YTSSRSVEVLLAIDKTVYVVDAVEAEDRGLEAGPFRHIRVSPNGKFIALYTDDGKVWVIS  245



>ref|XP_011318503.1| hypothetical protein FGSG_02565 [Fusarium graminearum PH-1]
 gb|ESU08018.1| hypothetical protein FGSG_02565 [Fusarium graminearum PH-1]
 gb|EYB30840.1| hypothetical protein FG05_02565 [Fusarium graminearum]
 emb|CEF74879.1| unnamed protein product [Fusarium graminearum]
Length=827

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/247 (30%), Positives = 132/247 (53%), Gaps = 6/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYVVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DG V  YD++ E
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTADGNVRCYDLQGE  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA    E    +
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNTLITVSSYTEPRPKALAQTP-EGGINA  176

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P +T+S +VEVL+ VG  V +V+    +   + IGP   + VS +G+ +  +  +
Sbjct  177  WSIISPNHTLSRSVEVLLGVGKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAAN  236

Query  785  GRLLVMT  805
            G+  V++
Sbjct  237  GKAHVIS  243



>ref|XP_001274640.1| vacuolar protein sorting vps16, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW13214.1| vacuolar protein sorting vps16, putative [Aspergillus clavatus 
NRRL 1]
Length=829

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  265
            A W+ L + +YRK  +Y   + + VDL    VA +P+GG IA+ RD++K  +   A +A 
Sbjct  8    ANWERLGDSFYRKVTVYDAIFDEDVDLDNYIVAGAPYGGAIALHRDESKPYRFRDAHTAR  67

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + I++ +G  I    W++  G + G+ W+D + L+ IT+DGTV RY        S SL
Sbjct  68   SSIDIYSCSGKPINRINWEH--GTIRGLGWSDKEELLVITEDGTVRRYFGLYGDFTSFSL  125

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     + V  C FW  G V +    Q+  + ++  P P KL     E    S ++I P 
Sbjct  126  GNGAEEYGVRACKFWTYGFVALLANNQLIAVSNYDEPRP-KLLARCPEGEVSSWSLIPPP  184

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            YT+S +VEVL+AV   + L++    +   +  GP +   VS  G+ +A +T +G++ V++
Sbjct  185  YTLSRSVEVLLAVDKTIYLIDATDAEDKVLQNGPFKHASVSPTGRFVALYTAEGKVWVVS  244



>gb|EYE92957.1| vacuolar protein sorting-associated protein 16 [Aspergillus ruber 
CBS 135680]
Length=829

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 129/238 (54%), Gaps = 5/238 (2%)
 Frame = +2

Query  98   WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESALRK  271
            W+ + + +YRK  +Y   + + V+L    VA +P+GG IA+ RD++K+ +   A++    
Sbjct  10   WERVGDSFYRKVPVYDAIFDEDVELENYIVAGAPYGGAIALYRDESKLYRFQGAQTTKSS  69

Query  272  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  451
            + I++ +G  I    W+   G + G+ W+D + L+ +++DGTV RY        S SLG 
Sbjct  70   IDIYSCSGKHINRINWEY--GSIRGLGWSDKEELLVVSEDGTVRRYFGLFGDFTSFSLGN  127

Query  452  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  631
                + V  C FW +G V +    Q+  + +++ P P  LA P  E    S ++I P YT
Sbjct  128  GTEEYGVRACRFWTSGFVALLSNNQLVAVSNYEEPRPRPLA-PCPEGEVSSWSLIPPAYT  186

Query  632  MSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +S +VEVL+AV   + LV+    +   +  GP +   VS  G+ +A +T +G++ V++
Sbjct  187  LSRSVEVLLAVDKTIYLVDPTEAEDKFLQNGPFKHTSVSPTGRFVALYTAEGKVWVVS  244



>gb|EJU02203.1| vacuolar protein sorting-associated protein 16 [Dacryopinax sp. 
DJM-731 SS1]
Length=840

 Score =   120 bits (300),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 71/231 (31%), Positives = 120/231 (52%), Gaps = 5/231 (2%)
 Frame = +2

Query  119  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRK--LRIFNSA  292
            +YRK ELY MQWK  DL+  KV  + +GGP+A+IRD+ K++ L       K  +++++S+
Sbjct  20   FYRKQELYSMQWKVQDLSDFKVVGARYGGPLAIIRDEHKVIALGGAQRFTKPQIQVYSSS  79

Query  293  GVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSV  472
            G  I+   W    G+++ M W  D+ L+ ++++G    YD++ E  E  SLG +     V
Sbjct  80   GGLISTLSWDQ--GKIICMGWAYDERLVVLSEEGLYRVYDLQGE-YEQFSLGAEALEEGV  136

Query  473  VDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGNVEV  652
            V+      G+V +  +     +  ++      LA  GL   P   T++ P+ T+S +VEV
Sbjct  137  VEAQVHETGLVALTGSLNFLEVRSWEGGKAQTLASSGLSTPPHCWTIMPPELTVSRHVEV  196

Query  653  LMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            L++    +L+++        V  GP   +  S NGK LA  T    L V++
Sbjct  197  LISTDSTILMLDNLECIDQRVSRGPFTFLAPSPNGKALALLTAQNVLWVVS  247



>ref|XP_003300566.1| hypothetical protein PTT_11835 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91339.1| hypothetical protein PTT_11835 [Pyrenophora teres f. teres 0-1]
Length=839

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 128/241 (53%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ + +++YRK +LYQ  + + ++L    V  +P+ G +A+ RD+ K+      SA +
Sbjct  6    ANWEKVGDKFYRKVQLYQAVFDQDLELENYNVVGAPYSGAVAIFRDEEKLHTYRGPSASK  65

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESLS  442
              + I++ AG  I    W    G + G+ W++D+ L+ IT DGTV   YD++ +     +
Sbjct  66   PSIDIYSCAGKLIRSINWDK--GTIKGLGWSEDEKLLVITSDGTVRCYYDLQGD-FVPFT  122

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     H VV C F+  G V +     +  +  +  P P  LA P   D  +S ++I P
Sbjct  123  LGHGADEHGVVSCKFYSTGFVALLGNNHLISVTSYAEPRPKLLAIPPT-DPVISWSIIPP  181

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             Y++S +VEV++A+G  + +V+    +      GP + + VS   + LA +T DG++ V+
Sbjct  182  AYSLSRSVEVILAIGATLYVVDATEAEDRNFDAGPFRHISVSPRAEFLAFYTEDGKVWVV  241

Query  803  T  805
            +
Sbjct  242  S  242



>gb|KIL59455.1| hypothetical protein M378DRAFT_85025 [Amanita muscaria Koide 
BX008]
Length=844

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 133/243 (55%), Gaps = 9/243 (4%)
 Frame = +2

Query  92   AEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE--S  259
            + WQ +   N +YR+ +LY +  K  +L+  ++A   +GGP+A++RD +K++ L     S
Sbjct  7    SSWQAMQDGNVFYRRQQLYSIPGKLPNLSHYRIAGCRYGGPLALMRDSSKMIALGTTPLS  66

Query  260  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  439
               +++I +SAG  I    W    G+++   WT D+ L+ + ++GT   YD++ E  +  
Sbjct  67   MKPQIQIISSAGEGIMSFSWDQ--GKIIRFGWTFDEKLVVLNEEGTYRLYDLQGE-YQQY  123

Query  440  SLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIE  619
            SLG +     V+D     NG+V +  A ++  + +++    + LA+PGL   P +  VI 
Sbjct  124  SLGSEAAEMGVIDARIHENGLVALTGALKLLEVKEWRGERALHLANPGLSQPPHAWAVIP  183

Query  620  PQYTMSGNVEVLMAVGDHVLLVEE-DGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLL  796
            P  T+S +VEVL++V   +  V+  + + QL +  GP  ++  S NGK LA  T  G L 
Sbjct  184  PDSTISRHVEVLLSVESTIYTVDSLETVDQL-LARGPFIQVSPSPNGKSLALLTFSGLLW  242

Query  797  VMT  805
            V++
Sbjct  243  VVS  245



>emb|CDM31032.1| Probable transposable element [Penicillium roqueforti FM164]
Length=828

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 127/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  265
            A W+ + + +YRK  +Y   ++  ++L    V  +P+GG IA+ RD++K  +L   + + 
Sbjct  7    ANWEKVGDSFYRKIAVYDAIFEDDIELENYIVVGAPYGGAIALYRDESKTFRLRDGQGSR  66

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + I++ +G +I    W+    R  G+ W+D + L+ +++DGTV RY        S SL
Sbjct  67   STIDIYSCSGRKINRINWEQATIR--GLGWSDKEELLVVSEDGTVRRYFGLDGEFTSFSL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     + V  C FW +G+V +    Q+  +  +  P P  LA P  E    S  +I P 
Sbjct  125  GNGAEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRLLA-PCPEGEVSSWALIPPA  183

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+AV   V L++    +   +  GP + + VS  G+ +A FT +GRL V++
Sbjct  184  HTLSRSVEVLLAVDKTVFLIDSTEAEDKILQDGPFKHISVSPTGRFVALFTAEGRLWVVS  243



>gb|EZF35996.1| hypothetical protein H101_00471 [Trichophyton interdigitale H6]
Length=830

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 131/241 (54%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ + +++YRK  +Y   + + V+L  +    +P+GG IA+ RD+ ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKCRIYDAVFDEDVELENDIAVGAPYGGAIALHRDERRL-QRYRDAQTS  66

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
               + I++ +G +I    W +  G + G+ W++D+ L+ +T+DGTV  Y   +      S
Sbjct  67   KSSIDIYSCSGQRICRINWDH--GSIRGLGWSEDERLLAVTEDGTVRCYYGLSGDFTPFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSVAEEYGVVGCRFWSTGFVALLSNNQLVAVSHYDEPRP-KLLAQSPEGEISSWSLIPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+A+   + +V+    +   +  GP + + VS NG  +A FT DG+L V+
Sbjct  184  TYTLSRSVEVLLAIDKSIYVVDAADSEDRMLQNGPFKHVSVSPNGLFVALFTGDGKLWVV  243

Query  803  T  805
            +
Sbjct  244  S  244



>ref|XP_002567389.1| Pc21g03250 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP95222.1| Pc21g03250 [Penicillium rubens Wisconsin 54-1255]
Length=828

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 127/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ + + +YRK  +Y   ++  ++L    VA +P+GG IA+ RD++K  +L      R
Sbjct  7    ANWEKVGDSFYRKIAVYDAIFEDDIELENYIVAGAPYGGAIALYRDESKPFRLRDGQGSR  66

Query  269  K-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ +G +I    W+    R  G+ W+D + L+ +++DGTV RY        S SL
Sbjct  67   STIDVYSCSGQKINRINWEQATIR--GLGWSDKEELLVVSEDGTVRRYFELDGEFTSFSL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     + V  C FW +G+V +    Q+  +  +  P P  LA P  E    S  +I P 
Sbjct  125  GNGSEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRLLA-PCPEGEVSSWALISPA  183

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+AV   V L++    +   +  GP + + VS  G+ +A FT +G+L V++
Sbjct  184  HTLSRSVEVLLAVDKTVFLIDSTEAEDKILQDGPFKHISVSPTGRFVALFTAEGKLWVVS  243



>ref|XP_003170422.1| vacuolar protein sorting-associated protein [Microsporum gypseum 
CBS 118893]
 gb|EFR04659.1| vacuolar protein sorting-associated protein [Microsporum gypseum 
CBS 118893]
Length=830

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 130/241 (54%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ + +++YRK  +Y   + + ++L       +P+GG IA+ RD+ ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKSRIYDAVFDEDIELENYIAVGAPYGGAIALHRDERRL-QRYRDAQTS  66

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
               + I++ +G +I    W +  G + G+ W+DD+ L+ +T+DGTV  Y   +      S
Sbjct  67   KSSIDIYSCSGQRICRINWDH--GSIRGLGWSDDERLLAVTEDGTVRCYYGLSGDFTPFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSVAEEYGVVGCRFWTTGFVALLSNNQLVAVSHYDEPRP-KLLAQSPEGEINSWSLIPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+A+   + +V+    +   +  GP + + VS NG  +A FT DG+L V+
Sbjct  184  TYTLSRSVEVLLAIDKTIYVVDAADSEDRMLQNGPFKHVSVSPNGLFVALFTGDGKLWVV  243

Query  803  T  805
            +
Sbjct  244  S  244



>gb|KEZ45344.1| Uncharacterized protein SAPIO_CDS2157 [Scedosporium apiospermum]
Length=827

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 131/247 (53%), Gaps = 6/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T    A W+ L +++YR+ + Y   +   +DL    +A +P+GG IA+  DD K+ Q 
Sbjct  1    MDTALPRATWERLGDKWYRRIQHYTEVFDLDLDLDNYIIAGAPYGGAIALWNDDTKLQQY  60

Query  248  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
             A  A++  + I+N AG ++    W+   G + G+ W++++ L+ +  DGTV  YD++ +
Sbjct  61   QATRAVKPSIDIYNYAGKKLRSIPWEK--GTIKGLGWSEEEQLLAVLADGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG     + V  C F+ +G+V +     +  +  +  P P KL     E    S
Sbjct  119  -FTQFSLGHGSDNYGVHSCRFYDHGMVAMLTNNALITVSSYAEPRP-KLLASVPEGEVHS  176

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
              +I P YT+S +VEVL+++ + V LV+    +   + IGP   + VS +GKL+A +T  
Sbjct  177  WGIIPPAYTLSRSVEVLLSIKETVYLVDSTECEDRFLDIGPFSHISVSPDGKLVALYTKS  236

Query  785  GRLLVMT  805
            G+  V++
Sbjct  237  GKAHVVS  243



>gb|ESZ95296.1| vacuolar protein sorting [Sclerotinia borealis F-4157]
Length=828

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 126/245 (51%), Gaps = 7/245 (3%)
 Frame = +2

Query  80   VSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE  256
             S  AEW+ + +++YRK +LY   + + ++L    V    +GG IA+ RD+ K+      
Sbjct  2    TSPTAEWEKVGDKFYRKIQLYTAVFDQDLELENYVVTGCSYGGAIALYRDETKLQAFRGS  61

Query  257  SALRK-LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPL  430
             A +  + +++ AG  I    W    G + G+ WT+D++LI +T DGTV   YD++ +  
Sbjct  62   QASKSSIDLYSCAGKLIRRINWDQ--GSIKGLGWTEDESLIVVTADGTVRCYYDLQGD-F  118

Query  431  ESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMT  610
               SLG     + V  C F+  G V +     +  +  ++ P P  LA P   D   S T
Sbjct  119  NQFSLGNGADEYGVTACRFYGTGFVALLSNNHLISVSRYEEPRPKLLATPAEGDVH-SWT  177

Query  611  VIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGR  790
            +I P +T+S +VEVL+++G  + + +    +   + IGP   + VS NGK +A +T  G 
Sbjct  178  LIPPAFTLSRSVEVLLSIGQTIHVADAAESEDRFLDIGPFTHISVSPNGKFVALYTETGN  237

Query  791  LLVMT  805
              V+T
Sbjct  238  AYVIT  242



>ref|XP_009260076.1| hypothetical protein FPSE_08683 [Fusarium pseudograminearum CS3096]
 gb|EKJ71177.1| hypothetical protein FPSE_08683 [Fusarium pseudograminearum CS3096]
Length=827

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 132/247 (53%), Gaps = 6/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHPRADWESVGDRWFRKTQQYTAVFDQDLDLDNYVVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DG V  YD++ E
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTADGNVRCYDLQGE  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA     +   +
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNTLITVSSYTEPRPKALAQTPEGEIN-A  176

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P +T+S +VEVL+ VG  V +V+    +   + IGP   + VS +G+ +  +  +
Sbjct  177  WSIISPTHTLSRSVEVLLGVGKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAAN  236

Query  785  GRLLVMT  805
            G+  V++
Sbjct  237  GKAHVIS  243



>gb|KGO41557.1| Vps16, N-terminal [Penicillium expansum]
Length=828

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 128/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  265
            A W+ + + +YRK  +Y   ++  V+L    VA +P+GG IA+ RD++K  +L   + + 
Sbjct  7    ANWEKVGDSFYRKIAVYDAIFEDDVELENYIVAGAPYGGAIALYRDESKPFRLRDGQGSR  66

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ +G +I    W+    R  G+ W+D + L+ +++DGTV RY        S SL
Sbjct  67   STIDVYSCSGQRINRINWEQATIR--GLGWSDKEELLVVSEDGTVRRYFGLDGEFTSFSL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     + V  C FW +G+V +    Q+  +  +  P P  LA P  E    S  +I P 
Sbjct  125  GNGAEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRLLA-PCPEGEVSSWALIPPA  183

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+AV   V L++    +   +  GP + + VS  G+ +A FT +G+L V++
Sbjct  184  HTLSRSVEVLLAVDKTVFLIDSTEAEDKILQDGPFKHISVSPTGRFVALFTAEGKLWVVS  243



>gb|EGE07561.1| vacuolar protein sorting protein vps16 [Trichophyton equinum 
CBS 127.97]
Length=775

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 130/241 (54%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ + +++YRK  +Y   + + V+L       +P+GG IA+ RD+ ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKSRIYDAVFDEDVELENYIAVGAPYGGAIALHRDERRL-QRYRDAQTS  66

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
               + I++ +G +I    W +  G + G+ W++D+ L+ +T+DGTV  Y   +      S
Sbjct  67   KSSIDIYSCSGQRICRINWDH--GSIRGLGWSEDERLLAVTEDGTVRCYYGLSGDFTPFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSVAEEYGVVGCRFWSTGFVALLSNNQLVTVSHYDEPRP-KLLAQSPEGEISSWSLIPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+A+   + +V+    +   +  GP + + VS NG  +A FT DG+L V+
Sbjct  184  TYTLSRSVEVLLAIDKSIYVVDAADSEDRMLQNGPFKHVSVSPNGLFVALFTGDGKLWVV  243

Query  803  T  805
            +
Sbjct  244  S  244



>gb|EGD96647.1| vacuolar protein sorting vps16 [Trichophyton tonsurans CBS 112818]
Length=830

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 130/241 (54%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ + +++YRK  +Y   + + V+L       +P+GG IA+ RD+ ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKSRIYDAVFDEDVELENYIAVGAPYGGAIALHRDERRL-QRYRDAQTS  66

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
               + I++ +G +I    W +  G + G+ W++D+ L+ +T+DGTV  Y   +      S
Sbjct  67   KSSIDIYSCSGQRICRINWDH--GSIRGLGWSEDERLLAVTEDGTVRCYYGLSGDFTPFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSVAEEYGVVGCRFWSTGFVALLSNNQLVTVSHYDEPRP-KLLAQSPEGEISSWSLIPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+A+   + +V+    +   +  GP + + VS NG  +A FT DG+L V+
Sbjct  184  TYTLSRSVEVLLAIDKSIYVVDAADSEDRMLQNGPFKHVSVSPNGLFVALFTGDGKLWVV  243

Query  803  T  805
            +
Sbjct  244  S  244



>ref|XP_009850778.1| hypothetical protein NEUTE1DRAFT_122061 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO57679.1| hypothetical protein NEUTE1DRAFT_122061 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ72052.1| vacuolar protein sorting-associated protein 16 [Neurospora tetrasperma 
FGSC 2509]
Length=865

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 128/241 (53%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ +  ++YRK +LY Q+    +DL    VA +P+GG +A+ RD+ K+V   A    +
Sbjct  9    AGWEQVGEKFYRKTQLYTQVFDADLDLDNYIVAGAPYGGAVALYRDEEKLVAFAAGRPSK  68

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESLS  442
              + I++ AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ +     S
Sbjct  69   PSIDIYSCAGKLIRRIPWDK--GSIKGLGWSEDEKLLVVTGDGTVRCYYDLQGD-FTQFS  125

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG D     V  C F+ +G+V +     +  +  +  P P  LA P  E    S +++ P
Sbjct  126  LGHDADEIGVRSCKFYGHGLVALLNNNSLVSVSAYDEPRPKLLAQPP-EGQVHSWSLVPP  184

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+++G  + + +    +   + IGP   + +S NGK +A +T  G+  V+
Sbjct  185  AYTLSRSVEVLLSIGQTIYVSDASECEDRFIDIGPFSHISISPNGKFVALYTKTGKAHVI  244

Query  803  T  805
            +
Sbjct  245  S  245



>ref|XP_007850547.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
 gb|ESK90169.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
Length=846

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 131/244 (54%), Gaps = 10/244 (4%)
 Frame = +2

Query  92   AEWQLLYNR--YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES--  259
            A WQ + +   +YRK +LY +  K  DL    VA   +GGP+A++RD+ K+V L   +  
Sbjct  7    ASWQAMQDGSVFYRKQQLYSLSGKLPDLGDYIVAGCRYGGPLALMRDNTKLVALGRSTPS  66

Query  260  -ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  436
             A  +L++++SAG  +    W    G+++   WT ++ L+ + ++G    YD++ +  + 
Sbjct  67   FAKSQLQVYSSAGEGLLLFSWDQ--GKIIRFGWTYNERLVVLNEEGVYRIYDLQGD-YQQ  123

Query  437  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  616
             SLG D     VVD     NG+V +    Q+  +  ++   P+ LA+PGL + P +  +I
Sbjct  124  YSLGGDAAEMGVVDARIHENGLVALTGHLQLLEVKGWEGGRPMTLANPGLSEPPGAWAII  183

Query  617  EPQYTMSGNVEVLMAVGDHVLLVEE-DGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRL  793
             P   +S ++EVL++V + +  V+  + I Q  +  GP   +  S NGK LA  T  G L
Sbjct  184  PPDLNISRHIEVLLSVDNTIFTVDNLESIDQR-LSQGPFTHVSPSPNGKSLALLTFSGTL  242

Query  794  LVMT  805
            LV++
Sbjct  243  LVVS  246



>ref|XP_009658018.1| vacuolar protein sorting-associated protein [Verticillium dahliae 
VdLs.17]
 gb|EGY20767.1| vacuolar protein sorting-associated protein [Verticillium dahliae 
VdLs.17]
Length=826

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 125/232 (54%), Gaps = 6/232 (3%)
 Frame = +2

Query  98   WQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAE-SALRK  271
            W+ + ++++RK +LY   + + +DL  + VA +P GG +A+ RDD KI    A+ SA   
Sbjct  10   WESVGDKWFRKTQLYTEVFDQDLDLDNHIVAGAPNGGALAIYRDDTKIQAHRAQKSAKPS  69

Query  272  LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGK  451
            + I++ AG ++    W    G + G+ W++D++L+ +T DGTV  YD++ E     SLG 
Sbjct  70   IDIYSYAGKKLRSIAWDK--GSIKGIGWSEDESLLIVTADGTVRVYDLQGE-FTQFSLGN  126

Query  452  DCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYT  631
                + V  C F+ +G+V +     +  +  +  P P  LA P  E       ++ P +T
Sbjct  127  GADNYGVTSCRFYDHGMVALLTNNALISVTSYSEPRPKLLASPP-EGEIHGWAIMTPAHT  185

Query  632  MSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDG  787
            +S +VEVL+++G  + + +    +   + IGP   + VS +G L+A +T  G
Sbjct  186  LSRSVEVLLSIGQTLYVADATECEDRFLDIGPFSHVSVSPDGGLIALYTESG  237



>ref|XP_007301979.1| vacuolar assembling/sorting protein VPS16 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM89070.1| vacuolar assembling/sorting protein VPS16 [Stereum hirsutum FP-91666 
SS1]
Length=846

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 123/234 (53%), Gaps = 6/234 (3%)
 Frame = +2

Query  113  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES---ALRKLRIF  283
            N +YR+ ++Y +  K  +L    VA   +GGPIA++RD+ K++ L   +   A  ++++F
Sbjct  16   NVFYRRQQVYSIHGKLPNLGDCIVAGCRYGGPIALMRDNTKMIALGRATPVFAKAQIQVF  75

Query  284  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  463
            + AG       W    G+++   WT D+ L+ + ++G    YD++ +     SLG D   
Sbjct  76   SPAGEGRLLFSWDQ--GKIIRFGWTGDERLVVLNEEGVYRLYDLQGD-YAQFSLGSDATE  132

Query  464  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGN  643
              ++D     NG+V +    Q+  +  ++   P+ LA+PG+ + P + T+I P +T+S +
Sbjct  133  VGIIDAKIHENGLVAMTGTLQLLEVKGWEGAKPLTLANPGMSEPPHAWTIIPPDFTLSRH  192

Query  644  VEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            VEVL++V   +L V+        +  GP   M  S NGK LA  T  G L V++
Sbjct  193  VEVLLSVDSSILSVDNLETIDQRLSRGPFSYMSASPNGKSLAMLTVTGTLWVVS  246



>gb|KGO60206.1| Vps16, N-terminal [Penicillium expansum]
 gb|KGO68732.1| Vps16, N-terminal [Penicillium expansum]
Length=828

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 128/240 (53%), Gaps = 5/240 (2%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESAL  265
            A W+ + + +YRK  +Y   ++  V+L    VA +P+GG IA+ RD++K  +L   + + 
Sbjct  7    ANWEKVGDSFYRKIAVYDAIFEDDVELENYIVAGAPYGGAIALYRDESKPFRLRDGQGSR  66

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ +G +I    W+    R  G+ W+D + L+ +++DGTV RY        S SL
Sbjct  67   STIDVYSCSGQRINRINWEQATIR--GLGWSDKEELLVVSEDGTVRRYFGLDGEFTSFSL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQ  625
            G     + V  C FW +G+V +    Q+  +  +  P P  LA P  E    S  +I P 
Sbjct  125  GNGAEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRLLA-PCPEGEVSSWALIPPA  183

Query  626  YTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +T+S +VEVL+AV   V L++    +   +  GP + + VS  G+ +A FT +G+L +++
Sbjct  184  HTLSRSVEVLLAVDKTVFLIDSTEAEDKILQDGPFKHISVSPTGRFVALFTAEGKLWIVS  243



>ref|XP_001215326.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU33909.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=810

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/247 (31%), Positives = 131/247 (53%), Gaps = 5/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M+  +  A W+ L + +YRK  +Y   + + V+L    VA +P+GG +A+ RD++K  + 
Sbjct  1    MAPSNPLANWERLGDSFYRKVSIYDAVFDQDVELENYIVAGAPYGGALALHRDESKPYRF  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
              A++A   + I++ +G  I     ++  G + G+ W+D + L+ IT+DGTV RY     
Sbjct  61   RDAQTARSSIDIYSCSGKHINRIQCEH--GAIRGLGWSDKEELLLITEDGTVRRYFGLHG  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               S SLG     + V  C FW+ G V +    Q+  + ++  P P KL  P  E    S
Sbjct  119  DFTSFSLGNGAEEYGVRACRFWNAGFVALLSNNQLIAVSNYDEPRP-KLLAPCPEGEVSS  177

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
             ++I P YT+S +VEVL+AV   + L++    +   +  GP +   VS  G+ +A  T +
Sbjct  178  WSLIPPAYTLSRSVEVLLAVDQTIYLIDPTEAEDKVLQNGPFKHASVSPTGRFVALITAE  237

Query  785  GRLLVMT  805
            G++ V++
Sbjct  238  GKVWVVS  244



>gb|KIJ15884.1| hypothetical protein PAXINDRAFT_168867 [Paxillus involutus ATCC 
200175]
Length=841

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 133/243 (55%), Gaps = 8/243 (3%)
 Frame = +2

Query  92   AEWQLL--YNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY-AESA  262
            A W+ +   N +YR+ +LY +  K  DL    +A    GGPIA++RD +KI+ +  A  A
Sbjct  10   ATWEAMPDGNVFYRRLQLYSIPGKLPDLNDFVIAGCRNGGPIALMRDSSKIITVGGAGHA  69

Query  263  LRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  436
              K  +++++ AG  +    W    G+++   WT D+ L+ + ++G    YD++++  + 
Sbjct  70   FSKSQIQVYSPAGEGLLLLSWDQ--GKIIRFGWTADERLVVLNEEGVYRLYDLQSD-YQQ  126

Query  437  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  616
             SLG +     +VD     NG+V ++ +  +  + D++   P+ LA+PGL + P S  VI
Sbjct  127  YSLGSEAAEMGIVDARIHENGLVALSGSLSLLEVKDWEGSRPLTLANPGLSEPPHSWAVI  186

Query  617  EPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLL  796
             P   +S +VEVL++V + +L+V+        +  GP  ++  S NGKLLA   ++G L 
Sbjct  187  PPDQNISRHVEVLLSVENTILVVDNLENMDQRISRGPFLRVSPSPNGKLLALLNYNGLLW  246

Query  797  VMT  805
            V++
Sbjct  247  VVS  249



>ref|XP_006693134.1| putative vacuolar protein sorting-associated protein [Chaetomium 
thermophilum var. thermophilum DSM 1495]
 gb|EGS20838.1| putative vacuolar protein sorting-associated protein [Chaetomium 
thermophilum var. thermophilum DSM 1495]
Length=816

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 126/248 (51%), Gaps = 7/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T    A W+ L  R+YRK +LY Q+  +  DL    V  +P+GG IA+ RDD K+V  
Sbjct  1    MDTAHPTASWEQLGERFYRKIQLYTQVFDQDFDLDNYIVTGAPYGGAIALYRDDEKLVAY  60

Query  248  YAESALR-KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRY-DIRA  421
                + R  + I + +G  +    W    G + G+ W++D+ L+ +  DGTV  Y D+++
Sbjct  61   QPSRSSRPTIDICSLSGKLLRRISWDQ--GPIKGVGWSEDEKLLIVMVDGTVRCYFDLQS  118

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            E     SLG     H V  C F+ +G+V +     +  +  +  P P  LA P  E    
Sbjct  119  E-FTQFSLGHGAEEHGVKSCRFYSHGLVALLGNNALVSVSSYDEPRPKLLASPP-EGRVY  176

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P Y++S +VEVL++V   + + +    +   + IGP   + VS NG+  A +T 
Sbjct  177  SWNIIPPAYSLSRSVEVLLSVNQTIYVCDASECEDRFLDIGPFSHIAVSPNGRFCALYTT  236

Query  782  DGRLLVMT  805
             G++ V+T
Sbjct  237  TGKVHVIT  244



>gb|KDQ31847.1| hypothetical protein PLEOSDRAFT_48878 [Pleurotus ostreatus PC15]
Length=846

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 128/248 (52%), Gaps = 8/248 (3%)
 Frame = +2

Query  77   TVSVAAEWQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            T    A W  +   N +YR+ +LY    K  +L    VA   +GGP+A++RD  K++ + 
Sbjct  2    TAHPTASWSAMQDGNVFYRRQQLYSTSGKLPNLNEYIVAGCKYGGPLAMMRDTTKVISIG  61

Query  251  AES-ALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRA  421
              + AL K  ++I++ AG  +    W N  G++V   WTDD+ L+ + ++G    YD++ 
Sbjct  62   GTNPALNKAQIQIYSPAGDGMLLFSWDN--GKIVRFGWTDDERLVILNEEGVYRLYDLQG  119

Query  422  EPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL  601
            +  +  SLG +     +VD   + +G+V I  +  +  +  ++   P+ LA+PGL   P 
Sbjct  120  D-YQQYSLGSEAGELGIVDACIYESGLVAITGSLTLLEVKGWEGARPLSLANPGLTSPPH  178

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            +  VI P   +S +VEVL++V   +  V+   +    +  GP   +  S NGK LA  T 
Sbjct  179  AWAVIPPDLNISRHVEVLLSVEATIYSVDNLEVVDQRLSRGPFTHLSPSPNGKSLALLTF  238

Query  782  DGRLLVMT  805
             G LLV++
Sbjct  239  SGLLLVVS  246



>gb|EWG49671.1| hypothetical protein FVEG_09136 [Fusarium verticillioides 7600]
Length=746

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V + V +V+    +   + IGP   + VS +G+    +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDETVYVVDATDCEDRFLDIGPFSHISVSPDGRYANLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>gb|KDB28142.1| hypothetical protein H109_00087 [Trichophyton interdigitale MR816]
Length=830

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 130/241 (54%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ + +++YRK  +Y   + + V+L       +P+GG IA+ RD+ ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKCRIYDAVFDEDVELENYIAVGAPYGGAIALHRDERRL-QRYRDAQTS  66

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
               + I++ +G +I    W +  G + G+ W++D+ L+ +T+DGTV  Y   +      S
Sbjct  67   KSSIDIYSCSGQRICRINWDH--GSIRGLGWSEDERLLAVTEDGTVRCYYGLSGDFTPFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSVAEEYGVVGCRFWSTGFVALLSNNQLVAVSHYDEPRP-KLLAQSPEGEISSWSLIPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+A+   + +V+    +   +  GP + + VS NG  +A FT DG+L V+
Sbjct  184  TYTLSRSVEVLLAIDKSIYVVDAADSEDRMLQNGPFKHVSVSPNGLFVALFTGDGKLWVV  243

Query  803  T  805
            +
Sbjct  244  S  244



>ref|XP_002837491.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81682.1| unnamed protein product [Tuber melanosporum]
Length=832

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 128/252 (51%), Gaps = 12/252 (5%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            MS  S  A W+ + ++YYR  +LY   W    DL+   V  +P+GG +A+ +D+ +I Q 
Sbjct  1    MSHTSATAGWERVEDKYYRTIQLYSALWDPDFDLSDYIVVGAPYGGALALYKDETRI-QA  59

Query  248  YAESALRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIR  418
            Y  S   K  + I+++AG  I    W    G + G+ W++D+ L+ +T+DG V   YD++
Sbjct  60   YRSSQQSKSSIDIYSAAGRLIRRISWDK--GSIKGLGWSEDEKLLVVTEDGVVRCYYDLQ  117

Query  419  AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADP----GL  586
             +     SLG       V +C F+  G V +    Q   +  +  P P  LADP      
Sbjct  118  GD-FTQFSLGNGAEEAGVKECRFYSTGFVALLRNNQFISVSRYDEPRPRLLADPVPFIPA  176

Query  587  EDFPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLL  766
             +   S T++ P YT+S +VEV ++ G  +L+V+   +    +  GP   + VS NGK +
Sbjct  177  TEIIHSWTILPPSYTLSRHVEVFVSTGTTILIVDATEVLDQMLQNGPFAHISVSPNGKYV  236

Query  767  ASFTHDGRLLVM  802
               + +G++ V+
Sbjct  237  TLCSVEGKVWVI  248



>ref|XP_003231008.1| vacuolar protein sorting vps16 [Trichophyton rubrum CBS 118892]
 gb|EGD92267.1| hypothetical protein TERG_08484 [Trichophyton rubrum CBS 118892]
 gb|EZF27916.1| hypothetical protein H100_00164 [Trichophyton rubrum MR850]
 gb|EZF46922.1| hypothetical protein H102_00163 [Trichophyton rubrum CBS 100081]
 gb|EZF57636.1| hypothetical protein H103_00165 [Trichophyton rubrum CBS 288.86]
 gb|EZF68200.1| hypothetical protein H104_00164 [Trichophyton rubrum CBS 289.86]
 gb|EZF78908.1| hypothetical protein H105_00155 [Trichophyton soudanense CBS 
452.61]
 gb|EZF89486.1| hypothetical protein H110_00165 [Trichophyton rubrum MR1448]
 gb|EZG00300.1| hypothetical protein H113_00165 [Trichophyton rubrum MR1459]
 gb|EZG11202.1| hypothetical protein H106_00057 [Trichophyton rubrum CBS 735.88]
 gb|EZG21922.1| hypothetical protein H107_00167 [Trichophyton rubrum CBS 202.88]
 gb|KDB38747.1| hypothetical protein H112_00165 [Trichophyton rubrum D6]
Length=830

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 130/241 (54%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY--AESA  262
            A+W+ + +++YRK  +Y   + + V+L       +P+GG IA+ RD+ ++ Q Y  A+++
Sbjct  8    ADWERVGDQFYRKSRIYDAVFDEDVELENYIAVGAPYGGAIALHRDERRL-QRYRDAQTS  66

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
               + I++ +G +I    W +  G + G+ W++D+ L+ +T+DGTV  Y   +      S
Sbjct  67   KSSIDIYSYSGQRICRINWDH--GSIRGLGWSEDERLLAVTEDGTVRCYYGLSGDFTPFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG     + VV C FW  G V +    Q+  +  +  P P KL     E    S ++I P
Sbjct  125  LGSMAEEYGVVGCRFWSAGFVALLSNNQLVAVSHYDEPRP-KLLAQSPEGEINSWSLIPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+A+   + +V+    +   +  GP + + VS NG  +A FT DG+L V+
Sbjct  184  TYTLSRSVEVLLAIDKSIYVVDAADSEDRMLQNGPFKHVSVSPNGLFVALFTGDGKLWVV  243

Query  803  T  805
            +
Sbjct  244  S  244



>ref|XP_007922652.1| hypothetical protein MYCFIDRAFT_60175 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME85262.1| hypothetical protein MYCFIDRAFT_60175 [Pseudocercospora fijiensis 
CIRAD86]
Length=825

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 125/240 (52%), Gaps = 10/240 (4%)
 Frame = +2

Query  98   WQLLYNRYYRKPELYQMQWKHVDLTRNK--VACSPFGGPIAVIR-DDAKIVQLYA-ESAL  265
            W+ + +++YRK ELY   +  VDL      V  +P+ G +A +R D++K+      +SA 
Sbjct  8    WRRIGDKFYRKVELYTNVF-DVDLALENYTVTGAPYSGAVAALRRDESKVYSFRGPQSAK  66

Query  266  RKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + I + AG  I    W    G++  + W++D+ L+ +T+DG+V  Y          +L
Sbjct  67   STIDIHSCAGKLIQHIQWDR--GKIKSVGWSEDEKLLVVTEDGSVRIYPDLHGDFTPFTL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTVIEP  622
            G     H VV C FW +G V +     V  +  +  P P  LA  P  E   +S TVI P
Sbjct  125  GHGADEHGVVACKFWSSGFVALLGNNSVVAVTRYDEPRPQLLASAPSGE--VISWTVIPP  182

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            +YT S +VEVL+A+ D V +++    +  G+  GP + + VS NGK +A +T D ++ V+
Sbjct  183  EYTSSRSVEVLLAINDTVYVLDAVECEDRGLQAGPFRHIAVSPNGKFIALYTDDSKVWVI  242



>gb|EWG49670.1| hypothetical protein FVEG_09136 [Fusarium verticillioides 7600]
Length=827

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V + V +V+    +   + IGP   + VS +G+    +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDETVYVVDATDCEDRFLDIGPFSHISVSPDGRYANLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>ref|XP_005846081.1| hypothetical protein CHLNCDRAFT_135924 [Chlorella variabilis]
 gb|EFN53979.1| hypothetical protein CHLNCDRAFT_135924 [Chlorella variabilis]
Length=953

 Score =   118 bits (295),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 73/250 (29%), Positives = 121/250 (48%), Gaps = 17/250 (7%)
 Frame = +2

Query  95   EWQLLYNRYYRKPELYQMQWKH--------VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
            EWQL+ + YY + ELY++ W           DL   +V  +P GGPIA +RDD+K+V   
Sbjct  11   EWQLVGDAYYSRRELYRLDWGGGGSGGGGSFDLAFMRVFPAPAGGPIAALRDDSKLVLYV  70

Query  251  AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPL  430
                   +++F+ AG  +   +W   GG ++   WT  + L+ +     V+ + +R E L
Sbjct  71   GGFTKPDVQVFSGAGAPLGRVLWD--GGHVLAAGWTAGEQLLVLEAGAKVHMFSVRGERL  128

Query  431  -ESLSLGKDCFTHSVVD-CVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
               LSLG +C     V+  V + +G+  +  A  ++C+PD   P   +  DP        
Sbjct  129  PRHLSLGAECEEEGGVEAAVLFRDGLALLTPAGHLWCVPDVHEPRLQRFPDPAPGLGGGG  188

Query  605  -----MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLA  769
                 M VI P  + SG +E++ AV D V +++ +      V  GP+ ++ VS  GK + 
Sbjct  189  SGVHCMAVIPPSASSSGALELIAAVEDTVRVIDANEALPTPVFEGPILRLAVSPCGKFVV  248

Query  770  SFTHDGRLLV  799
             +  DG + V
Sbjct  249  GYGQDGTIHV  258



>gb|EXM23638.1| hypothetical protein FOTG_09079 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=827

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V   V +V+    +   + IGP   + VS +G+ +  +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>gb|EWZ38287.1| hypothetical protein FOZG_09966 [Fusarium oxysporum Fo47]
 gb|EWZ82849.1| hypothetical protein FOWG_13655 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXL57751.1| hypothetical protein FOCG_04830 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=827

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V   V +V+    +   + IGP   + VS +G+ +  +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>gb|ENH66099.1| Putative vacuolar protein sorting-associated protein 16 like 
protein [Fusarium oxysporum f. sp. cubense race 1]
Length=827

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V   V +V+    +   + IGP   + VS +G+ +  +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>gb|EMT70745.1| Putative vacuolar protein sorting-associated protein 16 like 
protein [Fusarium oxysporum f. sp. cubense race 4]
 gb|EXA45881.1| hypothetical protein FOVG_06735 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK92202.1| hypothetical protein FOQG_06098 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL72473.1| hypothetical protein FOPG_11955 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL97217.1| hypothetical protein FOIG_10867 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=827

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V   V +V+    +   + IGP   + VS +G+ +  +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>emb|CCT69282.1| related to vacuolar protein sorting VACUOLELESS1 [Fusarium fujikuroi 
IMI 58289]
Length=827

 Score =   117 bits (294),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLIVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V   V +V+    +   + IGP   + VS +G+ +  +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>gb|EXK40358.1| hypothetical protein FOMG_07258 [Fusarium oxysporum f. sp. melonis 
26406]
Length=827

 Score =   117 bits (294),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V   V +V+    +   + IGP   + VS +G+ +  +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDKTVYVVDATDCEDRFLDIGPFSHISVSPDGRYVNLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>gb|EWY91619.1| hypothetical protein FOYG_08668 [Fusarium oxysporum FOSC 3-a]
Length=827

 Score =   117 bits (293),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 133/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   A+W+ + +R++RK + Y   + + +DL    VA +P+ G +A+ RDD K++  
Sbjct  1    MDTLHARADWESVGDRWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDTKLLAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                SA   + I++ AG ++    W N  G + G+ W++D+TL+ +T DGTV  YD++ +
Sbjct  61   QPGRSAKPAIDIYSLAGKKLRSIPWDN--GTIKGLGWSEDETLLVVTTDGTVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPL  601
                 SLG     +SV  C F+ +G+V +     +  +  +  P P  LA  P  E    
Sbjct  119  -FTQFSLGHGADNYSVESCRFYDHGMVALLGNNSLVTVSSYTEPRPKALAKIPESEIHAW  177

Query  602  SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTH  781
            S  +I P +T+S +VEVL++V   V +V+    +   + IGP   + VS +G+ +  +  
Sbjct  178  S--IISPNHTLSRSVEVLLSVDKTVYVVDATDCEDRFLDIGPFSHVSVSPDGRYVNLYAV  235

Query  782  DGRLLVMT  805
            +G+  V++
Sbjct  236  NGKAHVIS  243



>ref|XP_003351543.1| hypothetical protein SMAC_00085 [Sordaria macrospora k-hell]
Length=858

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 128/241 (53%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ +  ++YRK +LY Q+    +DL    VA +P+GG +A+ RD+ K+V   A    +
Sbjct  8    AGWEQVGEKFYRKTQLYTQIFDADLDLDNYIVAGAPYGGAVALYRDEDKLVAFAAGRPSK  67

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESLS  442
              + I++ AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ +     S
Sbjct  68   PSIDIYSCAGKLIRRIPWDK--GSIKGLGWSEDEKLLVVTGDGTVRCYYDLQGD-FTQFS  124

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG D     V  C F+ +G+V +     +  +  +  P P  LA P  E    S +++ P
Sbjct  125  LGHDADEVGVRACKFYGHGLVALLNNNSLVSVSAYDEPRPKLLAQPP-EGQVNSWSLVPP  183

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+++G  + + +    +   + IGP   + +S NGK +A +T  G+  V+
Sbjct  184  AYTLSRSVEVLLSIGQTIYVSDASECEDRYIDIGPFSHISISPNGKFVALYTTTGKAHVI  243

Query  803  T  805
            +
Sbjct  244  S  244



>emb|CCC05869.1| unnamed protein product [Sordaria macrospora k-hell]
Length=859

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 128/241 (53%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ +  ++YRK +LY Q+    +DL    VA +P+GG +A+ RD+ K+V   A    +
Sbjct  9    AGWEQVGEKFYRKTQLYTQIFDADLDLDNYIVAGAPYGGAVALYRDEDKLVAFAAGRPSK  68

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESLS  442
              + I++ AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ +     S
Sbjct  69   PSIDIYSCAGKLIRRIPWDK--GSIKGLGWSEDEKLLVVTGDGTVRCYYDLQGD-FTQFS  125

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG D     V  C F+ +G+V +     +  +  +  P P  LA P  E    S +++ P
Sbjct  126  LGHDADEVGVRACKFYGHGLVALLNNNSLVSVSAYDEPRPKLLAQPP-EGQVNSWSLVPP  184

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT+S +VEVL+++G  + + +    +   + IGP   + +S NGK +A +T  G+  V+
Sbjct  185  AYTLSRSVEVLLSIGQTIYVSDASECEDRYIDIGPFSHISISPNGKFVALYTTTGKAHVI  244

Query  803  T  805
            +
Sbjct  245  S  245



>ref|XP_962872.3| vacuolar protein sorting-associated protein [Neurospora crassa 
OR74A]
 gb|EAA33636.3| vacuolar protein sorting-associated protein [Neurospora crassa 
OR74A]
 gb|KHE84301.1| vacuolar protein sorting-associated protein 16 [Neurospora crassa]
Length=865

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 129/242 (53%), Gaps = 9/242 (4%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ +  ++YRK +LY Q+    +DL    VA +P+GG +A+ RD+ K+V   A    +
Sbjct  9    AGWEQVGEKFYRKTQLYTQVFDADLDLDNYIVAGAPYGGAVALYRDEEKLVAFAAGRPSK  68

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESLS  442
              + I + AG  I    W    G + G+ W++D+ L+ +T DGTV   YD++ +     S
Sbjct  69   PSIDIHSCAGKLIRRIPWDK--GSIKGLGWSEDEKLLVVTGDGTVRCYYDLQGD-FTQFS  125

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL-SMTVIE  619
            LG D     V  C F+ +G+V +     +  +  +  P P  LA P   + P+ S +++ 
Sbjct  126  LGHDADEIGVRSCKFYGHGLVALLNNNSLVSVSAYDEPRPKLLAQP--PEGPVHSWSLVP  183

Query  620  PQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
            P YT+S +VEVL+++G  + + +    +   + IGP   + +S NGK +A +T  G+  V
Sbjct  184  PAYTLSRSVEVLLSIGQTIYVSDASECEDRFIDIGPFSHISISPNGKFVALYTKTGKAHV  243

Query  800  MT  805
            ++
Sbjct  244  IS  245



>gb|KIJ36797.1| hypothetical protein M422DRAFT_179088, partial [Sphaerobolus 
stellatus SS14]
Length=643

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 129/243 (53%), Gaps = 10/243 (4%)
 Frame = +2

Query  92   AEWQLLYN--RYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL-YAESA  262
            A W+ + +   +YRK  +YQMQW+++D++   VA + +GGP+A++RD  K++ L     A
Sbjct  9    ASWEPIQDGTAFYRKHSVYQMQWQYLDVSDYIVAGARYGGPLAMMRDTNKLIALGRGVPA  68

Query  263  LRK--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLES  436
            + K  +R+++S G    E +      +++   WT D+ L  + ++G    YD++ +  + 
Sbjct  69   ISKSEIRVYSSVG----EGLLLFTVRKIIRFGWTYDERLAVLNEEGVYRIYDLQGD-YQQ  123

Query  437  LSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVI  616
             SLG +     ++D     NG++ +  +  +  +  ++   P+ LA PG+ + P S  +I
Sbjct  124  FSLGPEAAETGIIDARIHENGMIALTGSMSLLEVKGWEGGKPLVLASPGISEPPASWAII  183

Query  617  EPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLL  796
             P  T+S +VEVL++    +L V+  G     +  GP      S NGK+LA  T  G L 
Sbjct  184  PPDQTISRHVEVLLSSESTILSVDTLGSTDQRISRGPFSHFSPSPNGKMLALLTLSGVLW  243

Query  797  VMT  805
            V++
Sbjct  244  VVS  246



>ref|XP_002795864.1| vacuolar protein sorting-associated protein [Paracoccidioides 
sp. 'lutzii' Pb01]
Length=799

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 136/251 (54%), Gaps = 10/251 (4%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPI---AVIRDDAKI  238
            M+  +  A+W+ + +R+YRK  +Y   + + ++L    VA +P+GG I   A+ RD+ K+
Sbjct  1    MAPTNPLADWEKVGDRFYRKIRVYDAVFDEDLELENFIVAGAPYGGSIGVAALYRDENKL  60

Query  239  VQLY--AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYD  412
             Q Y  AE+    + I++ +G +I+    ++   R  G+ W+DD+ L+ +TQDGTV  Y 
Sbjct  61   -QRYRDAETGKSYIDIYSCSGQRISRINGEHAAIR--GLGWSDDEKLLVVTQDGTVRCYY  117

Query  413  IRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLED  592
                     SLG     + V  C FW +G V +    Q+  +  +  P P  LA P   +
Sbjct  118  GLHGDFTPFSLGTAAEENGVKACRFWSDGFVALLYNNQLIAVSRYDEPRPKLLASPPAGE  177

Query  593  FPLSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLAS  772
               S ++I P Y++S +VEVL+A+ + + +V+    +   +  GP + + VS NG+ +A 
Sbjct  178  VS-SWSLIPPNYSLSRSVEVLLAIDETIYVVDATEAEDRMLQNGPFKHVSVSPNGRFVAL  236

Query  773  FTHDGRLLVMT  805
            +T DG++ V++
Sbjct  237  YTGDGKMWVVS  247



>gb|KIK92586.1| hypothetical protein PAXRUDRAFT_146989 [Paxillus rubicundulus 
Ve08.2h10]
Length=841

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 127/234 (54%), Gaps = 6/234 (3%)
 Frame = +2

Query  113  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL---RKLRIF  283
            N +YR+ +LY +  K  DL    VA    GGPIA++RD ++I+ +          +++++
Sbjct  19   NVFYRRLQLYTIPGKLPDLDDFVVAGCRNGGPIALMRDSSRIIPVGGTGHTFPKSQIQVY  78

Query  284  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  463
            + AG  +    W    G+++   WT D+ L+ + ++G    YD++++  +  SLG +   
Sbjct  79   SPAGEGLLLLSWDQ--GKIIRFGWTADERLVVLNEEGVYRLYDLQSD-YQQFSLGSEAAE  135

Query  464  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGN  643
              ++D     NG+V ++ +  +  + D++   P+ LA+PGL + P S  VI P   +S +
Sbjct  136  MGIIDAQIHENGLVALSGSLSLLEVKDWEGSRPLTLANPGLSEPPHSWAVIPPDQNISRH  195

Query  644  VEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            VEVL++V + +L+V+        +  GP  ++  S NGKLLA   ++G L V++
Sbjct  196  VEVLLSVENTILVVDNLENMDQRISRGPFLRVSPSPNGKLLALLNYNGSLWVVS  249



>gb|EFQ25156.1| hypothetical protein GLRG_00300 [Colletotrichum graminicola M1.001]
Length=840

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 136/261 (52%), Gaps = 20/261 (8%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M     +A W+ + +++YRK +LY   + + +DL  + VA +P+GG +A++RDD KI Q 
Sbjct  1    MEASHPSAGWESVGDKWYRKVQLYTEVFDQDLDLDNHIVAGAPYGGALALLRDDTKI-QA  59

Query  248  Y--------AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTD----DQTLICITQD  391
            Y        A S+   + I++ AG  +    W    G + G+ W      ++ L+ +T D
Sbjct  60   YRVNPGGGGAPSSKPGIDIYSYAGKLLRRIPWDQGSGSIKGLGWASVAGGEERLLVVTTD  119

Query  392  GTVYRYDIRAEPLESLSLGKDCFTHSVVDCVFWHNGVVCI--NEAFQVFCIPDFKNPNPI  565
            GTV  YD++ +     SLG       VV C F+  G+V +  N+ F    +  +  P P 
Sbjct  120  GTVRAYDLQGD-FTQFSLGNGADESGVVGCRFYETGMVALLGNDTF--VSVSSYAEPRPR  176

Query  566  KLADPGLEDFPL-SMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMV  742
             LA P  +   + +  V+ P +T+S +VEVL+++G+ V +V+    +   + +GP   + 
Sbjct  177  LLATPPTDQGEIHAWAVVAPDHTLSRSVEVLLSIGETVYVVDAAECEDRFLDLGPFSHIS  236

Query  743  VSRNGKLLASFTHDGRLLVMT  805
            VS +G+L+  +T  G+  V++
Sbjct  237  VSPDGRLIVLYTKTGKAHVIS  257



>ref|XP_009550055.1| hypothetical protein HETIRDRAFT_325388 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW78052.1| hypothetical protein HETIRDRAFT_325388 [Heterobasidion irregulare 
TC 32-1]
Length=846

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 129/242 (53%), Gaps = 10/242 (4%)
 Frame = +2

Query  98   WQLLY--NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL-YAESALR  268
            WQ +   N +Y++ ++Y +  K  +L    +A   +GGP+A++RD+ K+V L     A  
Sbjct  9    WQAMQDGNIFYKRQQVYSINGKLPNLGDFFIAGCRYGGPLALMRDNTKMVALGRGAPAFS  68

Query  269  K--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
            K  +++F+ AG  +    W     ++V   WT D+ L  + ++GT   YD++ +  E  S
Sbjct  69   KSQIQVFSPAGDGLLLFSWDQ--SKIVKFGWTADERLAVLNEEGTYRLYDLQGD-YEQYS  125

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG D     ++D     +G+V +  + Q+  +  ++   P+ L +PGL   P S TVI P
Sbjct  126  LGSDAAEVGIIDAKIHESGMVAMTGSLQLLEVKGWEGVKPLTLNNPGLSQPPFSWTVIPP  185

Query  623  QYTMSGNVEVLMAVGDHVLLVEE-DGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
             +T+S +VEVL++V   +L V+  D + Q  +  GP   M  S NGK LA  T +G L V
Sbjct  186  DFTISRHVEVLLSVDSTILTVDNLDSVDQR-LSRGPFSHMSPSPNGKSLALLTLEGMLWV  244

Query  800  MT  805
            ++
Sbjct  245  VS  246



>gb|EKV05733.1| Vacuolar protein sorting vps16, putative [Penicillium digitatum 
Pd1]
 gb|EKV18693.1| Vacuolar protein sorting vps16, putative [Penicillium digitatum 
PHI26]
Length=828

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 126/241 (52%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ + N +YRK  +Y   +   V+L    VA +P+GG IA+ RD++K  +L      R
Sbjct  7    ANWEKVGNSFYRKIAVYDAIFDDDVELENYIVAGAPYGGAIALYRDESKPFRLRDGQGSR  66

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ +G +I    W+    R  G+ W+D + L+ +++DGTV RY        S SL
Sbjct  67   PAIDVYSCSGQKINRINWEKATIR--GIGWSDKEELLVVSEDGTVRRYFGLDGEFTSFSL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTVIEP  622
            G     + V  C FW +G+V +    Q+  +  +  P P  LA  P  E    S  +I P
Sbjct  125  GNSAEEYGVRACQFWSSGLVALLSNNQLIAVSKYDEPRPRLLATCP--EGEVSSWALIPP  182

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             +T+S +VEVL+AV   V L++    +   +  GP + + VS  G+ +A FT +G+L V+
Sbjct  183  AHTLSRSVEVLLAVDKTVFLIDPTEAEDKILQDGPFKHISVSPTGRFVALFTAEGKLWVV  242

Query  803  T  805
            +
Sbjct  243  S  243



>gb|KIK56666.1| hypothetical protein GYMLUDRAFT_230051 [Gymnopus luxurians FD-317 
M1]
Length=846

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 132/242 (55%), Gaps = 10/242 (4%)
 Frame = +2

Query  98   WQLLYN--RYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES---A  262
            WQ + N   +YR+ +LY +  K  DL    +A   +GGP+A++RD+ K+V +   +   A
Sbjct  9    WQAMQNGSAFYRRQQLYSILGKFPDLGDYIIAGCRYGGPLALMRDNTKLVAVGRATPAFA  68

Query  263  LRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
              ++++++SAG  +    W+    R++   WT D+ L+ + ++G    YD++ +  +  S
Sbjct  69   KSQIQVYSSAGEGLLLFSWEQ--SRIIRFGWTVDEKLVVLNEEGVYRVYDLQGD-YQQYS  125

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG +     V+D   + NG+V +  +  +  +  ++   P+ LA+P + D P+S T+I P
Sbjct  126  LGSEASEMGVIDARIYENGLVALIGSLALLEVKGWEGARPMTLANPNITDPPVSWTIIPP  185

Query  623  QYTMSGNVEVLMAVGDHVLLVEE-DGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLV  799
               +S +VEVL++V + + +V+  + I Q  +  GP   +  S NGK LA     G LLV
Sbjct  186  DANVSRHVEVLLSVENTIYIVDNLESIDQR-LSQGPFTHVSSSPNGKFLALLNASGTLLV  244

Query  800  MT  805
            ++
Sbjct  245  IS  246



>ref|XP_001907999.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP68672.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP32142.1| Putative vacuolar protein sorting-associated protein 16 VPS16 
[Podospora anserina S mat+]
Length=838

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 128/249 (51%), Gaps = 8/249 (3%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELY-QMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M      A W+ L   +YRK +LY Q+  + +DL    VA +P+ G IA+ RD+ K+V  
Sbjct  1    MDVAHPTAGWEQLGPSFYRKVQLYTQVFDQDLDLDNYIVAGAPYSGAIALYRDEGKLVAY  60

Query  248  Y-AESALRKLRIFNSAGVQ-IAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRY-DIR  418
                ++   + I++ AG + I    W +  G + G+ W++D+ L+ +T DGTV  Y D++
Sbjct  61   QPTRTSKPSIDIYSCAGGEPILSIPWDS--GSIKGLGWSEDEKLLVVTADGTVRCYFDLQ  118

Query  419  AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFP  598
             E     SLG       V  C F+ +G+V +     +  +  +  P P KL  P  E   
Sbjct  119  GE-FTQFSLGNGAEDSGVKSCRFYAHGLVALLNNNSLVSVSSYSEPRP-KLLAPPPEGEV  176

Query  599  LSMTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFT  778
             S ++I P YT S +VEVL+++G  + + +    +  G+  GP   + VS NGK +A +T
Sbjct  177  HSWSLIPPSYTNSRSVEVLLSIGQTIYVSDATACEDRGLDQGPFTHITVSPNGKFVALYT  236

Query  779  HDGRLLVMT  805
              GR+ V+ 
Sbjct  237  KAGRVYVIN  245



>emb|CCA70355.1| related to vacuolar protein sorting VACUOLELESS1 [Piriformospora 
indica DSM 11827]
Length=883

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 118/238 (50%), Gaps = 12/238 (5%)
 Frame = +2

Query  119  YYRKPELYQMQWK------HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALRK-LR  277
            +Y +  +Y M W         DL+   VA + FGGPIA+IRD++K++ L   +  +  + 
Sbjct  23   FYSRRHVYHMNWNLGAGGGGSDLSGYVVAAARFGGPIAIIRDNSKLIALGRTTFTKPVIL  82

Query  278  IFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDC  457
            +++SAG Q+A   W+    ++V + WT  + L+ + +DG    YD+      + SLG + 
Sbjct  83   VYSSAGTQLASITWEL--SKIVALGWTMSEELVVLNEDGQYRLYDLLGTTYRTYSLGPEA  140

Query  458  FTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMS  637
                VVD   +  G+V +        +  +    P  L+ P L   P++ T+I P  T S
Sbjct  141  AETGVVDARIFEAGLVALTGNLSFLEVRAWSGSKPTVLSSPVLTGPPITWTIIPPDQTSS  200

Query  638  GNVEVLMAVGDHVLLVE--EDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
             + EV+MAV   +   +  E   QQLG G GP   + VS NG+ LA  T    L V+T
Sbjct  201  RHAEVIMAVEGTIYTCDNLEHIDQQLG-GSGPFTHIAVSPNGRSLALLTSSSNLWVIT  257



>ref|XP_011117417.1| hypothetical protein AOL_s00004g466 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53807.1| hypothetical protein AOL_s00004g466 [Arthrobotrys oligospora 
ATCC 24927]
Length=835

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/243 (33%), Positives = 117/243 (48%), Gaps = 11/243 (5%)
 Frame = +2

Query  98   WQLLYNRYYRKPELYQMQW---KHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            W+L+  +YYRK  ++   W   +  DL    VA +PFGG IA+ +D  K        A +
Sbjct  12   WELVSGQYYRKFTVFTPSWTQDEDFDLDDYLVAGAPFGGAIALWKDPRKFHAYQGGQAAK  71

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVY-RYDIRAEPLESLS  442
              + I N AG  +    W    G +  + W+DD+ L+ +T DG+V   YD++       S
Sbjct  72   PNIMICNLAGALLRRITWDR--GAIQSIGWSDDEHLLVVTTDGSVRCYYDLQGN-FTQFS  128

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGL---EDFPLSMTV  613
            LG D   H VV C FW  G V +        +  +  P P  LA P L   E    S  +
Sbjct  129  LGADAEEHGVVSCRFWGTGFVALLSNNVFVAVNRYDEPRPRPLALPKLPSPESKIHSWAL  188

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRL  793
            I P Y+ S +VEV+MA    +L+V+    Q   +  GP   + VS NG  +A +T DG++
Sbjct  189  IPPNYSDSRHVEVIMATDQTILIVDATESQDQILQNGPFHHISVSPNGSYVALYTGDGKV  248

Query  794  LVM  802
             V+
Sbjct  249  WVI  251



>ref|XP_009217087.1| vacuolar protein sorting-associated protein [Gaeumannomyces graminis 
var. tritici R3-111a-1]
 gb|EJT81078.1| vacuolar protein sorting-associated protein [Gaeumannomyces graminis 
var. tritici R3-111a-1]
Length=827

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 125/241 (52%), Gaps = 7/241 (3%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWK-HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A W+ + +RYYRK +LY   +   +DL    VA +P  G +A+  D+ K+V+  A  A +
Sbjct  7    ASWEQVGDRYYRKVQLYTAVFDLDLDLDNYVVAGAPDAGAVALYMDENKLVEYRAGQARK  66

Query  269  -KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSL  445
              + +++ AG  +    W    G ++G+ W++D+ L+ +T+DGTV  Y          SL
Sbjct  67   PSVDVYSCAGKLLRSIPWDK--GSVIGLGWSEDERLLVVTRDGTVRCYYGLQHDFTQFSL  124

Query  446  GKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPL-SMTVIEP  622
            G     + V  C+F+  G+V +     +  +  +  P P  LA     D P+ S  +I P
Sbjct  125  GHGADEYGVQACLFYDTGLVALLSNNTLVSVSSYAEPRPRALA--AAPDGPVHSWALIPP  182

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            ++T+S +VEVL+++G  V + +    +   + IGP   + VS NGK  A +T  G + V+
Sbjct  183  RHTLSRSVEVLLSIGQTVYVADASECEDRFLDIGPFSHVAVSPNGKFAALYTPAGHVHVI  242

Query  803  T  805
            T
Sbjct  243  T  243



>ref|XP_001641101.1| predicted protein [Nematostella vectensis]
 gb|EDO49038.1| predicted protein [Nematostella vectensis]
Length=770

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 128/248 (52%), Gaps = 21/248 (8%)
 Frame = +2

Query  86   VAAEWQLLYNRYYRKPELYQMQWK--HVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAES  259
            V A+W  L + +YRK ELY M W    VDL++   A SPFGGPIA++R+  +I       
Sbjct  4    VTADWTPLGDVFYRKQELYSMTWNLNDVDLSKFGKAASPFGGPIALVRETTQI------Q  57

Query  260  ALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESL  439
                + IF+SAG ++++  +   GGRL+ ++WT  + L+CI  DG+V  YDI      + 
Sbjct  58   VKPLIYIFSSAGKELSKISFD--GGRLIHIAWTASEELMCIAVDGSVSLYDIHGTFFRTF  115

Query  440  SLGKDCFTHSVVDCVFWHN----GVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSM  607
            ++G +     V++C  + +    G+  +  ++      +  +    + ADP   + P S 
Sbjct  116  TMGHEAQMSQVIECRVFRSSAGTGLAILTGSYHFIVTTNIDDVRCKQFADPPGLNAPPSS  175

Query  608  TVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVG----IGPLQKMVVSRNGKLLASF  775
             ++ PQ       ++L+A+ + + L+ +  +QQ+ V     +  + +M +S NG  LA F
Sbjct  176  WLVLPQ---DRRADLLVAIDNQLFLINKLDVQQMSVTFSEPVNSITEMALSFNGAYLALF  232

Query  776  THDGRLLV  799
            T  G L +
Sbjct  233  TDSGLLWI  240



>gb|KEY69049.1| hypothetical protein S7711_03347 [Stachybotrys chartarum IBT 
7711]
 gb|KFA52785.1| hypothetical protein S40293_00890 [Stachybotrys chartarum IBT 
40293]
Length=827

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/247 (30%), Positives = 130/247 (53%), Gaps = 6/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   AEW+ + N+++RK +LY   + + +DL    VA +P+ G IA+ RDD+K+   
Sbjct  1    MDTLHPRAEWESVGNKWFRKTQLYTAVFDQDLDLDSYIVAGAPYAGAIALWRDDSKLHAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                S+   + I++ AG ++    W    G + G+ WT+++TL+ +T DG V  YD++ +
Sbjct  61   QPGRSSKPSIDIYSLAGKRLQSISWDK--GPIKGLGWTEEETLVVVTADGNVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG       V  C F++ G+V +     +  +  +  P P +LA    E    S
Sbjct  119  -FSHFSLGHGADNFGVESCRFYNQGMVALLGNNSLITVNSYAEPRPKQLASTP-EGQVHS  176

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
              +I P YT+S +VEVL+++   V +V+    +   + IGP   + VS NG+ +  +  +
Sbjct  177  WGIIPPYYTLSRSVEVLLSIEKTVYVVDATDCEDRFLDIGPFTHISVSPNGEHVNLYAEN  236

Query  785  GRLLVMT  805
            G+  V++
Sbjct  237  GKAHVIS  243



>gb|KFA65450.1| hypothetical protein S40285_00515 [Stachybotrys chlorohalonata 
IBT 40285]
Length=827

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/247 (30%), Positives = 130/247 (53%), Gaps = 6/247 (2%)
 Frame = +2

Query  71   MSTVSVAAEWQLLYNRYYRKPELYQMQW-KHVDLTRNKVACSPFGGPIAVIRDDAKIVQL  247
            M T+   AEW+ + N+++RK +LY   + + +DL    VA +P+ G IA+ RDD+K+   
Sbjct  1    MDTLHPRAEWESVGNKWFRKTQLYTAVFDQDLDLDSYIVAGAPYAGAIALWRDDSKLHAY  60

Query  248  Y-AESALRKLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAE  424
                S+   + I++ AG ++    W    G + G+ WT+++TL+ +T DG V  YD++ +
Sbjct  61   QPGRSSKPSIDIYSLAGKRLQSISWDK--GPIKGLGWTEEETLVVVTADGNVRCYDLQGD  118

Query  425  PLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLS  604
                 SLG       V  C F++ G+V +     +  +  +  P P +LA    E    S
Sbjct  119  -FSHFSLGHGADNFGVESCRFYNQGMVALLGNNSLITVNSYAEPRPKQLASTP-EGQVHS  176

Query  605  MTVIEPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHD  784
              +I P YT+S +VEVL+++   V +V+    +   + IGP   + VS NG+ +  +  +
Sbjct  177  WGIIPPYYTLSRSVEVLLSIEKTVYVVDATDCEDRFLDIGPFTHISVSPNGEHVNLYAEN  236

Query  785  GRLLVMT  805
            G+  V++
Sbjct  237  GKAHVIS  243



>gb|KDQ19047.1| hypothetical protein BOTBODRAFT_28535 [Botryobasidium botryosum 
FD-172 SS1]
Length=846

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 125/230 (54%), Gaps = 4/230 (2%)
 Frame = +2

Query  119  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAG  295
            +YRK E+Y MQW+  DL+   +A + +GGP A+IR+ +KIV L   +  + ++++F+S+G
Sbjct  20   FYRKVEIYSMQWQLSDLSNFIIAGARYGGPFALIRNTSKIVALDRMAFTKPQIQLFSSSG  79

Query  296  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  475
              I    W    G+++ M WT D+ L+ + ++G+   YD++ +  +  SLG +     V+
Sbjct  80   DLIQIIPWDQ--GKIIRMGWTFDEELVVLNEEGSYRIYDLQGDHRQ-YSLGSEAQEVGVI  136

Query  476  DCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGNVEVL  655
            D     +G+V +     +  I  ++   P+ LA+  L   P   ++I P  T+S +VEVL
Sbjct  137  DARIHESGLVAMTGNLGLLEIKGWEGGKPLTLANSTLNAPPHCWSIIPPDQTISRHVEVL  196

Query  656  MAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            +A    +L V+        +  GP  K+ VS NGK LA  T  G L V++
Sbjct  197  LAHESTILSVDNLECIDQRLSRGPFAKLAVSPNGKSLALLTKAGLLWVVS  246



>emb|CCG84590.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=826

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 125/243 (51%), Gaps = 11/243 (5%)
 Frame = +2

Query  95   EW-QLLYNRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESAL-R  268
            EW +L    YY K ELY++ W  VDL+    A + +GG IAV RDD K  +   +S L  
Sbjct  8    EWDELGSETYYHKFELYKLSWPEVDLSGVIFAAASYGGAIAVTRDDEKFQKYRGQSQLSN  67

Query  269  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  448
              ++F+S G  + +  W+    R +G  WTD++ L+ ++++G V  YD+        SL 
Sbjct  68   STQVFSSVGQLLRDIRWEGVSIRSLG--WTDEERLLIVSKEGLVRYYDLLGN-FSQFSLT  124

Query  449  KDCFTHSVVDCVFWHNGVVC--INEAFQVFCIPDFKNPNPIKLADPGL--EDFPLSMTVI  616
            K+     V++C FW++G++    N AF    I +++ P P  L +  L  E    S T+ 
Sbjct  125  KNSDEGEVIECKFWNSGMIARMSNNAF--IKIDNYREPRPHVLLNTHLKPESVINSWTIT  182

Query  617  EPQYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLL  796
             P +T+S   E L+++   ++ ++    Q L V  GP   +  S NG+ LA    +G +L
Sbjct  183  APAFTVSRQAECLVSLDKTIISLDGADSQDLSVDHGPFTHLQSSPNGQFLALRRAEGNIL  242

Query  797  VMT  805
            V +
Sbjct  243  VAS  245



>emb|CEL57340.1| Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium 
discoideum GN=vps16 PE=3 SV=2 [Rhizoctonia solani 
AG-1 IB]
Length=734

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 121/232 (52%), Gaps = 6/232 (3%)
 Frame = +2

Query  119  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAG  295
            +Y   E+YQM W+  DLT   +A + +GGP+A++RD +K+V L   S  + ++ I++SAG
Sbjct  20   FYSTREVYQMMWQLNDLTDFIIAGARYGGPLALMRDTSKLVALGRHSVSKPQIIIYSSAG  79

Query  296  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  475
              I    W    G++V M WT D+ L+ + ++GT   +D+     +  SLG D     + 
Sbjct  80   NLINTIPWDQ--GKVVSMGWTHDERLVALNEEGTYRIHDLSGAYTQH-SLGTDAADIGIQ  136

Query  476  DCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLA--DPGLEDFPLSMTVIEPQYTMSGNVE  649
            D     +G+V +        +  +    P+ LA  DP L+  P   +++ P  T+S ++E
Sbjct  137  DARIHEHGLVALTNQLTFLEVKAWTGTKPLALALPDPSLDGAPHGWSIVPPDATISRHIE  196

Query  650  VLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            VL+A G+ +L V+        VG GP   +  S NGK +A  T  G + V++
Sbjct  197  VLVASGNTILSVDALECVDQRVGRGPFLSIAPSPNGKSIALLTSSGLVWVVS  248



>ref|XP_005104108.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Aplysia californica]
Length=789

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/247 (30%), Positives = 131/247 (53%), Gaps = 18/247 (7%)
 Frame = +2

Query  92   AEWQLLYNRYYRKPELYQMQWKH-VDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR  268
            A+W  L   YYRK ELY M+W   VDL ++ VA S +GGPIA+++DD+K  ++   +   
Sbjct  4    ADWNPLGEVYYRKCELYTMEWSGLVDLAKHTVAASSYGGPIALMKDDSKTARV-TTTIKP  62

Query  269  KLRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLG  448
             + ++N+AG  +++  W +  G +V M W+  + L+C+ +DG V  YD+     ++ S+G
Sbjct  63   VISVYNAAGKLLSQMRWNS--GTVVTMGWSATEELLCVQEDGVVLVYDMFLTFKKTFSMG  120

Query  449  KDCFTHSVVD----CVFWHNGVVCINEAFQVFCIPDFKNPNPIKLAD-PGLEDFPLSMTV  613
            ++     ++D      F   G+  +  +F++F I +  +P  ++LA+ PGL + P   T+
Sbjct  121  QEAKDVKILDAKIFASFQGTGIAVMTTSFRIFLISNVDSPRIVRLAEVPGLNEAPNCWTI  180

Query  614  IEPQYTMSGNVEVLMAVGDHVLLVEEDGIQ-----QLGVGIGPLQKMVVSRNGKLLASFT  778
            +            L+A G  + LV++ G       +L    G + ++ VS N K LA  T
Sbjct  181  V----VSDRQARALVAKGGELYLVDQGGQFQQQQAELSENAGDITELAVSFNNKYLALCT  236

Query  779  HDGRLLV  799
             +G L +
Sbjct  237  KNGALWI  243



>gb|EMS54443.1| Vacuolar protein sorting-associated protein 16-like protein [Triticum 
urartu]
Length=307

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 80/112 (71%), Gaps = 6/112 (5%)
 Frame = +2

Query  485  FWHNGVVCINEAFQVFCIPDFK--NPNPIKLADPGL--EDFPLSMTVIEPQYTMSGNVEV  652
            FW  GV  + E  +V    D +  +P+P +LADPG+  ++  L M V+EPQ+ MSG+ EV
Sbjct  45   FWGGGVAILTEDNRVVVTTDIEVDDPHPRELADPGVAEDEQVLCMAVVEPQFVMSGSPEV  104

Query  653  LMAVGDHVLLVEEDGIQQLG--VGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
            L+AVGD V+ V+EDG+Q LG  + IGP+QKM VS NGKLLA+F HDGRLLV+
Sbjct  105  LLAVGDRVVSVDEDGVQVLGEALEIGPVQKMAVSPNGKLLAAFAHDGRLLVI  156



>ref|XP_003030158.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
 gb|EFI95255.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
Length=848

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 127/241 (53%), Gaps = 8/241 (3%)
 Frame = +2

Query  98   WQLLYNR--YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQL-YAESALR  268
            WQ + +   +YRK +LY +  K  +L    VA   +GGP+A++RD+ K++ L  A    +
Sbjct  9    WQAMQDGKVFYRKQQLYMIPDKLPNLADYIVAGCRYGGPLALMRDNTKMIALGRAAPTFQ  68

Query  269  K--LRIFNSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLS  442
            K  +RI++++G  +    W    GR++   WT D+ L+ + ++G    YD++ E  E  S
Sbjct  69   KAEIRIYSASGDGLLLFTWNQ--GRIIRFGWTHDERLVVLNEEGVYRIYDLQGE-YEQYS  125

Query  443  LGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEP  622
            LG +     V+D     +G+V +  +  +  +  +    P+ LA+PGL + P +  VI P
Sbjct  126  LGSEAGELGVIDAQIMESGLVALTGSLSLLEVKGWTGSRPVTLANPGLIEPPSAWAVIPP  185

Query  623  QYTMSGNVEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVM  802
             YT S +VEVL++V   +  V+        +  GP  ++  S  G+ LA  T+ G LLV+
Sbjct  186  DYTSSRHVEVLLSVDSTIYTVDNLECIDQRLSRGPFTQIAPSPKGQNLALLTYTGTLLVV  245

Query  803  T  805
            +
Sbjct  246  S  246



>ref|XP_001832533.2| vacuolar protein sorting 16 isoform 1 [Coprinopsis cinerea okayama7#130]
 gb|EAU89282.2| vacuolar protein sorting 16 isoform 1 [Coprinopsis cinerea okayama7#130]
Length=847

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 125/235 (53%), Gaps = 8/235 (3%)
 Frame = +2

Query  113  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIV---QLYAESALRKLRIF  283
            N +YR+ +LY +  K  DL    VA   +GGP+A++RD  K++   QL       +++++
Sbjct  16   NTFYRRQQLYSIPGKLPDLGDYIVAGCQYGGPLAIMRDTTKLLAIGQLTPAITKPQIQVY  75

Query  284  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  463
            ++AG  +    W    GR+V   WT D+ L+ + ++G    YD++ E  +  SLG D   
Sbjct  76   SAAGEGLLLLSWDQ--GRIVKFGWTLDERLVVLNEEGVYRIYDLQGEYTQH-SLGPDASE  132

Query  464  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGN  643
              V+D     NG+V +  +  +  +  ++   P+ LA+PG+ + P + ++I P   +S +
Sbjct  133  TGVIDARIHGNGLVALTSSLSLLEVKGWEGGRPLTLANPGMTEPPHAWSIIPPDLNISRH  192

Query  644  VEVLMAVGDHVLLVEE-DGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            VEVL++V   +  V+  + I Q  +  GP   +  S NGK LA  T +G L V++
Sbjct  193  VEVLLSVDQTIYTVDNLESIDQR-IARGPFTHISPSPNGKFLALLTFNGTLWVVS  246



>emb|CCO31224.1| putative vacuolar protein sorting-associated protein 16 homolog 
[Rhizoctonia solani AG-1 IB]
Length=818

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 121/232 (52%), Gaps = 6/232 (3%)
 Frame = +2

Query  119  YYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLYAESALR-KLRIFNSAG  295
            +Y   E+YQM W+  DLT   +A + +GGP+A++RD +K+V L   S  + ++ I++SAG
Sbjct  20   FYSTREVYQMMWQLNDLTDFIIAGARYGGPLALMRDTSKLVALGRHSVSKPQIIIYSSAG  79

Query  296  VQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFTHSVV  475
              I    W    G++V M WT D+ L+ + ++GT   +D+     +  SLG D     + 
Sbjct  80   NLINTIPWDQ--GKVVSMGWTHDERLVALNEEGTYRIHDLSGAYTQH-SLGTDAADIGIQ  136

Query  476  DCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLA--DPGLEDFPLSMTVIEPQYTMSGNVE  649
            D     +G+V +        +  +    P+ LA  DP L+  P   +++ P  T+S ++E
Sbjct  137  DARIHEHGLVALTNQLTFLEVKAWTGTKPLALALPDPSLDGAPHGWSIVPPDATISRHIE  196

Query  650  VLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            VL+A G+ +L V+        VG GP   +  S NGK +A  T  G + V++
Sbjct  197  VLVASGNTILSVDALECVDQRVGRGPFLSIAPSPNGKSIALLTSSGLVWVVS  248



>gb|KIK24542.1| hypothetical protein PISMIDRAFT_645755 [Pisolithus microcarpus 
441]
Length=841

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 125/234 (53%), Gaps = 6/234 (3%)
 Frame = +2

Query  113  NRYYRKPELYQMQWKHVDLTRNKVACSPFGGPIAVIRDDAKIVQLY---AESALRKLRIF  283
            N +YR+ +LY +  K  +L    VA    GGPIA++RD +K+V +      S+  +++++
Sbjct  19   NVFYRRLQLYSIAGKIPNLNDYVVAGCRNGGPIALMRDPSKLVAIGRAGPASSRSQIQVY  78

Query  284  NSAGVQIAETVWKNPGGRLVGMSWTDDQTLICITQDGTVYRYDIRAEPLESLSLGKDCFT  463
            + AG  I    W    GR+V   WT D+ L  + ++GT   YD++ E  +  SLG +   
Sbjct  79   SPAGEGILLFNWDQ--GRIVRFGWTYDERLAVLNEEGTYRLYDLQGE-YQQFSLGTEAAE  135

Query  464  HSVVDCVFWHNGVVCINEAFQVFCIPDFKNPNPIKLADPGLEDFPLSMTVIEPQYTMSGN  643
              ++D     NG V ++ +  +  + D+    P+ LA+PGL + P +  VI P   +S +
Sbjct  136  MGIIDARIHENGFVALSGSLALLEVKDWGGGRPLTLANPGLSEPPHAWAVIPPDQNISRH  195

Query  644  VEVLMAVGDHVLLVEEDGIQQLGVGIGPLQKMVVSRNGKLLASFTHDGRLLVMT  805
            VEVL++V + +++V+        +  GP  ++  S NG+LLA    +G L V++
Sbjct  196  VEVLLSVDNTIIVVDNLESADQRISRGPFIRVSPSPNGRLLALLNSNGLLWVVS  249



>gb|ETP46453.1| hypothetical protein F442_07305 [Phytophthora parasitica P10297]
Length=1895

 Score =   115 bits (289),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/257 (30%), Positives = 127/257 (49%), Gaps = 16/257 (6%)
 Frame = +2

Query  80    VSVAAEWQLLYNRYYRKPELYQMQWKH---VDLTRNKVACSPFGGPIAVIRDDAKIVQLY  250
             +S+  EW  L    Y+K  +Y M W      DL     AC+P+GGP+A++RD  K+V++ 
Sbjct  1024  ISMETEWHTLGKVQYQKWAVYGMTWASEGVTDLRDFVAACAPYGGPVALLRDPKKLVKVS  1083

Query  251   AESAL-RKLRIFNSAGVQIAETVW---KNPGGRLVGMSWTDDQTLICITQDGTVYRYDIR  418
             ++S L R+L +FN+ G ++    W   ++    LVGM+WTD+  L+C+   GT   + + 
Sbjct  1084  SDSPLARQLLLFNACGRKLGSVDWTPFEDKKETLVGMTWTDELRLLCVFASGTCVAFSMS  1143

Query  419   AEPLESLSLGKDCFTHSVVDCVFWHNGVVCINEAFQVFCIPDFKN--PNPIKLADPGLED  592
              +     SL        V     W  G+V + E   +  + D  +  P    L D GL D
Sbjct  1144  GDEETRFSLLPPGAKDKVATFEAWGGGLVALTEKMALVQVLDVDSVRPKVSLLPDCGLSD  1203

Query  593   F--PLSMTVIEPQYTMSGNVEVLMAVGDHVLLV--EEDGIQQLGVG---IGPLQKMVVSR  751
                P  M ++EP++  S   EVL+   +  L++  ++ G Q + +      P+  + ++ 
Sbjct  1204  SNPPTCMALLEPKFLKSIYPEVLLGTSNKSLVIVSKDGGAQDMKLQESIAAPISAVAIAP  1263

Query  752   NGKLLASFTHDGRLLVM  802
             NG  +A FT DG L V+
Sbjct  1264  NGLFMALFTQDGILTVL  1280



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005