BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041G05

Length=814
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         284   2e-88   Nicotiana sylvestris
ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    283   4e-88   Nicotiana tomentosiformis
emb|CDP07412.1|  unnamed protein product                                269   2e-82   Coffea canephora [robusta coffee]
gb|KHF97947.1|  hypothetical protein F383_10892                         265   4e-81   Gossypium arboreum [tree cotton]
gb|AID55377.1|  glycoside hydrolase family 9 B5                         265   5e-81   Gossypium hirsutum [American cotton]
gb|KJB58118.1|  hypothetical protein B456_009G195400                    265   6e-81   Gossypium raimondii
gb|ADU15552.1|  EG                                                      265   6e-81   Gossypium hirsutum [American cotton]
ref|XP_007017777.1|  EG isoform 3                                       259   7e-81   
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    263   1e-80   Solanum lycopersicum
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   261   2e-79   Sesamum indicum [beniseed]
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        261   2e-79   Cucumis melo [Oriental melon]
gb|AGV22125.1|  endo-1,4-beta-glucanase 3                               260   3e-79   Betula luminifera [liang ye hua]
ref|XP_007017776.1|  EG isoform 2                                       259   7e-79   Theobroma cacao [chocolate]
ref|XP_007017775.1|  EG isoform 1                                       259   9e-79   
ref|XP_010244092.1|  PREDICTED: endoglucanase 24-like                   258   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    258   2e-78   Cucumis sativus [cucumbers]
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   258   3e-78   Glycine max [soybeans]
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        257   5e-78   Glycine max [soybeans]
ref|XP_010104437.1|  Endoglucanase 24                                   256   1e-77   Morus notabilis
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    256   2e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   254   4e-77   Eucalyptus grandis [rose gum]
ref|XP_003603741.1|  Endoglucanase                                      254   1e-76   
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   253   1e-76   Solanum tuberosum [potatoes]
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     253   1e-76   Medicago truncatula
ref|XP_002276739.1|  PREDICTED: endoglucanase 10                        253   2e-76   Vitis vinifera
ref|XP_006302134.1|  hypothetical protein CARUB_v10020139mg             253   2e-76   Capsella rubella
ref|XP_011045112.1|  PREDICTED: endoglucanase 2                         252   3e-76   Populus euphratica
ref|XP_004500948.1|  PREDICTED: endoglucanase 10-like                   252   4e-76   Cicer arietinum [garbanzo]
gb|AFZ78647.1|  korrigan                                                251   8e-76   Populus tomentosa [Chinese white poplar]
gb|KJB58120.1|  hypothetical protein B456_009G195400                    251   1e-75   Gossypium raimondii
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             251   1e-75   Phaseolus vulgaris [French bean]
dbj|BAF42037.1|  cellulase2                                             251   1e-75   Pyrus communis
gb|EPS64495.1|  hypothetical protein M569_10284                         251   1e-75   Genlisea aurea
ref|XP_010539853.1|  PREDICTED: endoglucanase 10                        250   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_008364934.1|  PREDICTED: endoglucanase 10-like                   250   2e-75   
ref|XP_002889037.1|  hypothetical protein ARALYDRAFT_895440             250   2e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_011083520.1|  PREDICTED: endoglucanase 10                        249   3e-75   Sesamum indicum [beniseed]
ref|XP_010416457.1|  PREDICTED: endoglucanase 10-like                   249   5e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010471690.1|  PREDICTED: endoglucanase 10                        249   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                   249   6e-75   Prunus mume [ume]
ref|XP_010428595.1|  PREDICTED: endoglucanase 10-like                   248   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    248   2e-74   
ref|XP_010536354.1|  PREDICTED: endoglucanase 10-like                   247   3e-74   Tarenaya hassleriana [spider flower]
ref|XP_002307711.1|  glycosyl hydrolase family 9 family protein         247   3e-74   Populus trichocarpa [western balsam poplar]
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg             245   1e-73   Citrus clementina [clementine]
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg                244   2e-73   Erythranthe guttata [common monkey flower]
gb|KJB14408.1|  hypothetical protein B456_002G123700                    244   3e-73   Gossypium raimondii
gb|AAM63477.1|  endo-beta-1,4-glucanase, putative                       244   3e-73   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                244   4e-73   Erythranthe guttata [common monkey flower]
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                   244   6e-73   Citrus sinensis [apfelsine]
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                   244   6e-73   Citrus sinensis [apfelsine]
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                         243   1e-72   Malus domestica [apple tree]
ref|XP_004957464.1|  PREDICTED: endoglucanase 24-like                   243   1e-72   Setaria italica
gb|KDP36939.1|  hypothetical protein JCGZ_08230                         243   1e-72   Jatropha curcas
ref|XP_011100152.1|  PREDICTED: endoglucanase 24-like                   242   3e-72   
gb|EEC84946.1|  hypothetical protein OsI_32163                          241   4e-72   Oryza sativa Indica Group [Indian rice]
ref|NP_177697.1|  glycosyl hydrolase 9B7                                241   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001063771.1|  Os09g0533900                                       241   6e-72   
ref|XP_009128120.1|  PREDICTED: endoglucanase 10                        241   7e-72   Brassica rapa
ref|XP_007046716.1|  EG                                                 241   7e-72   
gb|EEE70113.1|  hypothetical protein OsJ_30126                          241   7e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  241   8e-72   Ricinus communis
emb|CDY13546.1|  BnaC02g23570D                                          238   8e-72   Brassica napus [oilseed rape]
ref|XP_006390284.1|  hypothetical protein EUTSA_v10018397mg             241   8e-72   Eutrema salsugineum [saltwater cress]
ref|XP_009398708.1|  PREDICTED: endoglucanase 24-like                   240   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP46724.1|  hypothetical protein JCGZ_06512                         241   1e-71   Jatropha curcas
emb|CDY39048.1|  BnaA02g17370D                                          240   2e-71   Brassica napus [oilseed rape]
ref|XP_010649048.1|  PREDICTED: endoglucanase 24-like                   239   2e-71   Vitis vinifera
ref|XP_009386441.1|  PREDICTED: endoglucanase 24-like                   239   5e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001145749.1|  hypothetical protein                               239   6e-71   Zea mays [maize]
ref|XP_002462729.1|  hypothetical protein SORBIDRAFT_02g030990          238   9e-71   Sorghum bicolor [broomcorn]
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         238   1e-70   Populus trichocarpa [western balsam poplar]
emb|CDY66396.1|  BnaAnng22170D                                          238   1e-70   Brassica napus [oilseed rape]
ref|XP_004291374.1|  PREDICTED: endoglucanase 10-like                   238   2e-70   Fragaria vesca subsp. vesca
ref|XP_010935039.1|  PREDICTED: endoglucanase 24-like                   237   2e-70   Elaeis guineensis
gb|KJB43353.1|  hypothetical protein B456_007G195700                    237   2e-70   Gossypium raimondii
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    237   3e-70   Citrus sinensis [apfelsine]
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg             237   3e-70   
ref|XP_009103373.1|  PREDICTED: endoglucanase 2                         237   3e-70   Brassica rapa
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                   237   4e-70   Citrus sinensis [apfelsine]
emb|CDY43425.1|  BnaC07g14920D                                          236   5e-70   Brassica napus [oilseed rape]
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                    236   6e-70   Populus euphratica
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    236   8e-70   Eucalyptus grandis [rose gum]
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     235   8e-70   Eucalyptus grandis [rose gum]
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                   236   1e-69   Prunus mume [ume]
ref|XP_008372790.1|  PREDICTED: endoglucanase 24-like                   235   1e-69   
ref|XP_009378180.1|  PREDICTED: endoglucanase 2-like                    235   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_010113364.1|  Endoglucanase 24                                   235   2e-69   
emb|CDP04112.1|  unnamed protein product                                230   2e-69   Coffea canephora [robusta coffee]
ref|XP_008788648.1|  PREDICTED: endoglucanase 24                        234   2e-69   Phoenix dactylifera
ref|XP_011462352.1|  PREDICTED: endoglucanase 2-like                    233   7e-69   Fragaria vesca subsp. vesca
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                         233   9e-69   
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                   233   9e-69   Elaeis guineensis
dbj|BAJ93299.1|  predicted protein                                      233   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                   233   1e-68   Phoenix dactylifera
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                         232   1e-68   Camelina sativa [gold-of-pleasure]
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                    232   1e-68   Arabis alpina [alpine rockcress]
emb|CDX73186.1|  BnaC06g36340D                                          231   3e-68   
gb|AAF79918.1|AC022472_27  Contains similarity to beta-1,4-glucan...    225   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                    231   4e-68   Nicotiana sylvestris
ref|XP_006661478.1|  PREDICTED: endoglucanase 24-like                   230   5e-68   
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             231   6e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    231   6e-68   Nicotiana tomentosiformis
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                    230   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_011043209.1|  PREDICTED: endoglucanase 2-like                    229   2e-67   Populus euphratica
ref|XP_003578508.1|  PREDICTED: endoglucanase 24                        229   2e-67   Brachypodium distachyon [annual false brome]
ref|XP_009106216.1|  PREDICTED: endoglucanase 10-like                   229   3e-67   Brassica rapa
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    227   1e-66   Solanum lycopersicum
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg             227   1e-66   Capsella rubella
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein                226   2e-66   Arabidopsis lyrata subsp. lyrata
gb|AID55379.1|  glycoside hydrolase family 9 B7                         226   2e-66   Gossypium hirsutum [American cotton]
gb|KJB63540.1|  hypothetical protein B456_010G005200                    226   3e-66   Gossypium raimondii
emb|CDY47506.1|  BnaAnng09040D                                          226   3e-66   Brassica napus [oilseed rape]
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   226   3e-66   Glycine max [soybeans]
ref|XP_003629333.1|  Endoglucanase                                      226   4e-66   Medicago truncatula
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    226   4e-66   Solanum tuberosum [potatoes]
ref|NP_173423.1|  glycosyl hydrolase 9B5                                225   6e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   225   7e-66   Cicer arietinum [garbanzo]
ref|XP_007156152.1|  hypothetical protein PHAVU_003G262600g             224   2e-65   Phaseolus vulgaris [French bean]
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         223   5e-65   Brassica rapa
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             222   1e-64   
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 222   1e-64   Populus trichocarpa [western balsam poplar]
gb|KDO84821.1|  hypothetical protein CISIN_1g036398mg                   219   2e-63   Citrus sinensis [apfelsine]
ref|XP_006435158.1|  hypothetical protein CICLE_v10003402mg             217   3e-63   
ref|XP_006656489.1|  PREDICTED: endoglucanase 18-like                   218   5e-63   Oryza brachyantha
gb|KHN00484.1|  Endoglucanase 24                                        216   1e-62   Glycine soja [wild soybean]
ref|XP_003563568.1|  PREDICTED: endoglucanase 18-like                   216   1e-62   Brachypodium distachyon [annual false brome]
gb|EAZ02358.1|  hypothetical protein OsI_24462                          215   5e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001058583.1|  Os06g0715300                                       214   8e-62   
gb|ABE02649.1|  putative glucanase/cellulase                            201   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04397.1|  predicted protein                                      211   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006829372.1|  hypothetical protein AMTR_s02175p00005920          201   1e-59   
ref|XP_010530451.1|  PREDICTED: endoglucanase 2-like                    207   3e-59   
emb|CDY44194.1|  BnaC05g15510D                                          213   5e-59   Brassica napus [oilseed rape]
ref|XP_002439027.1|  hypothetical protein SORBIDRAFT_10g030140          204   6e-58   Sorghum bicolor [broomcorn]
ref|XP_004966453.1|  PREDICTED: endoglucanase 18-like                   204   8e-58   Setaria italica
ref|NP_001288527.1|  uncharacterized protein LOC103626453 precursor     204   1e-57   Zea mays [maize]
gb|KHN45917.1|  Endoglucanase 2                                         197   4e-55   Glycine soja [wild soybean]
gb|ABK24648.1|  unknown                                                 196   8e-55   Picea sitchensis
gb|EMT32027.1|  Endoglucanase 24                                        192   1e-53   
gb|KHN21266.1|  Endoglucanase 24                                        179   4e-52   Glycine soja [wild soybean]
gb|EMS54236.1|  Endoglucanase 18                                        186   2e-51   Triticum urartu
ref|XP_002961546.1|  hypothetical protein SELMODRAFT_77612              187   4e-51   
ref|XP_002971269.1|  hypothetical protein SELMODRAFT_94888              186   4e-51   
gb|KJB58119.1|  hypothetical protein B456_009G195400                    177   2e-48   Gossypium raimondii
ref|XP_002978046.1|  hypothetical protein SELMODRAFT_417952             174   2e-46   Selaginella moellendorffii
gb|ACC63522.1|  putative glucanase/cellulase                            161   4e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006294088.1|  hypothetical protein CARUB_v10023082mg             168   9e-45   Capsella rubella
ref|XP_002966695.1|  hypothetical protein SELMODRAFT_144066             167   1e-44   
ref|XP_006843620.1|  hypothetical protein AMTR_s00007p00146230          161   1e-44   
ref|XP_006413937.1|  hypothetical protein EUTSA_v10027553mg             167   2e-44   
emb|CDY47674.1|  BnaC04g03850D                                          167   3e-44   Brassica napus [oilseed rape]
emb|CDX74668.1|  BnaA05g04140D                                          166   4e-44   
ref|XP_009143046.1|  PREDICTED: endoglucanase 14-like                   166   4e-44   Brassica rapa
ref|NP_181984.1|  glycosyl hydrolase 9B11                               166   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006840110.1|  hypothetical protein AMTR_s00224p00022980          156   6e-44   
ref|XP_002881965.1|  glycosyl hydrolase family 9 protein                166   8e-44   
ref|XP_001772307.1|  predicted protein                                  167   1e-43   
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    164   2e-43   Sesamum indicum [beniseed]
emb|CDP12150.1|  unnamed protein product                                165   3e-43   Coffea canephora [robusta coffee]
gb|EAZ38281.1|  hypothetical protein OsJ_22659                          164   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006343864.1|  PREDICTED: endoglucanase 6-like                    165   6e-43   Solanum tuberosum [potatoes]
ref|XP_010508282.1|  PREDICTED: endoglucanase 15-like                   163   6e-43   Camelina sativa [gold-of-pleasure]
dbj|BAF01119.1|  putative glucanase                                     162   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881964.1|  glycosyl hydrolase family 9 protein                163   6e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_002509954.1|  endo-1,4-beta-glucanase, putative                  157   6e-43   
gb|ABR10607.1|  endo-beta-1,4-glucanase                                 164   7e-43   Mangifera indica
ref|NP_001234172.1|  endo-beta-1,4-D-glucanase precursor                164   8e-43   Solanum lycopersicum
emb|CDX74666.1|  BnaA05g04120D                                          163   8e-43   
ref|XP_009143044.1|  PREDICTED: endoglucanase 12-like                   163   9e-43   Brassica rapa
gb|KDO76513.1|  hypothetical protein CISIN_1g006835mg                   163   1e-42   Citrus sinensis [apfelsine]
ref|XP_008232281.1|  PREDICTED: endoglucanase 14-like                   158   1e-42   Prunus mume [ume]
gb|EEE56313.1|  hypothetical protein OsJ_05399                          159   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|KDO76512.1|  hypothetical protein CISIN_1g006835mg                   163   2e-42   Citrus sinensis [apfelsine]
ref|XP_006439358.1|  hypothetical protein CICLE_v10019301mg             163   2e-42   Citrus clementina [clementine]
ref|XP_002269618.1|  PREDICTED: endoglucanase 14-like                   162   2e-42   Vitis vinifera
emb|CBI25463.3|  unnamed protein product                                162   2e-42   Vitis vinifera
gb|KEH21214.1|  endo-1,4-beta-glucanase                                 162   2e-42   Medicago truncatula
ref|XP_010230628.1|  PREDICTED: endoglucanase 2-like isoform X3         163   2e-42   
ref|XP_010230629.1|  PREDICTED: endoglucanase 2-like isoform X4         163   2e-42   
ref|XP_003565659.1|  PREDICTED: endoglucanase 2-like isoform X2         163   2e-42   
ref|XP_010230627.1|  PREDICTED: endoglucanase 2-like isoform X1         163   2e-42   
ref|XP_009626013.1|  PREDICTED: endoglucanase 6-like                    163   3e-42   Nicotiana tomentosiformis
ref|XP_009601304.1|  PREDICTED: endoglucanase 6                         163   3e-42   Nicotiana tomentosiformis
ref|XP_004503629.1|  PREDICTED: endoglucanase 6-like                    163   3e-42   Cicer arietinum [garbanzo]
gb|AAL30454.1|AF362949_1  endo-beta-1,4-glucanase precursor             162   3e-42   Nicotiana tabacum [American tobacco]
ref|XP_010943262.1|  PREDICTED: endoglucanase 11-like                   162   3e-42   Elaeis guineensis
gb|EYU23364.1|  hypothetical protein MIMGU_mgv1a004112mg                162   3e-42   Erythranthe guttata [common monkey flower]
ref|NP_181985.1|  glycosyl hydrolase 9B12                               161   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850530.1|  hypothetical protein AMTR_s00159p00033510          162   3e-42   Amborella trichopoda
ref|XP_010512853.1|  PREDICTED: endoglucanase 14                        161   3e-42   Camelina sativa [gold-of-pleasure]
emb|CDX74667.1|  BnaA05g04130D                                          160   4e-42   
gb|KEH21213.1|  endo-1,4-beta-glucanase                                 162   4e-42   Medicago truncatula
ref|XP_008812558.1|  PREDICTED: endoglucanase 19-like                   162   4e-42   Phoenix dactylifera
ref|XP_006643916.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    162   4e-42   
ref|XP_006476392.1|  PREDICTED: endoglucanase 6-like                    162   5e-42   Citrus sinensis [apfelsine]
ref|NP_001289239.1|  endoglucanase 6-like precursor                     162   6e-42   Pyrus x bretschneideri [bai li]
gb|KCW72408.1|  hypothetical protein EUGRSUZ_E00858                     161   6e-42   Eucalyptus grandis [rose gum]
ref|XP_009358597.1|  PREDICTED: endoglucanase 6-like                    162   6e-42   Pyrus x bretschneideri [bai li]
ref|XP_010314503.1|  PREDICTED: endoglucanase 6-like                    162   6e-42   Solanum lycopersicum
ref|XP_008374318.1|  PREDICTED: endoglucanase 6-like                    162   7e-42   
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg                160   7e-42   Erythranthe guttata [common monkey flower]
emb|CDX74664.1|  BnaA05g04100D                                          160   8e-42   
gb|KFK37261.1|  hypothetical protein AALP_AA4G234600                    162   8e-42   Arabis alpina [alpine rockcress]
ref|XP_009797971.1|  PREDICTED: endoglucanase 6-like isoform X2         161   9e-42   Nicotiana sylvestris
ref|XP_009143042.1|  PREDICTED: endoglucanase 14-like                   160   9e-42   Brassica rapa
ref|XP_002454930.1|  hypothetical protein SORBIDRAFT_03g001560          161   9e-42   Sorghum bicolor [broomcorn]
ref|XP_003525345.1|  PREDICTED: endoglucanase 6                         161   9e-42   Glycine max [soybeans]
gb|ACT54546.1|  endo-1,4-beta-glucanase                                 160   9e-42   Dimocarpus longan [longan]
dbj|BAC22691.1|  endo-1,4-beta-D-glucanase                              161   9e-42   Pyrus communis
ref|XP_010413050.1|  PREDICTED: endoglucanase 14-like                   160   9e-42   
emb|CDY47675.1|  BnaC04g03840D                                          160   9e-42   Brassica napus [oilseed rape]
ref|XP_010452662.1|  PREDICTED: endoglucanase 15-like                   160   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010055859.1|  PREDICTED: endoglucanase 6-like                    161   1e-41   Eucalyptus grandis [rose gum]
ref|XP_010266498.1|  PREDICTED: endoglucanase 19                        161   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008655784.1|  PREDICTED: endoglucanase 2-like isoform X2         161   1e-41   Zea mays [maize]
ref|XP_009797970.1|  PREDICTED: endoglucanase 6-like isoform X1         161   1e-41   Nicotiana sylvestris
gb|ABC94542.1|  endo-1,4-beta-glucanase                                 161   1e-41   Glycine max [soybeans]
ref|XP_008341511.1|  PREDICTED: endoglucanase 6                         161   1e-41   Malus domestica [apple tree]
ref|NP_001288408.1|  endoglucanase 2-like precursor                     161   1e-41   Zea mays [maize]
ref|XP_007220712.1|  hypothetical protein PRUPE_ppa021556mg             159   1e-41   
ref|XP_009346446.1|  PREDICTED: endoglucanase 6-like                    161   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_008655783.1|  PREDICTED: endoglucanase 2-like isoform X1         161   1e-41   Zea mays [maize]
ref|XP_011101037.1|  PREDICTED: endoglucanase 6                         160   2e-41   Sesamum indicum [beniseed]
ref|XP_010913688.1|  PREDICTED: endoglucanase 6                         160   2e-41   Elaeis guineensis
ref|XP_009764063.1|  PREDICTED: endoglucanase 6-like                    160   2e-41   Nicotiana sylvestris
ref|XP_007160157.1|  hypothetical protein PHAVU_002G297600g             160   2e-41   Phaseolus vulgaris [French bean]
ref|XP_003566424.1|  PREDICTED: endoglucanase 15-like isoform X1        160   2e-41   Brachypodium distachyon [annual false brome]
ref|XP_010231596.1|  PREDICTED: endoglucanase 15-like isoform X2        160   2e-41   
ref|NP_181982.1|  glycosyl hydrolase 9B9                                159   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530388.1|  PREDICTED: endoglucanase 6-like                    160   2e-41   
gb|KHN16746.1|  Endoglucanase 6                                         160   2e-41   Glycine soja [wild soybean]
ref|XP_008232258.1|  PREDICTED: endoglucanase 14-like                   159   2e-41   Prunus mume [ume]
ref|XP_006360711.1|  PREDICTED: endoglucanase 6-like                    160   2e-41   
ref|XP_006397635.1|  hypothetical protein EUTSA_v10001734mg             159   2e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010915660.1|  PREDICTED: endoglucanase 19-like                   160   2e-41   Elaeis guineensis
ref|XP_004149748.1|  PREDICTED: endoglucanase 6-like                    160   2e-41   Cucumis sativus [cucumbers]
ref|XP_008239042.1|  PREDICTED: endoglucanase 6                         160   2e-41   Prunus mume [ume]
gb|EMT23865.1|  hypothetical protein F775_52481                         159   2e-41   
ref|XP_006648310.1|  PREDICTED: endoglucanase 5-like                    160   3e-41   Oryza brachyantha
ref|XP_002881963.1|  glycosyl hydrolase family 9 protein                159   3e-41   Arabidopsis lyrata subsp. lyrata
gb|EAY84498.1|  hypothetical protein OsI_05874                          156   3e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_181983.1|  glycosyl hydrolase 9B10                               159   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005905.1|  PREDICTED: endoglucanase 11-like                   155   3e-41   Populus euphratica
ref|XP_010096825.1|  Endoglucanase 6                                    159   3e-41   
ref|XP_008783846.1|  PREDICTED: endoglucanase 19-like                   160   3e-41   Phoenix dactylifera
ref|XP_002301602.1|  glycosyl hydrolase family 9 family protein         155   3e-41   
ref|NP_001042423.1|  Os01g0220100                                       160   3e-41   
gb|EAY73052.1|  hypothetical protein OsI_00928                          160   3e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_002440792.1|  hypothetical protein SORBIDRAFT_09g006670          159   4e-41   Sorghum bicolor [broomcorn]
ref|XP_008791427.1|  PREDICTED: endoglucanase 6                         159   4e-41   Phoenix dactylifera
ref|XP_002270880.1|  PREDICTED: endoglucanase 6                         159   4e-41   Vitis vinifera
emb|CAI68020.1|  endo-beta-1,4-glucanase                                159   4e-41   Prunus persica
ref|XP_007210281.1|  hypothetical protein PRUPE_ppa002939mg             159   4e-41   Prunus persica
dbj|BAJ96589.1|  predicted protein                                      159   5e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI25462.3|  unnamed protein product                                158   5e-41   Vitis vinifera
gb|AAC12685.1|  endo-beta-1,4-glucanase                                 158   5e-41   Pinus radiata
ref|XP_006298937.1|  hypothetical protein CARUB_v10015060mg             158   6e-41   
ref|XP_002272408.1|  PREDICTED: endoglucanase 13                        158   6e-41   Vitis vinifera
ref|XP_008655181.1|  PREDICTED: uncharacterized protein LOC100381...    159   6e-41   Zea mays [maize]
gb|EAY96964.1|  hypothetical protein OsI_18884                          159   7e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_011026902.1|  PREDICTED: endoglucanase 6-like                    159   7e-41   Populus euphratica
gb|AEO97204.1|  endo-1,4-beta-glucanase                                 158   7e-41   Populus trichocarpa [western balsam poplar]
gb|AID55382.1|  glycoside hydrolase family 9 C4                         159   7e-41   Gossypium hirsutum [American cotton]
ref|XP_002321149.2|  hypothetical protein POPTR_0014s15590g             158   7e-41   Populus trichocarpa [western balsam poplar]
dbj|BAJ98062.1|  predicted protein                                      156   7e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010506383.1|  PREDICTED: endoglucanase 15-like                   157   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011047209.1|  PREDICTED: endoglucanase 11-like                   158   8e-41   Populus euphratica
emb|CDY47849.1|  BnaA09g12280D                                          159   8e-41   Brassica napus [oilseed rape]
ref|NP_001045907.1|  Os02g0151300                                       158   8e-41   
emb|CDY46529.1|  BnaC09g11040D                                          159   8e-41   Brassica napus [oilseed rape]
gb|AFZ78643.1|  korrigan                                                158   9e-41   Populus tomentosa [Chinese white poplar]
ref|XP_009112877.1|  PREDICTED: endoglucanase 6-like                    158   1e-40   Brassica rapa
ref|XP_006643915.1|  PREDICTED: endoglucanase 1-like                    158   1e-40   
ref|XP_006391621.1|  hypothetical protein EUTSA_v10023353mg             158   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_009112832.1|  PREDICTED: endoglucanase 6                         158   1e-40   Brassica rapa
ref|XP_006654154.1|  PREDICTED: endoglucanase 15-like                   158   1e-40   Oryza brachyantha
emb|CDY34422.1|  BnaA09g11640D                                          158   1e-40   Brassica napus [oilseed rape]
ref|XP_008451938.1|  PREDICTED: endoglucanase 6-like                    158   1e-40   Cucumis melo [Oriental melon]
ref|NP_001054920.1|  Os05g0212300                                       158   1e-40   
gb|AHB32109.1|  endoglucanase 6-like protein                            158   1e-40   
ref|XP_004298897.1|  PREDICTED: endoglucanase 6                         158   1e-40   
emb|CAC94006.1|  endo-beta-1,4-glucanase                                158   2e-40   
gb|AAC78298.2|  cellulase                                               157   2e-40   
emb|CAB43938.1|  endo-beta-1,4-glucanase                                157   2e-40   
ref|XP_008803527.1|  PREDICTED: endoglucanase 11-like                   157   2e-40   
ref|XP_008366122.1|  PREDICTED: endoglucanase 14-like                   157   2e-40   
ref|XP_007163509.1|  hypothetical protein PHAVU_001G239900g             157   2e-40   
ref|XP_008448558.1|  PREDICTED: endoglucanase CX-like                   156   2e-40   
ref|XP_010261581.1|  PREDICTED: endoglucanase 19-like                   157   2e-40   
ref|XP_010418504.1|  PREDICTED: endoglucanase 6 isoform X1              157   2e-40   
ref|XP_010473704.1|  PREDICTED: endoglucanase 6                         157   2e-40   
gb|AEO97206.1|  endo-1,4-beta-glucanase                                 157   2e-40   
ref|XP_002299478.2|  endo-glucanase 2 family protein                    157   2e-40   
ref|XP_010231597.1|  PREDICTED: endoglucanase 15-like isoform X3        157   2e-40   
ref|XP_010231599.1|  PREDICTED: endoglucanase 15-like isoform X5        157   2e-40   
ref|XP_010676302.1|  PREDICTED: endoglucanase 6                         157   2e-40   
ref|NP_001042421.1|  Os01g0219600                                       157   2e-40   
ref|XP_010231598.1|  PREDICTED: endoglucanase 15-like isoform X4        157   3e-40   
ref|XP_009607784.1|  PREDICTED: endoglucanase 12-like                   156   3e-40   
dbj|BAJ92316.1|  predicted protein                                      156   3e-40   
gb|EAY73050.1|  hypothetical protein OsI_00924                          157   3e-40   
gb|KEH40907.1|  glycosyl hydrolase family 9 protein                     156   3e-40   
gb|KJB24218.1|  hypothetical protein B456_004G133700                    156   3e-40   
ref|XP_004168441.1|  PREDICTED: endoglucanase 13-like                   156   3e-40   
ref|XP_009394546.1|  PREDICTED: endoglucanase 7-like                    156   3e-40   
gb|KCW73253.1|  hypothetical protein EUGRSUZ_E01715                     155   3e-40   
gb|KFK33689.1|  hypothetical protein AALP_AA5G047000                    157   3e-40   
ref|XP_009365104.1|  PREDICTED: endoglucanase 11 isoform X2             152   3e-40   
gb|EMT28624.1|  Endoglucanase 5                                         156   3e-40   
ref|XP_004146136.1|  PREDICTED: endoglucanase 1-like                    155   3e-40   
ref|XP_010058567.1|  PREDICTED: endoglucanase 13-like                   155   3e-40   
ref|XP_009396277.1|  PREDICTED: endoglucanase 7-like                    156   4e-40   
ref|XP_004960623.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    157   4e-40   
ref|XP_008379667.1|  PREDICTED: endoglucanase 11-like isoform X3        152   5e-40   
gb|KJB24219.1|  hypothetical protein B456_004G133700                    156   5e-40   
gb|EYU20028.1|  hypothetical protein MIMGU_mgv1a025805mg                155   5e-40   
gb|KCW73256.1|  hypothetical protein EUGRSUZ_E01717                     155   5e-40   
ref|XP_009408428.1|  PREDICTED: endoglucanase 7-like isoform X1         155   6e-40   
ref|XP_004159715.1|  PREDICTED: endoglucanase 1-like                    155   6e-40   
gb|KJB24217.1|  hypothetical protein B456_004G133700                    156   6e-40   
gb|KGN46280.1|  hypothetical protein Csa_6G079740                       155   6e-40   
ref|XP_010430574.1|  PREDICTED: endoglucanase 6-like                    156   6e-40   
ref|XP_002887890.1|  hypothetical protein ARALYDRAFT_892975             156   6e-40   
ref|XP_010058568.1|  PREDICTED: endoglucanase 14-like                   155   6e-40   
ref|XP_004153697.1|  PREDICTED: endoglucanase 12-like                   155   6e-40   
ref|XP_006837249.1|  hypothetical protein AMTR_s00112p00047400          155   7e-40   
ref|XP_009376856.1|  PREDICTED: endoglucanase 14-like                   155   7e-40   
ref|NP_176621.1|  glycosyl hydrolase 9C2                                156   7e-40   
gb|EPS69947.1|  hypothetical protein M569_04812                         155   7e-40   
gb|AAD28258.1|AF128404_1  cellulase homolog                             155   7e-40   
gb|AAN31840.1|  putative endo-beta-1,4-glucanase                        156   7e-40   
ref|XP_002975769.1|  hypothetical protein SELMODRAFT_232575             155   7e-40   
gb|KJB19011.1|  hypothetical protein B456_003G080800                    155   7e-40   
ref|XP_006357959.1|  PREDICTED: endoglucanase 11-like                   155   8e-40   
dbj|BAK06306.1|  predicted protein                                      155   8e-40   
gb|EMT25272.1|  Endoglucanase 2                                         155   8e-40   
ref|XP_008379666.1|  PREDICTED: endoglucanase 11-like isoform X2        152   8e-40   
gb|EEE62738.1|  hypothetical protein OsJ_17541                          158   9e-40   
ref|XP_006836843.1|  hypothetical protein AMTR_s00099p00071120          154   9e-40   
ref|XP_010681760.1|  PREDICTED: endoglucanase 11-like                   155   1e-39   
ref|XP_006300890.1|  hypothetical protein CARUB_v10019981mg             155   1e-39   
gb|KJB19012.1|  hypothetical protein B456_003G080800                    155   1e-39   
ref|XP_010666165.1|  PREDICTED: endoglucanase 14-like                   154   1e-39   
gb|KJB19013.1|  hypothetical protein B456_003G080800                    155   1e-39   
ref|XP_009771552.1|  PREDICTED: endoglucanase 13-like                   154   1e-39   
gb|KJB08652.1|  hypothetical protein B456_001G095700                    154   1e-39   
ref|XP_008799328.1|  PREDICTED: endoglucanase 11-like isoform X2        155   1e-39   
gb|AID55378.1|  glycoside hydrolase family 9 B9                         154   1e-39   
ref|XP_009589429.1|  PREDICTED: endoglucanase 11-like                   154   1e-39   
gb|KHG21954.1|  hypothetical protein F383_28246                         154   1e-39   
gb|AID55384.1|  glycoside hydrolase family 9 B11                        154   1e-39   
gb|KHN34290.1|  Endoglucanase 24                                        154   2e-39   
ref|XP_004967499.1|  PREDICTED: endoglucanase 2-like                    155   2e-39   
gb|KJB19010.1|  hypothetical protein B456_003G080800                    155   2e-39   
gb|EPS71030.1|  hypothetical protein M569_03731                         155   2e-39   
ref|XP_008799319.1|  PREDICTED: endoglucanase 11-like isoform X1        154   2e-39   
gb|AFZ78636.1|  korrigan                                                154   2e-39   
gb|AEO97202.1|  endo-1,4-beta-glucanase                                 154   2e-39   
ref|XP_011022406.1|  PREDICTED: endoglucanase 1-like isoform X2         154   2e-39   
ref|XP_010469521.1|  PREDICTED: endoglucanase 11-like                   154   2e-39   
ref|XP_007040506.1|  Glycosyl hydrolase 9C2                             154   2e-39   
ref|XP_002303645.1|  endo-glucanase 2 family protein                    154   3e-39   
ref|XP_010413920.1|  PREDICTED: endoglucanase 11                        154   3e-39   
gb|KJB42852.1|  hypothetical protein B456_007G170600                    154   3e-39   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    153   3e-39   
ref|XP_004304093.1|  PREDICTED: endoglucanase 11                        154   3e-39   
ref|XP_010509938.1|  PREDICTED: endoglucanase 11-like isoform X3        154   3e-39   
ref|XP_007153086.1|  hypothetical protein PHAVU_003G005700g             153   3e-39   
ref|XP_002299423.1|  hypothetical protein POPTR_0001s11430g             153   3e-39   
ref|XP_010509936.1|  PREDICTED: endoglucanase 11-like isoform X1        154   3e-39   
ref|XP_006843623.1|  hypothetical protein AMTR_s00007p00147280          147   3e-39   
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                            153   3e-39   
ref|XP_011022404.1|  PREDICTED: endoglucanase 1-like isoform X1         154   3e-39   
ref|XP_003556604.1|  PREDICTED: endoglucanase 12-like                   153   3e-39   
gb|ABK24281.1|  unknown                                                 153   3e-39   
ref|XP_011074347.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    154   3e-39   
gb|KJB52283.1|  hypothetical protein B456_008G254000                    154   3e-39   
gb|KHG13636.1|  hypothetical protein F383_04399                         154   3e-39   
ref|XP_001759537.1|  predicted protein                                  154   3e-39   
ref|XP_002973718.1|  hypothetical protein SELMODRAFT_99802              154   3e-39   
ref|XP_002131623.1|  PREDICTED: endoglucanase 22                        156   3e-39   
ref|XP_004951878.1|  PREDICTED: endoglucanase 5-like isoform X2         153   3e-39   
ref|XP_006293986.1|  hypothetical protein CARUB_v10022977mg             153   3e-39   
ref|XP_011022506.1|  PREDICTED: endoglucanase 6                         154   4e-39   
ref|XP_004951877.1|  PREDICTED: endoglucanase 5-like isoform X1         153   4e-39   
gb|KJB52282.1|  hypothetical protein B456_008G254000                    154   4e-39   
ref|XP_004143869.1|  PREDICTED: endoglucanase 6-like                    154   4e-39   
ref|XP_004298838.1|  PREDICTED: endoglucanase 20-like                   153   4e-39   
ref|XP_006343479.1|  PREDICTED: endoglucanase 3-like                    152   4e-39   
gb|KHG00538.1|  hypothetical protein F383_16609                         154   4e-39   
gb|AID55373.1|  glycoside hydrolase family 9 C2                         154   4e-39   
ref|XP_010094077.1|  Endoglucanase 13                                   152   4e-39   
ref|XP_006826915.1|  hypothetical protein AMTR_s00010p00165730          152   4e-39   
emb|CDY19428.1|  BnaC04g11710D                                          153   5e-39   
ref|NP_001234323.1|  endo-1,4-beta-D-glucanase precursor                152   5e-39   
ref|XP_008437388.1|  PREDICTED: endoglucanase 6-like isoform X1         154   5e-39   
ref|XP_001774444.1|  predicted protein                                  154   5e-39   
ref|XP_004308724.1|  PREDICTED: endoglucanase 14-like                   152   5e-39   
ref|XP_010053128.1|  PREDICTED: endoglucanase 6-like                    153   6e-39   
ref|XP_010913407.1|  PREDICTED: endoglucanase 11                        153   6e-39   
ref|XP_002738470.1|  PREDICTED: endoglucanase 19-like                   153   6e-39   
ref|XP_011026779.1|  PREDICTED: endoglucanase CX-like                   152   6e-39   
ref|XP_008342129.1|  PREDICTED: endoglucanase 11-like                   152   6e-39   
ref|XP_009396636.1|  PREDICTED: endoglucanase 6-like                    153   6e-39   
ref|XP_010541571.1|  PREDICTED: endoglucanase 19                        153   7e-39   
ref|XP_010533581.1|  PREDICTED: endoglucanase 6                         153   7e-39   
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg                152   7e-39   
dbj|BAA06877.1|  cellulase precursor                                    152   7e-39   
ref|XP_006375102.1|  hypothetical protein POPTR_0014s04390g             145   7e-39   
gb|KDP30800.1|  hypothetical protein JCGZ_13743                         152   8e-39   
gb|KHG28140.1|  hypothetical protein F383_15365                         152   8e-39   
dbj|BAA77239.1|  endo-1,4-beta glucanase                                152   8e-39   
emb|CDY23776.1|  BnaC04g43460D                                          152   8e-39   
ref|NP_180858.1|  glycosyl hydrolase 9B8                                152   8e-39   
emb|CDX83426.1|  BnaA03g20800D                                          152   8e-39   
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                   153   8e-39   
ref|XP_004243521.1|  PREDICTED: endoglucanase 11                        152   9e-39   
ref|XP_009133676.1|  PREDICTED: endoglucanase 15-like                   152   9e-39   
ref|XP_009784759.1|  PREDICTED: endoglucanase CX-like                   152   9e-39   
ref|XP_002862860.1|  predicted protein                                  152   9e-39   
gb|AAN04496.2|  endo-1,4-beta-glucanase                                 152   9e-39   
ref|XP_008379665.1|  PREDICTED: endoglucanase 11-like isoform X1        152   9e-39   
ref|XP_007215908.1|  hypothetical protein PRUPE_ppa004172mg             152   1e-38   
ref|XP_009365103.1|  PREDICTED: endoglucanase 11 isoform X1             152   1e-38   
gb|EEC78672.1|  hypothetical protein OsI_18802                          152   1e-38   
ref|XP_006410437.1|  hypothetical protein EUTSA_v10016495mg             152   1e-38   
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                   152   1e-38   
emb|CDY17123.1|  BnaA05g10650D                                          152   1e-38   
dbj|BAL41418.1|  endo-1,4-beta-glucanase                                152   1e-38   
ref|XP_009143907.1|  PREDICTED: endoglucanase 11                        152   1e-38   
ref|XP_010244161.1|  PREDICTED: endoglucanase 11-like                   152   1e-38   
ref|XP_009137168.1|  PREDICTED: endoglucanase 20                        151   1e-38   
ref|XP_009625038.1|  PREDICTED: endoglucanase 1-like                    152   1e-38   
ref|XP_002879427.1|  glycosyl hydrolase family 9 protein                152   1e-38   
dbj|BAA85150.1|  endo-1,4-beta-glucanase                                152   1e-38   
gb|AFZ78635.1|  korrigan                                                151   1e-38   
ref|XP_004240228.2|  PREDICTED: endoglucanase 13-like                   151   1e-38   
emb|CDY19174.1|  BnaA04g19140D                                          152   1e-38   
sp|P05522.1|GUN1_PERAE  RecName: Full=Endoglucanase 1; AltName: F...    151   1e-38   
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                   151   1e-38   
ref|XP_010100207.1|  Endoglucanase 1                                    151   1e-38   
gb|KHN07637.1|  Endoglucanase 1                                         151   2e-38   
ref|XP_003552557.1|  PREDICTED: endoglucanase 1                         151   2e-38   
ref|XP_002525326.1|  endo-1,4-beta-glucanase, putative                  151   2e-38   
emb|CDX95605.1|  BnaC03g24860D                                          151   2e-38   
gb|AAL30452.1|AF362947_1  endo-beta-1,4-glucanase precursor             151   2e-38   
ref|XP_010928420.1|  PREDICTED: endoglucanase 11-like isoform X1        151   2e-38   
emb|CDY10895.1|  BnaC01g15100D                                          151   2e-38   
ref|XP_009603927.1|  PREDICTED: endoglucanase 9-like                    151   2e-38   
ref|XP_008239259.1|  PREDICTED: endoglucanase CX                        151   2e-38   
ref|XP_008230008.1|  PREDICTED: endoglucanase 11                        151   2e-38   
ref|XP_001781646.1|  predicted protein                                  150   2e-38   
gb|EAZ06862.1|  hypothetical protein OsI_29098                          151   2e-38   
gb|KCW66948.1|  hypothetical protein EUGRSUZ_F00710                     151   2e-38   
gb|ACU23374.1|  unknown                                                 145   2e-38   
gb|EAZ42601.1|  hypothetical protein OsJ_27165                          151   2e-38   
ref|NP_001061713.1|  Os08g0387400                                       151   2e-38   
gb|KFK31096.1|  hypothetical protein AALP_AA6G067600                    151   2e-38   
dbj|BAB39482.1|  endo-1,4-beta glucanase                                151   2e-38   
ref|XP_006447630.1|  hypothetical protein CICLE_v10014884mg             151   2e-38   
ref|XP_008389952.1|  PREDICTED: endoglucanase 15-like                   150   2e-38   
ref|XP_010060286.1|  PREDICTED: endoglucanase 11-like                   151   2e-38   
ref|XP_009802592.1|  PREDICTED: endoglucanase 11-like                   151   2e-38   
ref|XP_011097842.1|  PREDICTED: endoglucanase 11-like                   151   2e-38   
ref|XP_006285075.1|  hypothetical protein CARUB_v10006388mg             150   3e-38   
ref|XP_003574795.1|  PREDICTED: endoglucanase 5-like                    151   3e-38   
gb|KGN56104.1|  hypothetical protein Csa_3G073940                       150   3e-38   
ref|XP_004149358.1|  PREDICTED: endoglucanase 11-like                   150   3e-38   
gb|EMT30441.1|  Endoglucanase 13                                        150   3e-38   
ref|XP_009382522.1|  PREDICTED: endoglucanase 3-like isoform X1         150   3e-38   
ref|XP_002447897.1|  hypothetical protein SORBIDRAFT_06g017600          150   3e-38   
gb|KFK42632.1|  hypothetical protein AALP_AA1G020500                    150   3e-38   
ref|XP_009141285.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    150   3e-38   
ref|XP_010424527.1|  PREDICTED: endoglucanase 19-like                   150   4e-38   
ref|XP_006286136.1|  hypothetical protein CARUB_v10007690mg             150   4e-38   
ref|XP_009788927.1|  PREDICTED: endoglucanase 3-like                    150   5e-38   
dbj|BAJ98829.1|  predicted protein                                      150   5e-38   
emb|CDY05130.1|  BnaC03g29280D                                          150   5e-38   
ref|XP_008644160.1|  PREDICTED: uncharacterized protein LOC100384...    150   5e-38   
ref|XP_010544547.1|  PREDICTED: endoglucanase 14-like                   150   5e-38   
ref|WP_026418585.1|  glycosyl hydrolase family 9                        150   5e-38   
ref|XP_001755693.1|  predicted protein                                  149   5e-38   
ref|XP_006396968.1|  hypothetical protein EUTSA_v10028514mg             150   5e-38   
ref|XP_004143969.1|  PREDICTED: endoglucanase-like                      150   5e-38   
gb|KHG04285.1|  Endoglucanase 1                                         149   6e-38   
gb|AID55372.1|  glycoside hydrolase family 9 B13                        149   6e-38   
ref|XP_009134219.1|  PREDICTED: endoglucanase 19 isoform X2             150   6e-38   
ref|XP_009134218.1|  PREDICTED: endoglucanase 19 isoform X1             150   6e-38   
ref|XP_006355746.1|  PREDICTED: endoglucanase 14-like                   149   6e-38   
emb|CDX90780.1|  BnaA03g24600D                                          150   6e-38   
ref|XP_007145197.1|  hypothetical protein PHAVU_007G218400g             150   6e-38   
ref|XP_004498113.1|  PREDICTED: endoglucanase 14-like                   149   6e-38   
ref|XP_007039376.1|  Endoglucanase 1                                    149   7e-38   
ref|XP_006286846.1|  hypothetical protein CARUB_v10003874mg             150   7e-38   
emb|CDP12234.1|  unnamed protein product                                149   7e-38   
ref|XP_010455501.1|  PREDICTED: endoglucanase 19-like isoform X2        150   8e-38   
ref|XP_010271485.1|  PREDICTED: endoglucanase 23-like                   149   8e-38   
ref|XP_010455500.1|  PREDICTED: endoglucanase 19-like isoform X1        150   8e-38   
ref|XP_010503056.1|  PREDICTED: endoglucanase 16-like                   149   8e-38   



>ref|XP_009783020.1| PREDICTED: endoglucanase 2 [Nicotiana sylvestris]
Length=525

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 172/201 (86%), Gaps = 4/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSR KGGWCGW++V+IV AA   +I VLVKKKH G   S PDAAPVPGPPG+ T+KY
Sbjct  1    MGEKSR-KGGWCGWIIVLIVVAAAAGAIVVLVKKKHNG---SSPDAAPVPGPPGSPTKKY  56

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK AMQFFDVQKSGKLV+NKISWRGDS +KDG  A LDLSKGMYDAGD MKFGFPMA
Sbjct  57   ADALKTAMQFFDVQKSGKLVNNKISWRGDSAVKDGSPAKLDLSKGMYDAGDHMKFGFPMA  116

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            YTATVL+W ILEYGDQM VV QLEPA+ SLKWITDYL+NAHP DNVLYIQVGDPD DHKC
Sbjct  117  YTATVLSWAILEYGDQMKVVDQLEPAQDSLKWITDYLINAHPKDNVLYIQVGDPDADHKC  176

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTE RPL  INASVP
Sbjct  177  WDRPEDMTEERPLIQINASVP  197



>ref|XP_009610927.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=525

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 172/201 (86%), Gaps = 4/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSR KGGWCGW++V+IV AA   +I VLVKKKH G   S PDAAPVPGPPG+ T+KY
Sbjct  1    MGEKSR-KGGWCGWIIVLIVVAAAAGAIVVLVKKKHNG---SSPDAAPVPGPPGSPTKKY  56

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK AMQFFDVQKSGKLV+NKISWRGDS +KDG  A +DLSKGMYDAGD MKFGFPMA
Sbjct  57   ADALKTAMQFFDVQKSGKLVNNKISWRGDSAVKDGSQAKVDLSKGMYDAGDHMKFGFPMA  116

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            YTATVL+W ILEYGDQM VV QLEPA+ SLKWITDYL+NAHP DNVLYIQVGDPD DHKC
Sbjct  117  YTATVLSWAILEYGDQMKVVDQLEPAEDSLKWITDYLINAHPKDNVLYIQVGDPDADHKC  176

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTE RPL  INASVP
Sbjct  177  WDRPEDMTEERPLIQINASVP  197



>emb|CDP07412.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 167/201 (83%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSRSKGGWCGWLLV+IVAAAI   IFV +KKKH    +S+ +AAPVPGPPGAVT+KY
Sbjct  1    MGEKSRSKGGWCGWLLVLIVAAAIAFGIFVTIKKKHH---ASKGEAAPVPGPPGAVTKKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DAL  AMQF DVQKSGKLV NKI WRGDS L DG  A +DLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALHAAMQFLDVQKSGKLVHNKIPWRGDSALDDGSPAKVDLSKGMYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            YTATVL+W+ILEYGDQM VV QLEPA+ SL+WITDYLVNAH  DNVL IQVGDPD DHKC
Sbjct  118  YTATVLSWSILEYGDQMKVVNQLEPAQDSLRWITDYLVNAHLSDNVLIIQVGDPDADHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTE RPL  +N S P
Sbjct  178  WDRPEDMTEKRPLIQVNTSFP  198



>gb|KHF97947.1| hypothetical protein F383_10892 [Gossypium arboreum]
Length=526

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKMDHANDNKPSPVPGPPGAID--KKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQMA V QLEPA+ SLKWITD+L+NAHP DNVLYIQVGDPDLDHKC
Sbjct  118  FTATVLSWAILEYGDQMAAVNQLEPAQQSLKWITDFLINAHPKDNVLYIQVGDPDLDHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE+M E RPLT +N +VP
Sbjct  178  WERPENMKEKRPLTQVNITVP  198



>gb|AID55377.1| glycoside hydrolase family 9 B5 [Gossypium hirsutum]
Length=526

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKQSKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQMA V QLEPA+ SLKWITD+L+NAHP DNVLYIQVGDPDLDHKC
Sbjct  118  FTATVLSWAILEYGDQMAAVNQLEPAQQSLKWITDFLINAHPKDNVLYIQVGDPDLDHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE+M E RPLT +N +VP
Sbjct  178  WERPENMKEKRPLTQVNITVP  198



>gb|KJB58118.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=526

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQMA V QLEPA+ SLKWITD+L+NAHP DNVLYIQVGDPDLDHKC
Sbjct  118  FTATVLSWAILEYGDQMAAVNQLEPAQQSLKWITDFLINAHPKDNVLYIQVGDPDLDHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE+M E RPLT +N +VP
Sbjct  178  WERPENMKEKRPLTQVNITVP  198



>gb|ADU15552.1| EG [Gossypium hirsutum]
Length=526

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQMA V QLEPA+ SLKWITD+L+NAHP DNVLYIQVGDPDLDHKC
Sbjct  118  FTATVLSWAILEYGDQMAAVNQLEPAQQSLKWITDFLINAHPKDNVLYIQVGDPDLDHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE+M E RPLT +N +VP
Sbjct  178  WERPENMKEKRPLTQVNITVP  198



>ref|XP_007017777.1| EG isoform 3 [Theobroma cacao]
 gb|EOY15002.1| EG isoform 3 [Theobroma cacao]
Length=365

 Score =   259 bits (663),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 162/203 (80%), Gaps = 7/203 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  383
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFGFP
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFP  115

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+TATVL+W ILEYGDQM  V QLEPA+ SLKWITDYL+NAHP +NVLYIQVGDP+ DH
Sbjct  116  LAFTATVLSWAILEYGDQMEAVNQLEPAQESLKWITDYLINAHPSENVLYIQVGDPEADH  175

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW RPEDMTE RPLT +N SVP
Sbjct  176  KCWDRPEDMTEKRPLTMVNTSVP  198



>ref|XP_004238345.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
 ref|XP_010320423.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=519

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 156/201 (78%), Gaps = 9/201 (4%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+ KGGWCGW++ ++V AA   +I VL  KKH G GS            GA  +KY
Sbjct  1    MGEKSK-KGGWCGWIIALVVVAAAAGAIVVLFMKKHNGSGSD--------AASGASEKKY  51

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
            GDALKIAMQFFDVQKSGKLV+NKISWRGDS +KDG    LDLS+GMYDAGD MKF FPMA
Sbjct  52   GDALKIAMQFFDVQKSGKLVNNKISWRGDSAVKDGSQEKLDLSQGMYDAGDHMKFNFPMA  111

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            YTATVL+W ILEYG+QM  V QLEPA+ SLKWITDYL+N HP D+VLYIQVGD D DHKC
Sbjct  112  YTATVLSWAILEYGNQMKGVGQLEPAEDSLKWITDYLINCHPKDDVLYIQVGDADADHKC  171

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTE+RPL  INAS P
Sbjct  172  WDRPEDMTEARPLIQINASTP  192



>ref|XP_011074667.1| PREDICTED: endoglucanase 10-like [Sesamum indicum]
Length=525

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = +3

Query  216  DKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGD  395
            ++ R   GWCGW LV+IV AAI  +IF  V++K      SEP AAPVPGPPGAVT+KY D
Sbjct  2    EEKRGSRGWCGWFLVLIVLAAIAFAIFYAVRQKQH---KSEPGAAPVPGPPGAVTKKYAD  58

Query  396  ALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYT  575
            ALK+AMQF D+QKSGKL +N I WRGDSGLKDG  A +DLSKGMYDAGD MKFGFPMA+T
Sbjct  59   ALKVAMQFLDIQKSGKLENNNIPWRGDSGLKDGSEAQVDLSKGMYDAGDHMKFGFPMAFT  118

Query  576  ATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQ  755
            ATVL+WTILEYGDQM VV QLEPA+ SLKWITDYLVNAHP DNVLYIQVG P +DH CW 
Sbjct  119  ATVLSWTILEYGDQMKVVNQLEPAQDSLKWITDYLVNAHPTDNVLYIQVGSPKVDHGCWD  178

Query  756  RPEDMTESRPLTXINASVP  812
            RPEDMTE RPLT +NASVP
Sbjct  179  RPEDMTEDRPLTQVNASVP  197



>ref|XP_008466493.1| PREDICTED: endoglucanase 10 [Cucumis melo]
Length=523

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 165/201 (82%), Gaps = 4/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSRS+G  CGW LV+++   I  +I   VKKK      S+ D APVPGPPGA+ +KY
Sbjct  1    MGEKSRSRGC-CGWFLVLVILGLIAGAIVFAVKKK---SSHSDDDPAPVPGPPGAIQKKY  56

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+A++FFDVQKSGKLVDNKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKMALRFFDVQKSGKLVDNKISWRGDSGLKDGSEANLDLSKGMYDAGDHMKFGFPMA  116

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+PAK SLKWITDYL+NAHP +NVLYIQVGDP++DH C
Sbjct  117  FTATVLSWSILEYGDQMDAVGQLDPAKDSLKWITDYLINAHPSENVLYIQVGDPEVDHAC  176

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE M E RPL  INASVP
Sbjct  177  WDRPETMAEKRPLIQINASVP  197



>gb|AGV22125.1| endo-1,4-beta-glucanase 3 [Betula luminifera]
Length=527

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSRS  GWCGW LV+++ A +  ++ + +KKK     S    A PVPGPPGA+ +KY
Sbjct  1    MGEKSRSSKGWCGWFLVLVILALVVGAVVITIKKK----TSHSDKAPPVPGPPGAIVKKY  56

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFDVQKSGKLVDN ISWRGDS LKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKIAMQFFDVQKSGKLVDNPISWRGDSALKDGSEATLDLSKGMYDAGDHMKFGFPMA  116

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QLEPAK SLKWITDYL+NAH  DNVLYIQVGD   DH C
Sbjct  117  FTATVLSWSILEYGDQMETVNQLEPAKDSLKWITDYLINAHQSDNVLYIQVGDAKADHSC  176

Query  750  WQRPEDMTESRPLTXINASV  809
            W+RPE M E RPLT IN S 
Sbjct  177  WERPEVMAEKRPLTQINTSA  196



>ref|XP_007017776.1| EG isoform 2 [Theobroma cacao]
 gb|EOY15001.1| EG isoform 2 [Theobroma cacao]
Length=526

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 162/203 (80%), Gaps = 7/203 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  383
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFGFP
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFP  115

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+TATVL+W ILEYGDQM  V QLEPA+ SLKWITDYL+NAHP +NVLYIQVGDP+ DH
Sbjct  116  LAFTATVLSWAILEYGDQMEAVNQLEPAQESLKWITDYLINAHPSENVLYIQVGDPEADH  175

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW RPEDMTE RPLT +N SVP
Sbjct  176  KCWDRPEDMTEKRPLTMVNTSVP  198



>ref|XP_007017775.1| EG isoform 1 [Theobroma cacao]
 gb|EOY15000.1| EG isoform 1 [Theobroma cacao]
Length=533

 Score =   259 bits (662),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 162/203 (80%), Gaps = 7/203 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  383
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFGFP
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFP  115

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+TATVL+W ILEYGDQM  V QLEPA+ SLKWITDYL+NAHP +NVLYIQVGDP+ DH
Sbjct  116  LAFTATVLSWAILEYGDQMEAVNQLEPAQESLKWITDYLINAHPSENVLYIQVGDPEADH  175

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW RPEDMTE RPLT +N SVP
Sbjct  176  KCWDRPEDMTEKRPLTMVNTSVP  198



>ref|XP_010244092.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
 ref|XP_010244093.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
Length=527

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 158/201 (79%), Gaps = 4/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG K +SKG +CGWL+  +V   +   I + V+ KH    S +P  AP+PGPPGA+ +KY
Sbjct  1    MGGKEKSKG-YCGWLIAFVVLGIVVAVIVLTVRHKHS---SHKPVPAPIPGPPGAIEKKY  56

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DAL +AMQFFDVQKSGKLV+NKISWRGDS L+DGK   LDLSKGMYDAGD MKFG PMA
Sbjct  57   ADALGVAMQFFDVQKSGKLVNNKISWRGDSALQDGKEKKLDLSKGMYDAGDHMKFGLPMA  116

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TAT+L+WTILEYGDQM  V QLEPA+ SLKWITDYL+NAHP  NVLYIQVGDPD+DHKC
Sbjct  117  FTATILSWTILEYGDQMDAVNQLEPAQDSLKWITDYLINAHPSPNVLYIQVGDPDIDHKC  176

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE M E RPL  +N S P
Sbjct  177  WERPETMAEKRPLIQVNTSSP  197



>ref|XP_004136389.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 ref|XP_004162553.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 gb|KGN60025.1| hypothetical protein Csa_3G872070 [Cucumis sativus]
Length=523

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 165/201 (82%), Gaps = 4/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSRS+G  CGW LV++V A I  +I   VKKK      S+ D APVPGPPGA+ +KY
Sbjct  1    MGEKSRSRGC-CGWFLVLVVLALIAGAIVFAVKKK---SSHSDDDPAPVPGPPGAIEKKY  56

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+AM+FFDVQKSGKLVDN+ISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKMAMKFFDVQKSGKLVDNQISWRGDSGLKDGSDANLDLSKGMYDAGDHMKFGFPMA  116

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+ AK SLKWITDYL+NAHP +NVLYIQVGDP++DH C
Sbjct  117  FTATVLSWSILEYGDQMDAVGQLDSAKDSLKWITDYLINAHPSENVLYIQVGDPEVDHAC  176

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE M E RPL  INASVP
Sbjct  177  WDRPETMVEKRPLIQINASVP  197



>ref|XP_003527686.1| PREDICTED: endoglucanase 10-like [Glycine max]
 gb|KHN09095.1| Endoglucanase 24 [Glycine soja]
Length=529

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 160/201 (80%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSRSKGG CGW +  ++ A +  +I   VKKK    GS +   APVPGPPGAV QKY
Sbjct  1    MGEKSRSKGGCCGWFIAFVILALVVGAIVFTVKKKFSHSGSDK--PAPVPGPPGAVDQKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
              ALK AMQFFDVQKSG+LVDNKISWRG+S LKDG  A LDLSKGMYDAGD MKFGFPMA
Sbjct  59   STALKTAMQFFDVQKSGRLVDNKISWRGNSALKDGSQAKLDLSKGMYDAGDNMKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+ A+ SLKWITD+L+NAHP +NVLYIQVGDP  DHKC
Sbjct  119  FTATVLSWSILEYGDQMDHVGQLDAAQDSLKWITDFLINAHPSENVLYIQVGDPVADHKC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W++PE MTE RPL  +NAS P
Sbjct  179  WEKPEAMTEERPLLQVNASCP  199



>ref|XP_003523541.1| PREDICTED: endoglucanase 10 [Glycine max]
Length=529

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 160/201 (80%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSRSKGG CGW +  I+ A +  +I   VKKK    GS +   APVPGPPGAV QKY
Sbjct  1    MGEKSRSKGGCCGWFIAFIILALVVGAIVFTVKKKFSHSGSDK--PAPVPGPPGAVDQKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
              ALK AMQFFD+QKSGKLVDNKISWRG+S LKDG  A LDL+KGMYDAGD MKFGFPMA
Sbjct  59   STALKTAMQFFDIQKSGKLVDNKISWRGNSALKDGSQAKLDLTKGMYDAGDNMKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+ A+ SLKWITDYL+NAHP +NVLYIQVGDP  DHKC
Sbjct  119  FTATVLSWSILEYGDQMDHVGQLDAAQDSLKWITDYLINAHPSENVLYIQVGDPVADHKC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W++PE +TE RPL  +NAS P
Sbjct  179  WEKPEAITEERPLIQVNASCP  199



>ref|XP_010104437.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC00970.1| Endoglucanase 24 [Morus notabilis]
Length=525

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 162/204 (79%), Gaps = 10/204 (5%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK---HGGGGSSEPDaapvpgppgavT  380
            MG+KS SKG WCGW LV+++ A +  +I + +KKK   H    +  P      GPPGA++
Sbjct  1    MGEKSSSKG-WCGWFLVLVILALVVGAIVITIKKKQSDHSDKAAPVP------GPPGAIS  53

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY DALKIA+QFFDVQKSGKL DNKISWRGDSGL+DG  A +DLSKGMYDAGD MKFGF
Sbjct  54   QKYADALKIAIQFFDVQKSGKLEDNKISWRGDSGLRDGSDAKVDLSKGMYDAGDHMKFGF  113

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+WTILEYGDQM  V QLEPA+ SLKWITD+L+NAH  +NVL +QVGDP+ D
Sbjct  114  PMAFTATVLSWTILEYGDQMDAVDQLEPAQDSLKWITDFLINAHTSENVLIVQVGDPNKD  173

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPEDMT+ RPLT +N S P
Sbjct  174  HKCWERPEDMTQKRPLTQVNTSFP  197



>ref|XP_010667385.1| PREDICTED: endoglucanase 2-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 162/202 (80%), Gaps = 5/202 (2%)
 Frame = +3

Query  210  MGDKSRSKGG-WCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  386
            MG +  SKGG  CGW LV+IVA+AI   I + V+ K      +EP    VPGPPGA+  K
Sbjct  1    MGKEKESKGGGCCGWFLVIIVASAIVAGIVIAVRSKFHHSDKAEP----VPGPPGAIVTK  56

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y DALK+A+QFFDVQKSG+LVDNKISWRG+S L+DG  A LDLSKGMYDAGD MKFGFPM
Sbjct  57   YSDALKLALQFFDVQKSGRLVDNKISWRGNSALEDGSEAKLDLSKGMYDAGDHMKFGFPM  116

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W ILEYGDQMA +KQLEPA+ +LKW+TD+L+NAHP DNVLYIQVGDP++DHK
Sbjct  117  AFTATVLSWAILEYGDQMAAIKQLEPAQENLKWMTDFLINAHPRDNVLYIQVGDPEVDHK  176

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE MT  RPLT +N + P
Sbjct  177  CWERPESMTGERPLTQVNVTTP  198



>ref|XP_010061046.1| PREDICTED: endoglucanase 10-like [Eucalyptus grandis]
 gb|KCW67943.1| hypothetical protein EUGRSUZ_F01640 [Eucalyptus grandis]
Length=528

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 165/203 (81%), Gaps = 6/203 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  383
            MG + RS GGWCGWLLV+++ A +  ++ V VKK+  HGGGG    +AAPVPGPPGAV +
Sbjct  1    MGAEKRS-GGWCGWLLVLLILAVVAAAVVVTVKKRSGHGGGGD---EAAPVPGPPGAVQK  56

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALK+A QFFD+QKSGKL DN ISWRG+S LKDG  A +DLSKGM+DAGD MKFGFP
Sbjct  57   KYADALKLATQFFDIQKSGKLEDNPISWRGNSALKDGSDADIDLSKGMFDAGDHMKFGFP  116

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+TATVL+W ILEYGDQM  V QLE A+GSLKWITDYL+NAH  DNVLYIQVGDPDLDH
Sbjct  117  LAFTATVLSWAILEYGDQMNAVNQLETARGSLKWITDYLINAHASDNVLYIQVGDPDLDH  176

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW RPE MTE RPLT +N S P
Sbjct  177  KCWDRPEAMTEKRPLTQVNTSTP  199



>ref|XP_003603741.1| Endoglucanase [Medicago truncatula]
Length=535

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 150/201 (75%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            M +KS+SKGG CGW +  ++ A +  +I   VKKK     S +P+  P P       QKY
Sbjct  1    MREKSKSKGGCCGWFIAFVILALVVGAIVYAVKKKIDNSNSDKPEPVPGPPGAID--QKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A LDL+KGMYDAGD MKFGFPMA
Sbjct  59   ASALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQADLDLTKGMYDAGDHMKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TA+VL+W ILEYGDQM  V QLEPA+ SL+WITD+LVNAHP +NVLYIQVGDP  DHKC
Sbjct  119  FTASVLSWAILEYGDQMDAVGQLEPAQDSLRWITDFLVNAHPSENVLYIQVGDPVADHKC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE +TE RPL  +N S P
Sbjct  179  WNRPELITEERPLLQVNVSCP  199



>ref|XP_006342034.1| PREDICTED: endoglucanase 10-like [Solanum tuberosum]
Length=519

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 156/201 (78%), Gaps = 9/201 (4%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+ KGGWCGW++V+IVAAA   +I VLV KKH          +      GA  +KY
Sbjct  1    MGEKSK-KGGWCGWIIVLIVAAAAAGAIVVLVMKKH--------KDSSSDAASGASEKKY  51

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
            GDALKIAMQFFDVQKSGKLV+NKI WRGDS +KDG    LDLS+GMYDAGD MKF FPMA
Sbjct  52   GDALKIAMQFFDVQKSGKLVNNKIPWRGDSAIKDGSQEKLDLSQGMYDAGDHMKFNFPMA  111

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            YTATVL+W ILEYGDQM  V QLEPA+ SLKWITDYL+N HP DNVLYIQVGD + DHKC
Sbjct  112  YTATVLSWAILEYGDQMKGVGQLEPAQDSLKWITDYLINCHPKDNVLYIQVGDANADHKC  171

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPED+TE+RPL  INAS P
Sbjct  172  WDRPEDITEARPLIQINASTP  192



>gb|AES73992.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=529

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 150/201 (75%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            M +KS+SKGG CGW +  ++ A +  +I   VKKK     S +P+  P P       QKY
Sbjct  1    MREKSKSKGGCCGWFIAFVILALVVGAIVYAVKKKIDNSNSDKPEPVPGPPGAID--QKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A LDL+KGMYDAGD MKFGFPMA
Sbjct  59   ASALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQADLDLTKGMYDAGDHMKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TA+VL+W ILEYGDQM  V QLEPA+ SL+WITD+LVNAHP +NVLYIQVGDP  DHKC
Sbjct  119  FTASVLSWAILEYGDQMDAVGQLEPAQDSLRWITDFLVNAHPSENVLYIQVGDPVADHKC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE +TE RPL  +N S P
Sbjct  179  WNRPELITEERPLLQVNVSCP  199



>ref|XP_002276739.1| PREDICTED: endoglucanase 10 [Vitis vinifera]
 emb|CBI19843.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 162/201 (81%), Gaps = 5/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG +S+SKG WCGW +V++VAA +   I + ++K+      + P    VPGPPGA+ +KY
Sbjct  1    MGQRSKSKG-WCGWFIVLVVAALVAAVIVISIRKRSDHSDKAAP----VPGPPGAIDKKY  55

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+AMQFFD+QKSGKL +NKISWRG+S L+DG  A LDLSKGMYDAGD +KFGFPMA
Sbjct  56   SDALKLAMQFFDIQKSGKLENNKISWRGNSALQDGSEAKLDLSKGMYDAGDHIKFGFPMA  115

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQM VV QLEPA+ SLKWITDYL+NAHP +NVLYIQVGDP+ DHKC
Sbjct  116  FTATVLSWAILEYGDQMDVVDQLEPAQDSLKWITDYLINAHPSENVLYIQVGDPEADHKC  175

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE+M E RPLT +N S P
Sbjct  176  WERPENMKEKRPLTQVNTSAP  196



>ref|XP_006302134.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
 gb|EOA35032.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
Length=525

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+S+G WCGWL+ +IV A++ +++   VK +    G  E  A PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWLIAIIVLASVVLAVVYTVKSRMKKSGDDE-GAGPVPGPPGAIDKKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+A+QFFD+QKSGKLV+NKISWRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKMALQFFDIQKSGKLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V  L+PAK SL+W TDYL+ AHP DNVLYIQVGDP +DH C
Sbjct  119  FTATVLSWSILEYGDQMDAVNSLDPAKDSLRWTTDYLIKAHPSDNVLYIQVGDPKVDHPC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDM E RPLT I+A  P
Sbjct  179  WERPEDMKEKRPLTKIDADTP  199



>ref|XP_011045112.1| PREDICTED: endoglucanase 2 [Populus euphratica]
Length=523

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY DALKIA QFFD+QKSGKLVDNKISWRGDS L+DG  A LDLSKGMYDAGD MKFG 
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDNKISWRGDSALRDGSQAKLDLSKGMYDAGDHMKFGL  112

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+WTILEYGDQM VV QLEPAK SLKWITDYL+NAHP+ NVLYIQVGDPD D
Sbjct  113  PMAFTATVLSWTILEYGDQMDVVNQLEPAKDSLKWITDYLINAHPEANVLYIQVGDPDTD  172

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMTE RPLT +N S P
Sbjct  173  HGCWDRPEDMTEKRPLTQVNTSFP  196



>ref|XP_004500948.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=528

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 157/201 (78%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG KSRS+G  CGW +  ++ A +  ++   +KKK     S +   APVPGPPGA+ QKY
Sbjct  1    MGGKSRSRGC-CGWFIAFVIFALVVGAVVYTIKKKIDNSDSDK--PAPVPGPPGAIEQKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   STALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQANLDLSKGMYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TA+VL+W ILEYGDQM  V QLEPA+ SLKWITD+L+NAHP +NVLYIQVGDP  DHKC
Sbjct  118  FTASVLSWAILEYGDQMDAVGQLEPAQDSLKWITDFLINAHPSENVLYIQVGDPVADHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE MTE RPLT +N S P
Sbjct  178  WDRPETMTEERPLTQVNTSCP  198



>gb|AFZ78647.1| korrigan [Populus tomentosa]
Length=523

 Score =   251 bits (641),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY DALKIA QFFD+QKSGKLVDNKISWRGDS L+DG  A LDLSKGMYDAGD MKFG 
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDNKISWRGDSALRDGSQAKLDLSKGMYDAGDHMKFGL  112

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W ILEYGDQM VV QLEPAK SLKWITDYL+NAHP+ NVLYIQVGDPD D
Sbjct  113  PMAFTATVLSWAILEYGDQMNVVNQLEPAKDSLKWITDYLINAHPEANVLYIQVGDPDTD  172

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMTE RPLT +N S P
Sbjct  173  HGCWDRPEDMTEKRPLTQVNTSFP  196



>gb|KJB58120.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=522

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 155/201 (77%), Gaps = 7/201 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QK    ++NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQK----LNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  113

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQMA V QLEPA+ SLKWITD+L+NAHP DNVLYIQVGDPDLDHKC
Sbjct  114  FTATVLSWAILEYGDQMAAVNQLEPAQQSLKWITDFLINAHPKDNVLYIQVGDPDLDHKC  173

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE+M E RPLT +N +VP
Sbjct  174  WERPENMKEKRPLTQVNITVP  194



>ref|XP_007136082.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
 gb|ESW08076.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
Length=529

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 160/201 (80%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+SKGG CGW +  ++ A +  ++   VKKK G  GS +  AAPVPGPPGAV QKY
Sbjct  1    MGEKSKSKGGCCGWFIAFVILAIVVGAVVYTVKKKFGHSGSDK--AAPVPGPPGAVDQKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
              ALK ++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDL+KGMYDAGD +KFGFPMA
Sbjct  59   ATALKTSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSQAKLDLTKGMYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQM  V QL  A+ SLKW+TDYL++AHP  NVLYIQVGDP  DHKC
Sbjct  119  FTATVLSWAILEYGDQMDHVGQLVSAQDSLKWVTDYLISAHPSANVLYIQVGDPVADHKC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDMTE+RPL  +N S P
Sbjct  179  WERPEDMTEARPLIQVNESYP  199



>dbj|BAF42037.1| cellulase2 [Pyrus communis]
Length=526

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 158/201 (79%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG KSR KG W  WLLV+ +   +  ++ + V KK     +S  D   VPGPPGA+TQKY
Sbjct  1    MGAKSRCKG-WWAWLLVLAIFGLVVGAVVLAVVKKVKK--NSGGDDGAVPGPPGAITQKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+A+QFFDVQKSG+LVDNKISWRGDSGLKDG    LDLSKGMYDAGD MKFGFPMA
Sbjct  58   SDALKLAVQFFDVQKSGQLVDNKISWRGDSGLKDGSDVRLDLSKGMYDAGDQMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            YTATVL+WTILEYGDQM  V QL+ A+ SLKWITD+LVNAHP DNVLY+QVGDP  DH C
Sbjct  118  YTATVLSWTILEYGDQMDAVNQLQTAQASLKWITDFLVNAHPKDNVLYVQVGDPKKDHAC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTESRP+T +N S P
Sbjct  178  WYRPEDMTESRPVTQVNTSAP  198



>gb|EPS64495.1| hypothetical protein M569_10284, partial [Genlisea aurea]
Length=530

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 167/201 (83%), Gaps = 7/201 (3%)
 Frame = +3

Query  219  KSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEP--DaapvpgppgavTQKY  389
            + R  GGWCGW LV+IV A++G+++F++VK+K H     S+P  +AAPVPGPPGAV  KY
Sbjct  1    EKRGGGGWCGWFLVLIVLASVGLAVFLVVKQKIH----KSQPPGEAAPVPGPPGAVVAKY  56

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQF D+QKSGKL++N+++WRGDSGL+DG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKIAMQFLDIQKSGKLMNNEVAWRGDSGLQDGSEANLDLSKGMYDAGDHMKFGFPMA  116

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+WTILEYGDQM    QL PA+ SL+WITDYL NAHP DN LY+QVGDP  DH C
Sbjct  117  FTATVLSWTILEYGDQMEATSQLHPAQESLRWITDYLANAHPSDNTLYVQVGDPKTDHGC  176

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE+MTE+RPLT +NAS P
Sbjct  177  WERPEEMTEARPLTQVNASSP  197



>ref|XP_010539853.1| PREDICTED: endoglucanase 10 [Tarenaya hassleriana]
Length=524

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+S+G WCGW + ++V A + V++   ++ K G   S +    PVPGPPGA+ +KY
Sbjct  1    MGEKSQSRG-WCGWFIALVVLAVVVVAVVFTIRAKTGH--SDDGGDGPVPGPPGAIDKKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD MKFGFPMA
Sbjct  58   SDALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGNEVNLDLSKGLYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+PAK SLKWITD+L+NAHP +NVLYIQVGDP +DHKC
Sbjct  118  FTATVLSWSILEYGDQMEAVNQLKPAKDSLKWITDFLINAHPSENVLYIQVGDPSVDHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE MT  RPLT I+   P
Sbjct  178  WDRPETMTGKRPLTKIDTETP  198



>ref|XP_008364934.1| PREDICTED: endoglucanase 10-like [Malus domestica]
Length=526

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 158/205 (77%), Gaps = 11/205 (5%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvi----vaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgav  377
            MG KSR KG W  WLLV+     V  A+ +++   VKK  GG  S+ P      GPPGA+
Sbjct  1    MGAKSRCKG-WWAWLLVLAILGLVVGAVVLAVVKKVKKNSGGDDSAVP------GPPGAI  53

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            TQKY DALK+A+QFFDVQKSG+LVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFG
Sbjct  54   TQKYSDALKLAVQFFDVQKSGQLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGDHMKFG  113

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMAYTATVL+W ILEYGDQM  V QL  A+ SLKWITD+LVNAHP DNVLY+QVGDP  
Sbjct  114  FPMAYTATVLSWAILEYGDQMDAVNQLHTAQASLKWITDFLVNAHPKDNVLYVQVGDPKK  173

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW RPEDMTESRP+T +N S P
Sbjct  174  DHACWYRPEDMTESRPVTQVNISSP  198



>ref|XP_002889037.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65296.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 162/201 (81%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+S+G WCGW + +IV A++ +++   VK +    G       PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWFIAIIVLASVVLAVVYTVKLRMKKSGDDG-GGGPVPGPPGAIDKKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+A+QFFD+QKSGKL +NKISWRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLALQFFDIQKSGKLANNKISWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM VV QL+PAK SL+W TDYL+ AHP DNVLYIQVGDP +DH C
Sbjct  119  FTATVLSWSILEYGDQMNVVNQLDPAKDSLRWTTDYLIKAHPSDNVLYIQVGDPKVDHPC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDM E RPLT I+A  P
Sbjct  179  WERPEDMKEKRPLTKIDADTP  199



>ref|XP_011083520.1| PREDICTED: endoglucanase 10 [Sesamum indicum]
Length=518

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 146/202 (72%), Gaps = 13/202 (6%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsi-fvLVKKKHGGGGSSEPDaapvpgppgavTQK  386
            M  K +SKG  C  +L ++V A + V +  V+VK   G G    P             +K
Sbjct  1    MRQKKKSKGVCCWSMLALVVLAIVAVILLVVMVKTDEGSGSPGAP------------VKK  48

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y DALK+AMQFFDVQKSGKL  N+I WRGDSGLKDG  A LDLSKGMYDAGD MKFGFPM
Sbjct  49   YADALKLAMQFFDVQKSGKLEKNQIDWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFPM  108

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W ILEYGDQM VV QLEPA+ SLKWITDYL+NAHP +NVLYIQVG+P LDH 
Sbjct  109  AFTATVLSWAILEYGDQMQVVDQLEPARSSLKWITDYLINAHPSENVLYIQVGNPKLDHS  168

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW RPEDMTE RPL  +N S P
Sbjct  169  CWNRPEDMTEKRPLRQVNTSAP  190



>ref|XP_010416457.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 161/201 (80%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+SKG WCGW + +IV A + +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAVVVLAVVYTVKSRMKKSGEAD-GSGPVPGPPGAIDKKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+PAK SL+W TDYL+ AHP DNVLYIQVGDP LDH C
Sbjct  119  FTATVLSWSILEYGDQMDAVNQLDPAKDSLRWTTDYLIKAHPSDNVLYIQVGDPKLDHPC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDM E RPLT I+   P
Sbjct  179  WERPEDMKEKRPLTKIDVDTP  199



>ref|XP_010471690.1| PREDICTED: endoglucanase 10 [Camelina sativa]
Length=525

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 162/201 (81%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+SKG WCGW + +IV AA+ +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAAVVLAVVYTVKSRMKKSGEAD-GSGPVPGPPGAIDKKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+PAK SL+W TDYL+ AHP DNVLYIQVGDP +DH C
Sbjct  119  FTATVLSWSILEYGDQMDAVNQLDPAKDSLRWTTDYLIKAHPSDNVLYIQVGDPKIDHPC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDM E RPLT I+   P
Sbjct  179  WERPEDMKEKRPLTKIDVDTP  199



>ref|XP_008221286.1| PREDICTED: endoglucanase 10-like [Prunus mume]
Length=526

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 161/201 (80%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG KSRSKG W   L++V++A  +   +  +VKKK     SS+ D  PVPGPPGA+TQKY
Sbjct  1    MGAKSRSKGCWAWLLVLVVLALVVTAIVVAIVKKK---SNSSDDDNGPVPGPPGAITQKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+A+QFFD+QKSGKLVDNKISWRGDSGLKDG    LDLSKGMYDAGD MKFGFPMA
Sbjct  58   SDALKLAVQFFDIQKSGKLVDNKISWRGDSGLKDGSDEKLDLSKGMYDAGDHMKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+  +GSLKWITD+LVNAHP DNVLYIQVGDP  DH C
Sbjct  118  FTATVLSWSILEYGDQMDAVNQLQTVQGSLKWITDFLVNAHPKDNVLYIQVGDPKKDHDC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMT  RPLT IN+S P
Sbjct  178  WNRPEDMTGKRPLTQINSSSP  198



>ref|XP_010428595.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 162/201 (81%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+SKG WCGW + +IV AA+ +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAAVVLAVVYTVKSRMKKSGDAD-GSGPVPGPPGAIDKKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+PAK SL+W TDYL+ AHP DNVLYIQVGDP +DH C
Sbjct  119  FTATVLSWSILEYGDQMDAVNQLDPAKDSLRWTTDYLIKAHPSDNVLYIQVGDPKIDHPC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDM E RPLT I+   P
Sbjct  179  WERPEDMKEKRPLTKIDVDTP  199



>ref|XP_009335173.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=526

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            TQKY DALK+A+QFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFG
Sbjct  54   TQKYSDALKVAVQFFDVQKSGKLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGDHMKFG  113

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMAYTATVL+W ILEYGDQM  V QL+ ++ SLKWITD+LVNAHP DNVLYIQVGDP  
Sbjct  114  FPMAYTATVLSWAILEYGDQMDAVNQLKTSQASLKWITDFLVNAHPKDNVLYIQVGDPKK  173

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH+CW RPED+TE RP T +N S P
Sbjct  174  DHECWYRPEDVTEKRPATQVNTSAP  198



>ref|XP_010536354.1| PREDICTED: endoglucanase 10-like [Tarenaya hassleriana]
Length=524

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 162/203 (80%), Gaps = 7/203 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  383
            MG KSR +G  CGW + +IV AA+ +++   ++KK  H   G  +P    VPGPPGAV +
Sbjct  1    MGAKSRRRG-LCGWFIALIVLAAVVLAVVYTIRKKTGHSDDGGDDP----VPGPPGAVDK  55

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DAL+IA+QFFD+QKSGKL +NKISWRGDSGLKDGK A+LDLSKG+YDAGD MKFGFP
Sbjct  56   KYADALEIALQFFDIQKSGKLGNNKISWRGDSGLKDGKEANLDLSKGLYDAGDHMKFGFP  115

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W+ILEYGDQM  V QLEPAK SLKWITD+L+NAHP +NVLYIQVGDP +DH
Sbjct  116  MAFTATVLSWSILEYGDQMDEVNQLEPAKDSLKWITDFLINAHPSENVLYIQVGDPSIDH  175

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW RPE M+  RPLT I+   P
Sbjct  176  KCWDRPETMSGKRPLTKIDTETP  198



>ref|XP_002307711.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE94707.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97189.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97216.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 148/202 (73%), Gaps = 7/202 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavT-QK  386
            MG K  S+G + GW +V ++ A I  +I   VKKK     S + +       P   T +K
Sbjct  1    MGVKPSSRGCF-GWFIVAVILALIIGAIVYTVKKK-----SEKSEGPAPIPGPPGATDKK  54

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y DALKIA QFFD+QKSGKLVD KISWRGDS L+DG  A LDLSKGMYDAGD MKFG PM
Sbjct  55   YADALKIATQFFDIQKSGKLVDKKISWRGDSALRDGSQAKLDLSKGMYDAGDHMKFGLPM  114

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W ILEYGDQM VV Q EPAK SLKWITDYL+NAHP+ NVLYIQVGDPD DH 
Sbjct  115  AFTATVLSWAILEYGDQMDVVNQFEPAKDSLKWITDYLINAHPEANVLYIQVGDPDTDHG  174

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW RPEDMTE RPLT +N S P
Sbjct  175  CWDRPEDMTEKRPLTQVNTSFP  196



>ref|XP_006435157.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
 gb|ESR48397.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
Length=524

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 7/202 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  386
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD MKFGFPM
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPM  114

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W ILEYGDQM VV QL+PA+ SLKWITDYL++AHP +NVL +QVG+PD DHK
Sbjct  115  AFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGNPDKDHK  174

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE MTE RPLT +N S P
Sbjct  175  CWERPESMTEERPLTQVNTSFP  196



>gb|EYU38839.1| hypothetical protein MIMGU_mgv1a004578mg [Erythranthe guttata]
Length=519

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 146/201 (73%), Gaps = 10/201 (5%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            M  + RS  G CGW LV+IV A I  ++F ++K K  G GS                +KY
Sbjct  1    MKQRKRSSSGCCGWFLVIIVLAGIAFAVFAVLKHKTWGSGSP----------ALGDPKKY  50

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKL +N+I WRGDS LKDG  A +DLSKGMYDAGD MKFGFPMA
Sbjct  51   SDALKIAMQFFDIQKSGKLDENQIPWRGDSALKDGSEAKIDLSKGMYDAGDHMKFGFPMA  110

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQM    QLEPA+ SLKWITDYLVN+HP  NVLYIQVG+  +DH C
Sbjct  111  FTATVLSWAILEYGDQMNGAGQLEPARNSLKWITDYLVNSHPTANVLYIQVGNAKVDHGC  170

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDM E+RPLT +NAS P
Sbjct  171  WNRPEDMKEARPLTQVNASYP  191



>gb|KJB14408.1| hypothetical protein B456_002G123700 [Gossypium raimondii]
Length=529

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG +S+S+G + GWLLV+++ A +  ++  ++KKK   G  ++P   PVPGPPGA+  KY
Sbjct  1    MGKESKSRG-FFGWLLVLVILALVVGAVVYIIKKKLDHGNDNKP--TPVPGPPGAIDHKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
              AL+IAMQFFDVQKSG+LVDNKISWRGDS L DG  A LDLSKGMY AGD +KFGFPMA
Sbjct  58   AYALEIAMQFFDVQKSGRLVDNKISWRGDSALTDGSEAKLDLSKGMYVAGDHVKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEY DQM  V QLEPA+ SLKWITD+L+NAHP  NVLYIQVGDP  DHKC
Sbjct  118  FTATVLSWAILEYRDQMEAVNQLEPAQQSLKWITDFLLNAHPSPNVLYIQVGDPVTDHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTE RPLT +NASVP
Sbjct  178  WDRPEDMTEKRPLTQVNASVP  198



>gb|AAM63477.1| endo-beta-1,4-glucanase, putative [Arabidopsis thaliana]
Length=525

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            M +KS+S+G WCGW + +IV A++ +++   VK +    G  +    PVPGPPGA+ +KY
Sbjct  1    MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDD-GGCPVPGPPGAIDKKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+PAK SL+WITDYL+ AHP DNVLYIQVGDP +DH C
Sbjct  119  FTATVLSWSILEYGDQMNAVNQLDPAKDSLRWITDYLIKAHPSDNVLYIQVGDPKVDHPC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDM E RPLT I+   P
Sbjct  179  WERPEDMKEKRPLTKIDVDTP  199



>gb|EYU36779.1| hypothetical protein MIMGU_mgv1a004472mg [Erythranthe guttata]
Length=525

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 6/202 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEPDaapvpgppgavTQK  386
            MG+K++S+G WCGW L  IV AA+  ++F  +++K H     + P    +PGPPGA+T+K
Sbjct  1    MGEKNKSRG-WCGWFLAFIVLAAVAFALFFTLRQKFHKSDSGAAP----IPGPPGAITKK  55

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y DALKIA QF D+QKSGKLV+N+ISWRGDS LKDG   +LDLSKGMYDAGD +KFGFPM
Sbjct  56   YADALKIASQFLDIQKSGKLVNNQISWRGDSALKDGNQENLDLSKGMYDAGDHVKFGFPM  115

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TAT+L+W+ILEYGDQM  V QL P + SLKWITDYL+NAHP DNVLYIQVG P+ DH 
Sbjct  116  AFTATLLSWSILEYGDQMKAVDQLTPVQDSLKWITDYLINAHPTDNVLYIQVGSPEADHS  175

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW RPE +TE RPLT +N S P
Sbjct  176  CWVRPEAITEERPLTQVNTSSP  197



>gb|KDO84820.1| hypothetical protein CISIN_1g009846mg [Citrus sinensis]
Length=524

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 7/202 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  386
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD MKFGFPM
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPM  114

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W ILEYGDQM VV QL+PA+ SLKWITDYL++AHP +NVL +QVG+PD DHK
Sbjct  115  AFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGNPDKDHK  174

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE M E RPLT +N S P
Sbjct  175  CWERPESMAEERPLTQVNTSFP  196



>ref|XP_006473639.1| PREDICTED: endoglucanase 10-like [Citrus sinensis]
Length=524

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 7/202 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  386
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD MKFGFPM
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPM  114

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W ILEYGDQM VV QL+PA+ SLKWITDYL++AHP +NVL +QVG+PD DHK
Sbjct  115  AFTATVLSWAILEYGDQMDVVDQLQPAQDSLKWITDYLISAHPKENVLIVQVGNPDKDHK  174

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE M E RPLT +N S P
Sbjct  175  CWERPESMAEERPLTQVNTSFP  196



>ref|XP_008387935.1| PREDICTED: endoglucanase 2 [Malus domestica]
Length=526

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            TQKY  ALK+A+QFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFG
Sbjct  54   TQKYSAALKVAVQFFDVQKSGKLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGDHMKFG  113

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMAYTATVL+W ILEYGD M  V QL+ ++ SLKWITD+LVNAHP DNVLYIQVGDP  
Sbjct  114  FPMAYTATVLSWAILEYGDHMDAVNQLKTSQASLKWITDFLVNAHPKDNVLYIQVGDPKK  173

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH+CW RPED+TE RP T +N S P
Sbjct  174  DHECWYRPEDVTEKRPATQVNTSAP  198



>ref|XP_004957464.1| PREDICTED: endoglucanase 24-like [Setaria italica]
Length=528

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 150/197 (76%), Gaps = 0/197 (0%)
 Frame = +3

Query  222  SRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDAL  401
            S+   G CGWL+V ++AA +  +    + K+  GGG       PVPGPPGA+  KYGDAL
Sbjct  3    SKYTRGCCGWLIVALIAALVATAAMFAIMKRKPGGGGKHLKPLPVPGPPGAIDSKYGDAL  62

Query  402  KIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTAT  581
             +A+QFF VQKSGKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA+TAT
Sbjct  63   GVALQFFQVQKSGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMAFTAT  122

Query  582  VLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRP  761
            VLAW++LEYGDQM+  KQL+PA  +LKWITD+L+ AHP DNVLYIQVGDPDLDH CW+RP
Sbjct  123  VLAWSVLEYGDQMSAAKQLDPALDALKWITDFLIAAHPSDNVLYIQVGDPDLDHNCWERP  182

Query  762  EDMTESRPLTXINASVP  812
            E MTE RPLT IN   P
Sbjct  183  ETMTEKRPLTQINKKSP  199



>gb|KDP36939.1| hypothetical protein JCGZ_08230 [Jatropha curcas]
Length=523

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 153/201 (76%), Gaps = 5/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG KSRS+G + GW +V IV A +  ++   VKKK         DA  VPGPPGA+ +KY
Sbjct  1    MGKKSRSRGCF-GWFIVAIVLAVVVAAVVYTVKKKI----HKSDDAGAVPGPPGAIDKKY  55

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+AMQFFDVQKSG L DN+ISWRGDSG+ DG  A +DLSKGMYDAGD MKFGFPMA
Sbjct  56   ADALKVAMQFFDVQKSGNLEDNEISWRGDSGINDGSQAKVDLSKGMYDAGDHMKFGFPMA  115

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W ILEYGDQM  V QLEPAK SLKWITDYLVNAH   NVLYIQVGDP  DH C
Sbjct  116  FTATVLSWAILEYGDQMDAVNQLEPAKDSLKWITDYLVNAHASANVLYIQVGDPKTDHGC  175

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTE RP+T +N S P
Sbjct  176  WDRPEDMTEKRPVTQVNTSSP  196



>ref|XP_011100152.1| PREDICTED: endoglucanase 24-like [Sesamum indicum]
Length=528

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             +KY DAL IA+QFFDVQKSGKLV N+ISWRGDSGL+DG+ A+LDLSKG+YDAGDLMKFG
Sbjct  55   VEKYSDALAIALQFFDVQKSGKLVKNRISWRGDSGLEDGQDANLDLSKGLYDAGDLMKFG  114

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYGD M  VK+LE A+ SLKWITDYL+NAHP  N+ Y+QVGDP+L
Sbjct  115  FPMAFTATVLSWAILEYGDHMKEVKELENAQDSLKWITDYLINAHPFPNLFYVQVGDPEL  174

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DHKCW+RPE MTE+RPLT +N S P
Sbjct  175  DHKCWERPEAMTETRPLTQVNTSYP  199



>gb|EEC84946.1| hypothetical protein OsI_32163 [Oryza sativa Indica Group]
Length=528

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaa-aigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  386
            MG K++   G CGWL+V +VA+     ++  ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAAVVAIMKKKAGGGSGRKLKPLPVPGPPGAIDSK  57

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD +KF FPM
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPM  117

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W+ILEYGDQM+  KQL+PA  +L+WITD+LVNAHP DNV YIQVGDPDLDH 
Sbjct  118  AFTATVLSWSILEYGDQMSAAKQLDPALDALRWITDFLVNAHPSDNVFYIQVGDPDLDHN  177

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE M+E RPLT IN   P
Sbjct  178  CWERPETMSEKRPLTQINTKSP  199



>ref|NP_177697.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
 sp|Q8LCP6.2|GUN10_ARATH RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87112.1|AC006434_8 F10A5.13 [Arabidopsis thaliana]
 gb|AAK64042.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAN12892.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AEE35745.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
Length=525

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            M +KS+S+G WCGW + +IV A++ +++   VK +    G  +    PVPGPPGA+ +KY
Sbjct  1    MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDD-GGGPVPGPPGAIDKKY  58

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKFGFPMA  118

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM  V QL+PAK SL+WITDYL+ AHP DNVLYIQVGDP +DH C
Sbjct  119  FTATVLSWSILEYGDQMNAVNQLDPAKDSLRWITDYLIKAHPSDNVLYIQVGDPKVDHPC  178

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPEDM E RPLT I+   P
Sbjct  179  WERPEDMKEKRPLTKIDVDTP  199



>ref|NP_001063771.1| Os09g0533900 [Oryza sativa Japonica Group]
 sp|Q69SG5.1|GUN24_ORYSJ RecName: Full=Endoglucanase 24; AltName: Full=Endo-1,4-beta glucanase 
24; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD33331.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF25685.1| Os09g0533900 [Oryza sativa Japonica Group]
 dbj|BAG94612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30395.1| cellulase [Oryza sativa]
Length=528

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaa-aigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  386
            MG K++   G CGWL+V +VA+     ++  ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAAVVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSK  57

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD +KF FPM
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPM  117

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W+ILEYGDQM+  KQL+PA  +L+WITD+LVNAHP DNV YIQVGDPDLDH 
Sbjct  118  AFTATVLSWSILEYGDQMSATKQLDPALDALRWITDFLVNAHPSDNVFYIQVGDPDLDHN  177

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE M+E RPLT IN   P
Sbjct  178  CWERPETMSEKRPLTQINTKSP  199



>ref|XP_009128120.1| PREDICTED: endoglucanase 10 [Brassica rapa]
 ref|XP_009128121.1| PREDICTED: endoglucanase 10 [Brassica rapa]
Length=526

 Score =   241 bits (615),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 156/201 (78%), Gaps = 1/201 (0%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG++     GWCGW + +IV AA+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGWCGWFIALIVLAAVILAVVYMVKSKMKKSDDGD-GAGPVPGPPGAIDKKY  59

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+++QFFD+QKSGKLV+NKISWRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  60   ADALKLSLQFFDIQKSGKLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  119

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM VV QL+PAK SL+W TDY + AHP DNVLYIQVGDP +DH C
Sbjct  120  FTATVLSWSILEYGDQMDVVNQLDPAKESLRWTTDYFIKAHPSDNVLYIQVGDPKVDHPC  179

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE M   RPL  I+A  P
Sbjct  180  WERPETMKGKRPLIKIDADTP  200



>ref|XP_007046716.1| EG [Theobroma cacao]
 gb|EOX90873.1| EG [Theobroma cacao]
Length=527

 Score =   241 bits (615),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            ++KY DAL+IA+QFFD+QKSGKLVDN+ISWRGDSGL+DG   +LDLSKGMYDAGD MKFG
Sbjct  53   SKKYADALEIALQFFDIQKSGKLVDNRISWRGDSGLQDGSEGNLDLSKGMYDAGDTMKFG  112

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYGDQM  VKQL  A+ SL+WITDYL+N HP +NVLYIQVGDP++
Sbjct  113  FPMAFTATVLSWAILEYGDQMNAVKQLGYAQNSLRWITDYLINVHPSENVLYIQVGDPEV  172

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DHKCW+RPE M+E RPL  +N S P
Sbjct  173  DHKCWERPETMSERRPLIQVNTSFP  197



>gb|EEE70113.1| hypothetical protein OsJ_30126 [Oryza sativa Japonica Group]
Length=528

 Score =   241 bits (615),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsi-fvLVKKKHGGGGSSEPDaapvpgppgavTQK  386
            MG K++   G CGWL+V +VA+ +  +    ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAALVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSK  57

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD +KF FPM
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPM  117

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W+ILEYGDQM+  KQL+PA  +L+WITD+LVNAHP DNV YIQVGDPDLDH 
Sbjct  118  AFTATVLSWSILEYGDQMSATKQLDPALDALRWITDFLVNAHPSDNVFYIQVGDPDLDHN  177

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE M+E RPLT IN   P
Sbjct  178  CWERPETMSEKRPLTQINTKSP  199



>ref|XP_002510516.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF52703.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=523

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 154/201 (77%), Gaps = 5/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KSRS+G +CGW +V +V   + V++   VKKK    G + P    VPGPPGAV +KY
Sbjct  1    MGEKSRSRG-FCGWFIVAVVLTIVVVAVVYTVKKKTHNSGDASP----VPGPPGAVEKKY  55

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DAL IAMQFFD+QKSGKLVDN ISWRGDS L DG  A  DLSKGMYDAGD MKFGFPMA
Sbjct  56   ADALNIAMQFFDIQKSGKLVDNGISWRGDSALDDGNEAKRDLSKGMYDAGDHMKFGFPMA  115

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TAT+L+W ILEYGDQM  V QLEPA+ SLKWITDYL+NAH  +NVLY+QVGDP  DH C
Sbjct  116  FTATILSWAILEYGDQMDAVNQLEPAQDSLKWITDYLINAHASENVLYVQVGDPKADHGC  175

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPEDMTE RPL  +N + P
Sbjct  176  WDRPEDMTEKRPLIQVNETSP  196



>emb|CDY13546.1| BnaC02g23570D [Brassica napus]
Length=422

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 155/201 (77%), Gaps = 1/201 (0%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG++     G CGW + +IV  A+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGRCGWFIALIVLTAVILAVVYMVKSKMKKSDDGDG-AGPVPGPPGAIDKKY  59

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+++QFFD+QKSGKLVDNKISWRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPMA
Sbjct  60   ADALKLSLQFFDIQKSGKLVDNKISWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPMA  119

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM VV QL+PAK SL+W TDY + AHP DNVLYIQVGDP +DH C
Sbjct  120  FTATVLSWSILEYGDQMDVVNQLDPAKESLRWTTDYFIKAHPSDNVLYIQVGDPKVDHPC  179

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE M   RPL  ++A  P
Sbjct  180  WERPETMKGKRPLIKVDADTP  200



>ref|XP_006390284.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
 gb|ESQ27570.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
Length=524

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 162/201 (81%), Gaps = 3/201 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG+KS+S+G WCGWL+ +IV AA+ +++   VK +     S +  A PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWLIAIIVLAAVVLAVVYTVKSRMKK--SDDDGAGPVPGPPGAIDKKY  57

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIA+QFFD+QKSGKL  NK+SWRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPMA
Sbjct  58   ADALKIALQFFDIQKSGKLEKNKLSWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPMA  117

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM VV QL+PAK SL+W TD+ + AHP D+VLYIQVGDP +DHKC
Sbjct  118  FTATVLSWSILEYGDQMEVVNQLDPAKESLRWTTDFFIKAHPSDDVLYIQVGDPKVDHKC  177

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE MT  RPL  I+A  P
Sbjct  178  WERPETMTGKRPLIKIDAETP  198



>ref|XP_009398708.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY DAL +A+QFF VQKSGKLVDNKI+WRGDS L DGK A LDLSKGMYDAGD MKFGF
Sbjct  52   QKYADALGVALQFFQVQKSGKLVDNKITWRGDSALHDGKDAGLDLSKGMYDAGDHMKFGF  111

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMAYTATVL+W+ILEYGDQ++ V QL+ A  +LKWIT++ +NAHP DNVLY+QVGDPDLD
Sbjct  112  PMAYTATVLSWSILEYGDQISAVDQLDLALDALKWITEFFINAHPSDNVLYVQVGDPDLD  171

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPE MTESRPL  +N +VP
Sbjct  172  HKCWERPETMTESRPLVQVNKTVP  195



>gb|KDP46724.1| hypothetical protein JCGZ_06512 [Jatropha curcas]
Length=538

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             +KY DAL++A+QFFDVQKSGKLVDN+I+WRGDSGL+DG+   LDLSKG+YDAGDL+KFG
Sbjct  64   VKKYADALEVALQFFDVQKSGKLVDNRIAWRGDSGLQDGRQQGLDLSKGIYDAGDLIKFG  123

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TAT+L+W ILEYGDQM  VKQLE A+ SLKWITDYL+NAHP  +VLY+QVGDPDL
Sbjct  124  FPMAFTATMLSWAILEYGDQMDKVKQLEYAQDSLKWITDYLINAHPSPDVLYVQVGDPDL  183

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPE MTE RPL  +N S P
Sbjct  184  DHSCWQRPETMTEERPLLQVNTSFP  208



>emb|CDY39048.1| BnaA02g17370D [Brassica napus]
Length=526

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 156/201 (78%), Gaps = 1/201 (0%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG++     GWCGW + +IV AA+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGWCGWFIALIVLAAVILAVVYMVKSKMKKSDDGD-GAGPVPGPPGAIDKKY  59

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALK+++QFFD+QKSG+LV+NKISWRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  60   ADALKLSLQFFDIQKSGRLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  119

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQM VV QL+PAK SL+W TDY + AHP DNVLYIQVGDP +DH C
Sbjct  120  FTATVLSWSILEYGDQMDVVNQLDPAKESLRWTTDYFIKAHPSDNVLYIQVGDPKVDHPC  179

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE M   RPL  ++A  P
Sbjct  180  WERPETMKGKRPLIKVDADTP  200



>ref|XP_010649048.1| PREDICTED: endoglucanase 24-like [Vitis vinifera]
 emb|CBI17386.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 145/202 (72%), Gaps = 7/202 (3%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLV-KKKHGGGGSSEPDaapvpgppgavTQK  386
            M  + +   GWC W+LV+ +AA +  S  + +         SS PD            + 
Sbjct  1    METEPKKSKGWCWWILVLAIAAMVVASATLTIWSNGRHSKVSSVPDRPGKI------AEN  54

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y DALKIA+QFFD+QKSGKLV+NKI WRGDSGL+DG+   LDLSKGMYDAGD MKFGFPM
Sbjct  55   YADALKIAIQFFDIQKSGKLVNNKIDWRGDSGLEDGREEMLDLSKGMYDAGDHMKFGFPM  114

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W ILEYGD M  VKQL  A+ SLKWITDYL+NAHP  N+LY+QVGDP+LDH+
Sbjct  115  AFTATVLSWAILEYGDHMKAVKQLGNAQASLKWITDYLINAHPSPNLLYVQVGDPELDHE  174

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE MTE RP+T +N S P
Sbjct  175  CWERPEAMTEKRPVTQVNTSFP  196



>ref|XP_009386441.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=523

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY  AL +A+QFF +QKSGKLV+NK SWRGDS L DGK A LDLSKGMYD+GD MKFGF
Sbjct  51   QKYASALAVALQFFQLQKSGKLVNNKFSWRGDSALDDGKEAGLDLSKGMYDSGDHMKFGF  110

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMAYTATVL+W+ILEYGDQM+ VK LE A  +LKWITDY +NAHP DNVLY+QVGDPD+D
Sbjct  111  PMAYTATVLSWSILEYGDQMSAVKLLESALDALKWITDYFINAHPSDNVLYVQVGDPDID  170

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPE M E RPLT +N S+P
Sbjct  171  HKCWERPETMIEKRPLTQVNKSIP  194



>ref|NP_001145749.1| hypothetical protein [Zea mays]
 gb|ACL52523.1| unknown [Zea mays]
 tpg|DAA62473.1| TPA: hypothetical protein ZEAMMB73_855274 [Zea mays]
Length=526

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 151/197 (77%), Gaps = 2/197 (1%)
 Frame = +3

Query  222  SRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDAL  401
            S+   G CGWL+V ++AA +  +    + K+  GG   +P   PVPGPPGA+  KYGDAL
Sbjct  3    SKYTRGCCGWLIVALIAALVATAAMFAIMKRKPGGRHIKP--LPVPGPPGAIDSKYGDAL  60

Query  402  KIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTAT  581
             +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA+TAT
Sbjct  61   GVALQFFQVQKAGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMAFTAT  120

Query  582  VLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRP  761
            VL+W++LEYGDQM+  KQL+PA  +LKWITD+L+ AHP DNVLYIQVGDPDLDH CW+RP
Sbjct  121  VLSWSVLEYGDQMSAAKQLDPALDALKWITDFLIAAHPSDNVLYIQVGDPDLDHNCWERP  180

Query  762  EDMTESRPLTXINASVP  812
            E MTE RPLT IN   P
Sbjct  181  ETMTEKRPLTQINKKTP  197



>ref|XP_002462729.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
 gb|EER99250.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
Length=525

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 153/201 (76%), Gaps = 5/201 (2%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            MG  +R   G CGWL+V ++AA +  +    + K+  GG   +P   PVPGPPGA+  KY
Sbjct  1    MGKYTR---GCCGWLIVALIAALVATAAMFAIMKRKPGGRHIKP--LPVPGPPGAIDSKY  55

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
            GDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA
Sbjct  56   GDALGVALQFFQVQKAGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMA  115

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W++LEYGDQM+  KQL+PA  +LKWITD+L+ AHP DNVLYIQVGDPDLDH C
Sbjct  116  FTATVLSWSVLEYGDQMSAAKQLDPALDALKWITDFLIAAHPSDNVLYIQVGDPDLDHNC  175

Query  750  WQRPEDMTESRPLTXINASVP  812
            W+RPE MTE RPLT IN   P
Sbjct  176  WERPETMTEKRPLTQINKKSP  196



>ref|XP_002300715.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE79988.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97188.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97215.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            +KY DALKIAMQFFD+Q+SG+L   NK SWRGDS L DG  A LDLSKGMYDAGDLMKFG
Sbjct  53   KKYADALKIAMQFFDIQRSGELGYSNKFSWRGDSTLTDGSQAKLDLSKGMYDAGDLMKFG  112

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYG QMAVV QL+PA+ SLKWITDYL+NAHP++NVLY+QVGDP++
Sbjct  113  FPMAFTATVLSWAILEYGGQMAVVNQLDPAQDSLKWITDYLINAHPEENVLYVQVGDPEI  172

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPE M+E RPLT IN S P
Sbjct  173  DHGCWERPEVMSEKRPLTQINTSSP  197



>emb|CDY66396.1| BnaAnng22170D [Brassica napus]
Length=533

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 148/206 (72%), Gaps = 9/206 (4%)
 Frame = +3

Query  195  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  374
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDVAP---------GS  61

Query  375  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
              +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKF
Sbjct  62   TDKKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGDHMKF  121

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFPMA+TAT+L+W+ILEYGD M  + QL+PAK SLKW TD+L+NAHP  NVLYIQVGDP+
Sbjct  122  GFPMAFTATLLSWSILEYGDHMDSLDQLDPAKDSLKWTTDFLINAHPSPNVLYIQVGDPE  181

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCW RPE M+  R LT I+A  P
Sbjct  182  TDHKCWDRPETMSRKRTLTKIDADTP  207



>ref|XP_004291374.1| PREDICTED: endoglucanase 10-like [Fragaria vesca subsp. vesca]
Length=529

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 149/203 (73%), Gaps = 6/203 (3%)
 Frame = +3

Query  210  MGDKSRSKG-GWCGWLLvvivaaaig-vsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  383
            MG K  SKG  W  W +V +V A I      V++KKK     +  P      GPPGAV  
Sbjct  1    MGAKQDSKGCKWLSWFIVFVVLAVIAGAVALVMIKKKQNDKDNEVP----TMGPPGAVVD  56

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALK AMQFFD+QKSGKLV+NKISWRGDSGLKDG+   +DLSKGMYDAGD MKFGFP
Sbjct  57   KYSDALKTAMQFFDIQKSGKLVNNKISWRGDSGLKDGEDVKVDLSKGMYDAGDHMKFGFP  116

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W+ILEYGD M  V QLE A+ SLKWITDYLV AHPDDNVLYIQVGDP  DH
Sbjct  117  MAFTATVLSWSILEYGDHMDKVDQLEKAQDSLKWITDYLVKAHPDDNVLYIQVGDPKADH  176

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            +CW RPEDMT  RP+  +N + P
Sbjct  177  ECWNRPEDMTGDRPVIQVNTTAP  199



>ref|XP_010935039.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=520

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY +AL +A+QFF VQKSGKLV+NKI WRGDSGL DGK   +DLSKGMYDAGD MKFGF
Sbjct  48   QKYAEALSVALQFFQVQKSGKLVNNKIPWRGDSGLDDGKEEKVDLSKGMYDAGDHMKFGF  107

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQM   KQL+PA  +LKWITDYL+NAHP D VLY+QVGDPDLD
Sbjct  108  PMAFTATVLSWSILEYGDQMKAAKQLDPALDALKWITDYLINAHPSDGVLYVQVGDPDLD  167

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE+MT+ RP+T IN   P
Sbjct  168  HKCWDRPEEMTKKRPVTQINKKTP  191



>gb|KJB43353.1| hypothetical protein B456_007G195700, partial [Gossypium raimondii]
Length=521

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY DAL++A+QFFDVQKSGKLVDN+I WRGDSGL+DG   +LDLSKGMYDAGD +KFGF
Sbjct  55   KKYADALELALQFFDVQKSGKLVDNRIPWRGDSGLQDGSEENLDLSKGMYDAGDAIKFGF  114

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQM  VKQL  A  SL+WITDYL+N+HP +NVLY QVGDP LD
Sbjct  115  PMAFTATVLSWSILEYGDQMNAVKQLGYAYNSLRWITDYLINSHPSENVLYFQVGDPGLD  174

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPE MTE RP+T +N S P
Sbjct  175  HKCWERPETMTERRPVTQVNTSFP  198



>ref|XP_006466419.1| PREDICTED: endoglucanase 2-like [Citrus sinensis]
Length=551

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGDLMKFG
Sbjct  77   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGDLMKFG  136

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYGD M  VKQLE A+ SLKWITDYL+NAHP  N+LYIQVGDPDL
Sbjct  137  FPMAFTATVLSWAILEYGDHMNAVKQLEHAQESLKWITDYLINAHPSQNMLYIQVGDPDL  196

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPE M+E RPLT IN + P
Sbjct  197  DHSCWERPETMSEKRPLTQINTTFP  221



>ref|XP_006426144.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
 gb|ESR39384.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
Length=550

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGDLMKFG
Sbjct  76   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGDLMKFG  135

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYGD M  VKQLE A+ SLKWITDYL+NAHP  N+LYIQVGDPDL
Sbjct  136  FPMAFTATVLSWAILEYGDHMNAVKQLEHAQESLKWITDYLINAHPSQNMLYIQVGDPDL  195

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPE M+E RPLT IN + P
Sbjct  196  DHSCWERPETMSEKRPLTQINTTFP  220



>ref|XP_009103373.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=533

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 148/206 (72%), Gaps = 9/206 (4%)
 Frame = +3

Query  195  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  374
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDVAP---------GS  61

Query  375  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
              +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKF
Sbjct  62   TDKKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGDHMKF  121

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFPMA+TAT+L+W+ILEYG+ M  + QL+PAK SLKW TD+L+NAHP  NVLYIQVGDP+
Sbjct  122  GFPMAFTATLLSWSILEYGNHMDSLDQLDPAKDSLKWTTDFLINAHPSPNVLYIQVGDPE  181

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCW RPE M+  R LT I+A  P
Sbjct  182  TDHKCWDRPETMSRKRTLTKIDADTP  207



>gb|KDO78852.1| hypothetical protein CISIN_1g048736mg [Citrus sinensis]
Length=550

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGDLMKFG
Sbjct  76   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGDLMKFG  135

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYGD M  VKQLE A+ SLKWITDYL+NAHP  N+LYIQVGDPDL
Sbjct  136  FPMAFTATVLSWAILEYGDHMNAVKQLEHAQESLKWITDYLINAHPSQNMLYIQVGDPDL  195

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPE M+E RPLT IN + P
Sbjct  196  DHSCWERPETMSEKRPLTQINTTFP  220



>emb|CDY43425.1| BnaC07g14920D [Brassica napus]
Length=533

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 148/206 (72%), Gaps = 9/206 (4%)
 Frame = +3

Query  195  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  374
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDIAP---------GS  61

Query  375  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
              +KY DALKIAMQFF++QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKF
Sbjct  62   TDKKYADALKIAMQFFNIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGDHMKF  121

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFPMA+TAT+L+W+ILEYGD M  + QL+PAK SLKW TD+L+NAHP  NVLYIQVGDP+
Sbjct  122  GFPMAFTATLLSWSILEYGDHMDSLDQLDPAKDSLKWTTDFLINAHPSPNVLYIQVGDPE  181

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCW RPE M+  R LT I+A  P
Sbjct  182  TDHKCWDRPETMSRKRTLTKIDADTP  207



>ref|XP_011028991.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=523

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            +KY DALKIAMQFFD+Q+S +L   NK SWRGDS L DG  A LDLSKGMYDAGDLMKFG
Sbjct  53   KKYADALKIAMQFFDIQRSAELGYCNKFSWRGDSALTDGSQAKLDLSKGMYDAGDLMKFG  112

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYG QMAVV QL+PA+ SLKWITDYL+NAHP++NVLY+QVGDP++
Sbjct  113  FPMAFTATVLSWAILEYGGQMAVVNQLDPAQDSLKWITDYLINAHPEENVLYVQVGDPEI  172

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPE M+E RPLT IN S P
Sbjct  173  DHGCWERPEVMSEKRPLTQINTSSP  197



>ref|XP_010029690.1| PREDICTED: endoglucanase 2-like [Eucalyptus grandis]
Length=527

 Score =   236 bits (601),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY DAL IAMQFFDVQKSG+LV+N+ISWRGDSGL DG    LDLSKGMYDAGD MKF F
Sbjct  54   QKYADALGIAMQFFDVQKSGQLVNNRISWRGDSGLMDGSGEGLDLSKGMYDAGDSMKFSF  113

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W ILEYGDQM  VKQL  A+ SLKWITDYL+NAHP  NVLYIQVGDPDLD
Sbjct  114  PMAFTATMLSWAILEYGDQMDAVKQLRNAQDSLKWITDYLINAHPSPNVLYIQVGDPDLD  173

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H+CWQRPE MT  RPLT +  S P
Sbjct  174  HECWQRPESMTLQRPLTQVITSYP  197



>gb|KCW56649.1| hypothetical protein EUGRSUZ_I02356 [Eucalyptus grandis]
Length=523

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY DAL IAMQFFDVQKSG+LV+N+ISWRGDSGL DG    LDLSKGMYDAGD MKF F
Sbjct  50   QKYADALGIAMQFFDVQKSGQLVNNRISWRGDSGLMDGSGEGLDLSKGMYDAGDSMKFSF  109

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W ILEYGDQM  VKQL  A+ SLKWITDYL+NAHP  NVLYIQVGDPDLD
Sbjct  110  PMAFTATMLSWAILEYGDQMDAVKQLRNAQDSLKWITDYLINAHPSPNVLYIQVGDPDLD  169

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H+CWQRPE MT  RPLT +  S P
Sbjct  170  HECWQRPESMTLQRPLTQVITSYP  193



>ref|XP_008241905.1| PREDICTED: endoglucanase 24-like [Prunus mume]
Length=533

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             QKY +AL+++MQFFD+QKSGKLVDN I WRGDSGL+DG    LDLSKG+YD+GDL+KFG
Sbjct  59   VQKYSEALQLSMQFFDIQKSGKLVDNPIPWRGDSGLQDGSEEDLDLSKGLYDSGDLIKFG  118

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+T TVL+W ILEYGDQM  VKQL+ A  SLKWITDYL+NAHP  N LYIQVGDPDL
Sbjct  119  FPMAFTGTVLSWGILEYGDQMKAVKQLDHAHDSLKWITDYLINAHPSPNELYIQVGDPDL  178

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DHKCWQRPE MTE RPL  IN S P
Sbjct  179  DHKCWQRPEVMTEERPLIQINTSFP  203



>ref|XP_008372790.1| PREDICTED: endoglucanase 24-like [Malus domestica]
Length=537

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY +AL+I+MQFFD QKSGKLVDN I WRGDSGL+DG    LDLSKG+YDAGDL+KFGFP
Sbjct  65   KYSEALQISMQFFDAQKSGKLVDNPIPWRGDSGLQDGSEDDLDLSKGLYDAGDLIKFGFP  124

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W ILEYGDQM  VKQL+ A  SLKWITDYL+NAHP  NVLY+QVGDP+LDH
Sbjct  125  MAFTATVLSWAILEYGDQMKAVKQLDHAHDSLKWITDYLINAHPSPNVLYVQVGDPELDH  184

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPE MTE RPL  IN S P
Sbjct  185  NCWQRPEVMTEKRPLIQINTSFP  207



>ref|XP_009378180.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
 ref|XP_009378181.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=537

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY +AL+I+MQFFD QKSGKLVDN I WRGDSGL+DG    LDLSKG+YDAGDL+KFGFP
Sbjct  65   KYSEALQISMQFFDAQKSGKLVDNPIPWRGDSGLQDGSEEDLDLSKGLYDAGDLIKFGFP  124

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W ILEYGD+M  VKQL+ A  SLKWITDYL+NAHP  NVLY+QVGDP+LDH
Sbjct  125  MAFTATVLSWAILEYGDRMKAVKQLDHAHDSLKWITDYLINAHPSPNVLYVQVGDPELDH  184

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            +CWQRPE MTE RPL  IN S P
Sbjct  185  RCWQRPEVMTEKRPLIQINTSFP  207



>ref|XP_010113364.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC35371.1| Endoglucanase 24 [Morus notabilis]
Length=544

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            +Y  AL+IAMQFFDVQKSGKLVDN+I WRGDSGL+DG   +LDLSKGMYDAGDL+KFGFP
Sbjct  61   QYAKALEIAMQFFDVQKSGKLVDNRIWWRGDSGLQDGIDQNLDLSKGMYDAGDLVKFGFP  120

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+TAT+L+W ILEYGDQM  VKQL  A+ SLKWITDYLVNAHP  NVLYIQVGDP+LDH
Sbjct  121  LAFTATILSWAILEYGDQMEAVKQLGFAQDSLKWITDYLVNAHPSPNVLYIQVGDPELDH  180

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCWQRPE MTE RP   IN S P
Sbjct  181  KCWQRPEAMTEKRPTLQINTSFP  203



>emb|CDP04112.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY +AL +AMQFF+VQKSGKLVDNKI+WRGDSGL+DG+  +LDLSKGMYDAGD MKFGF
Sbjct  59   EKYANALGVAMQFFEVQKSGKLVDNKIAWRGDSGLQDGREENLDLSKGMYDAGDDMKFGF  118

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W ILEYG  M  +KQL+ A+ SLKW+TDYL+NAHP DNVL IQVGDP++D
Sbjct  119  PMAFTATMLSWAILEYGQHMQEMKQLKNAQDSLKWVTDYLLNAHPSDNVLIIQVGDPEVD  178

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW+RPE +TE+RPLT +N S P
Sbjct  179  HNCWERPEAITEARPLTQVNISYP  202



>ref|XP_008788648.1| PREDICTED: endoglucanase 24 [Phoenix dactylifera]
Length=524

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY +AL +A+QFF VQKSGKLV+N+I WRGDSGL DGK   +DLSKGMYDAGD MKFGF
Sbjct  52   QKYAEALSVALQFFQVQKSGKLVNNEIPWRGDSGLDDGKEEKVDLSKGMYDAGDHMKFGF  111

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQM  VKQL+PA  +LKWI DYL+NAHP D+VLY+QVGD DLD
Sbjct  112  PMAFTATVLSWSILEYGDQMKAVKQLDPALDALKWIMDYLINAHPSDDVLYVQVGDTDLD  171

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE+MTE RP+T IN   P
Sbjct  172  HKCWDRPEEMTEKRPVTQINEKTP  195



>ref|XP_011462352.1| PREDICTED: endoglucanase 2-like [Fragaria vesca subsp. vesca]
Length=531

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             Q Y DAL +A QFFD QKSGKLV N++ WRGDSGL+DG    LDLSKGMYDAGDL+KFG
Sbjct  58   VQNYSDALGLATQFFDAQKSGKLVVNRVGWRGDSGLRDGSEEGLDLSKGMYDAGDLIKFG  117

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W+ILEYG+QM  VKQL  A  SLKWITDYL+NAHP  NVLYIQVGDP+L
Sbjct  118  FPMAFTATVLSWSILEYGEQMKKVKQLGHAHDSLKWITDYLINAHPSPNVLYIQVGDPEL  177

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DHKCWQRPE MTE RPL  IN S P
Sbjct  178  DHKCWQRPETMTERRPLVQINTSFP  202



>ref|XP_010501531.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=517

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 146/201 (73%), Gaps = 9/201 (4%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            M  K RS+   C W + +IV  A+ +++ +  K +       +P         G++ +KY
Sbjct  1    MVAKPRSRCCCCTWFIGIIVLIAVILAVVLTFKHRSNHSDDDQP---------GSIDKKY  51

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  ASLDLSKG+YDAGD MKFGFPMA
Sbjct  52   ADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASLDLSKGLYDAGDHMKFGFPMA  111

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQMA V  L+ AK SLKW TD+L+NAHP  NVLYIQVG+P+ DHKC
Sbjct  112  FTATVLSWSILEYGDQMASVNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGNPETDHKC  171

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE MT +R LT I+   P
Sbjct  172  WDRPETMTRNRTLTKIDTETP  192



>ref|XP_010941260.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941261.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941262.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941263.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941264.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=524

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            TQKY DAL +A+QFF VQKSG+LV+NKI WRG+S L DGK   +DLSKGMYDAGD MKFG
Sbjct  51   TQKYADALSVALQFFQVQKSGQLVNNKIPWRGNSALDDGKEEGVDLSKGMYDAGDHMKFG  110

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W+ILEYGDQM   K L PA  +L+WITDYL+NAHP DNVLY+QVGDPD+
Sbjct  111  FPMAFTATVLSWSILEYGDQMKAAKHLNPALDALQWITDYLINAHPADNVLYVQVGDPDV  170

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DHKCW RPE+MTE RP+T I+   P
Sbjct  171  DHKCWDRPEEMTEKRPVTKIDKKTP  195



>dbj|BAJ93299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KYGDAL +A+QFF VQK+GKLVDN+I WRGDS L DGK A LDLSKG+YDAGD MKF FP
Sbjct  60   KYGDALGVALQFFQVQKAGKLVDNQIPWRGDSALTDGKEAKLDLSKGLYDAGDHMKFTFP  119

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVLAW++LEYGDQM   KQL+PA  +L+W+TD+L+ AHP DNV YIQVGDPDLDH
Sbjct  120  MAFTATVLAWSVLEYGDQMTAAKQLDPALDALRWVTDFLIAAHPSDNVFYIQVGDPDLDH  179

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPE MTE RPLT IN   P
Sbjct  180  DCWQRPETMTEKRPLTQINPKNP  202



>ref|XP_008799407.1| PREDICTED: endoglucanase 24-like [Phoenix dactylifera]
Length=524

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
            TQKY +AL +A+QFF VQKSGKLV+NKI+WRGDS L DGK   +DLSKGMYDAGD MKFG
Sbjct  51   TQKYAEALSVALQFFQVQKSGKLVNNKITWRGDSALDDGKEEGVDLSKGMYDAGDHMKFG  110

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W+ILEYGDQM   K L PA  +L+WITDYL+NAHP D+VL +QVGDPD+
Sbjct  111  FPMAFTATVLSWSILEYGDQMKAAKHLNPALDALQWITDYLINAHPSDDVLIVQVGDPDV  170

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DHKCW RPE+MTE RP+T IN   P
Sbjct  171  DHKCWDRPEEMTEKRPVTKINKKTP  195



>ref|XP_010459672.1| PREDICTED: endoglucanase 2 [Camelina sativa]
 ref|XP_010459674.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=518

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 9/201 (4%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  389
            M  K +S+   C WL+ +IV  A+ +++ +  + +    G  +P         G++ +KY
Sbjct  1    MVAKPKSRCCCCTWLIGIIVLIAVILAVVLTFRHRSNHSGDDQP---------GSIDKKY  51

Query  390  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  569
             DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGFPMA
Sbjct  52   ADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGFPMA  111

Query  570  YTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKC  749
            +TATVL+W+ILEYGDQMA V  L+ AK SLKW TD+L+NAHP  NVLYIQVG+P+ DHKC
Sbjct  112  FTATVLSWSILEYGDQMASVNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGNPETDHKC  171

Query  750  WQRPEDMTESRPLTXINASVP  812
            W RPE M+ +R LT I+   P
Sbjct  172  WDRPETMSRNRTLTKIDTETP  192



>gb|KFK44119.1| hypothetical protein AALP_AA1G218000 [Arabis alpina]
Length=517

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  ASLDLSKG+YDAGD MKFGF
Sbjct  48   KKYSDALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGSEASLDLSKGLYDAGDHMKFGF  107

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQM  VK L+ AK SLKW TD+ +NAHP  NVLYIQVGDP+ D
Sbjct  108  PMAFTATVLSWSILEYGDQMDSVKLLDHAKESLKWTTDFFINAHPSANVLYIQVGDPETD  167

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE M+  R LT I+   P
Sbjct  168  HKCWDRPETMSRKRTLTKIDTETP  191



>emb|CDX73186.1| BnaC06g36340D [Brassica napus]
Length=527

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavT-QK  386
            MG+KS+S+G + GW + +IV AA+ +++  +VK K      ++ D A     P     +K
Sbjct  1    MGEKSKSRGCF-GWFIALIVLAAVILAVVYMVKSKMNKSDDNDDDEAGPVPGPPGAIDKK  59

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPM
Sbjct  60   YADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPM  119

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W+ILEY DQM  V  L+PAK SLKW TDY + AHP DNVLYIQVGDP++DH 
Sbjct  120  AFTATVLSWSILEYADQMDAVNLLDPAKDSLKWTTDYFIKAHPSDNVLYIQVGDPEVDHP  179

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE M   RP+  I+A  P
Sbjct  180  CWERPETMKGKRPVIKIDADTP  201



>gb|AAF79918.1|AC022472_27 Contains similarity to beta-1,4-glucanase 1 (EG1) from Mastotermes 
darwiniensis gb|AF220593 and is a member of glycosyl hydrolase 
family 9 PF|00759. This gene may be cut off, partial 
[Arabidopsis thaliana]
Length=300

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct  47   KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGF  106

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQMA +  L+ AK SLKW TD+L+NAHP  NVLYIQVGDP  D
Sbjct  107  PMAFTATVLSWSILEYGDQMASLNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGDPVTD  166

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE MT  R LT I+   P
Sbjct  167  HKCWDRPETMTRKRTLTKIDTKTP  190



>ref|XP_009803640.1| PREDICTED: endoglucanase 2-like [Nicotiana sylvestris]
Length=527

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              KY +AL IAM+FFDVQKSGKLV+NKI+WRGDS + DG  A+LDL+KGM+DAGD +KFG
Sbjct  51   VNKYANALSIAMRFFDVQKSGKLVNNKIAWRGDSAMGDGSEANLDLTKGMFDAGDHVKFG  110

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W+ILEYG+ M +V +LE A  SLKWITD+L+NAHP DNVLYIQVGDP L
Sbjct  111  FPMAFTATVLSWSILEYGNNMKLVNELENAHESLKWITDFLINAHPSDNVLYIQVGDPKL  170

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPE MT  RPLT +NA+ P
Sbjct  171  DHTCWERPEVMTRKRPLTHVNATYP  195



>ref|XP_006661478.1| PREDICTED: endoglucanase 24-like [Oryza brachyantha]
Length=498

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KYGDAL +A+QFF VQK+GKL +N+I WRGDS   DGK A LDLSKGMYDAGD MKF FP
Sbjct  27   KYGDALGVALQFFQVQKAGKLENNQIPWRGDSATDDGKQAGLDLSKGMYDAGDHMKFTFP  86

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W+ILEYGDQM+  KQL+PA  +L+WITD+L+NAHP DNV YIQVGDPDLDH
Sbjct  87   MAFTATVLSWSILEYGDQMSAAKQLDPALDALRWITDFLINAHPSDNVFYIQVGDPDLDH  146

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW+RPE M+E RPLT IN   P
Sbjct  147  NCWERPETMSEKRPLTQINTKSP  169



>ref|XP_006416450.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
 gb|ESQ34803.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
Length=523

 Score =   231 bits (588),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKFGF
Sbjct  54   KKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGNEASLDLSKGLYDAGDHMKFGF  113

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEY DQM  + QL+PAK +LKW TD+L+NAHP  NVLYIQVGDP++D
Sbjct  114  PMAFTATVLSWSILEYADQMDSLNQLDPAKHTLKWTTDFLINAHPSANVLYIQVGDPEVD  173

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE M+  R LT I+   P
Sbjct  174  HKCWDRPETMSRKRSLTKIDTETP  197



>ref|XP_009624009.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=527

 Score =   231 bits (588),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY +AL IAMQFFD+QKSGKLV+NKI+WRGDS + DG   +LDL+KGMYDAGD +KFGFP
Sbjct  53   KYANALSIAMQFFDIQKSGKLVNNKIAWRGDSAMGDGSEVNLDLTKGMYDAGDHVKFGFP  112

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W+ILEYG+ M +V +LE A+ SLKWITD+L+NAHP DNVLYIQVGDP LDH
Sbjct  113  MAFTATVLSWSILEYGNNMKLVNELENAQESLKWITDFLINAHPSDNVLYIQVGDPKLDH  172

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW+RPE MT  RPLT +NA+ P
Sbjct  173  TCWERPEVMTGKRPLTQVNATYP  195



>ref|XP_010477219.1| PREDICTED: endoglucanase 2-like [Camelina sativa]
Length=517

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct  49   KKYADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGF  108

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQMA V  L+ AK SLKW TD+L+NAHP  NVLYIQVG+P+ D
Sbjct  109  PMAFTATVLSWSILEYGDQMASVDLLDHAKYSLKWTTDFLINAHPSPNVLYIQVGNPETD  168

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE MT +R LT ++   P
Sbjct  169  HKCWDRPETMTRNRTLTKVDTETP  192



>ref|XP_011043209.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=530

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             +KY DAL+IA+QFFDVQKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGDLMKFG
Sbjct  56   VKKYADALEIALQFFDVQKSGKLVNNRIVWRGDSGLLDGIEMNLDLSKGMYDAGDLMKFG  115

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TAT+L+W ILEYG+ M  VKQL  A+ SLKWITD+L+NAHP +NVLYIQVGDP+L
Sbjct  116  FPMAFTATMLSWAILEYGENMKTVKQLGHARDSLKWITDFLINAHPSENVLYIQVGDPEL  175

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH+CW+RPE +   RPLT +N S P
Sbjct  176  DHQCWERPETIRGIRPLTQVNTSFP  200



>ref|XP_003578508.1| PREDICTED: endoglucanase 24 [Brachypodium distachyon]
Length=529

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KYGDAL IA+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKG+YDAGD MKF FP
Sbjct  58   KYGDALGIALQFFQVQKAGKLENNEIPWRGDSALDDGKEAKLDLSKGLYDAGDHMKFSFP  117

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVLAW++LEYGDQM   KQL+PA  +L+WITD+L+ AHP DNV YIQVGDPDLDH
Sbjct  118  MAFTATVLAWSVLEYGDQMNAAKQLDPALDALRWITDFLIAAHPSDNVFYIQVGDPDLDH  177

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW+RPE MTE RPLT IN   P
Sbjct  178  NCWERPETMTEKRPLTQINPKSP  200



>ref|XP_009106216.1| PREDICTED: endoglucanase 10-like [Brassica rapa]
Length=527

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavT-QK  386
            MG+KS+S+G + GW + +IV AA+ +++  +VK K      ++ + A     P     +K
Sbjct  1    MGEKSKSRGCF-GWFIALIVLAAVILAVVYMVKSKMKKPDDNDDNEAGPVPGPPGAIDKK  59

Query  387  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  566
            Y DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPM
Sbjct  60   YADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPM  119

Query  567  AYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHK  746
            A+TATVL+W+ILEY DQM  V  L+PAK SLKW TDY V AHP DNVLYIQVGDP++DH 
Sbjct  120  AFTATVLSWSILEYADQMDAVNLLDPAKDSLKWTTDYFVKAHPSDNVLYIQVGDPEVDHP  179

Query  747  CWQRPEDMTESRPLTXINASVP  812
            CW+RPE M   RP+  I+A  P
Sbjct  180  CWERPETMKGKRPVIKIDADTP  201



>ref|XP_004232483.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=526

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             +KY +AL IAMQFFDVQKSGKLV+NKI+WRGDS + DG   +LDLS+GMYDAGD +KFG
Sbjct  50   VEKYANALSIAMQFFDVQKSGKLVNNKIAWRGDSAMGDGSEVNLDLSRGMYDAGDHVKFG  109

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYG+ M +V +L+ A  SLKWITD+L NAHP +NVLYIQVGDP L
Sbjct  110  FPMAFTATVLSWAILEYGNHMNMVNELDNAHESLKWITDFLTNAHPSENVLYIQVGDPKL  169

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPE MT  RPLT +N S P
Sbjct  170  DHTCWERPEAMTGKRPLTQVNTSYP  194



>ref|XP_006307252.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
 gb|EOA40150.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
Length=517

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            +KY DALKIA+QFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct  48   KKYADALKIALQFFDIQKSGKLENNKISWRGDSGLKDGSDASIDLSKGLYDAGDHMKFGF  107

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+T +VL+W+ILEYGDQMA V  L+ AK SLKW TD+LVNAHP  NVLYIQVGDP+ D
Sbjct  108  PMAFTTSVLSWSILEYGDQMASVNLLDHAKDSLKWTTDFLVNAHPSPNVLYIQVGDPETD  167

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE M+  R LT I+   P
Sbjct  168  HKCWDRPETMSRKRTLTKIDTKTP  191



>ref|XP_002893081.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69340.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            + Y +ALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  A++DLSKG+YDAGD MKFGF
Sbjct  48   KNYANALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEANIDLSKGLYDAGDHMKFGF  107

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQMA V  L+ AK SLKW TD+L+NAHP  NVLYIQVGDP  D
Sbjct  108  PMAFTATVLSWSILEYGDQMASVNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGDPVTD  167

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE MT  R LT I+   P
Sbjct  168  HKCWDRPETMTRKRTLTKIDTETP  191



>gb|AID55379.1| glycoside hydrolase family 9 B7 [Gossypium hirsutum]
Length=525

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALKIAMQFFDVQKSGKLVD+KI WRG+SGLKDG  A LDLS GMYDAGD +KFGFP
Sbjct  53   KYSDALKIAMQFFDVQKSGKLVDDKIPWRGNSGLKDGSEAKLDLSMGMYDAGDNIKFGFP  112

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W ILEYG+ M  + Q EPA+ SL WITD+L+NAHP  NVLYIQVGDP  DH
Sbjct  113  MAFTATVLSWAILEYGEHMEHINQREPAENSLSWITDFLLNAHPSQNVLYIQVGDPKEDH  172

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW++PE MT  RPL  +N+S P
Sbjct  173  KCWEKPEKMTTKRPLKLVNSSKP  195



>gb|KJB63540.1| hypothetical protein B456_010G005200 [Gossypium raimondii]
Length=525

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALKIAMQFFDVQKSGKLVD+KI WRG+SGLKDG  A LDLS GMYDAGD +KFGFP
Sbjct  53   KYSDALKIAMQFFDVQKSGKLVDDKIPWRGNSGLKDGSEAKLDLSMGMYDAGDNIKFGFP  112

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W ILEYG+ M  + Q EPA+ SL WITD+L+NAHP  NVLYIQVGDP  DH
Sbjct  113  MAFTATVLSWAILEYGEHMEHINQREPAENSLAWITDFLLNAHPSQNVLYIQVGDPKEDH  172

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW++PE MT  RPL  +N+S P
Sbjct  173  KCWEKPEKMTTKRPLKLVNSSKP  195



>emb|CDY47506.1| BnaAnng09040D [Brassica napus]
Length=499

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD +KFGFP
Sbjct  31   KYADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFP  90

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W+ILEY DQM  V  L+PAK SLKW TDY V AHP DNVLYIQVGDP++DH
Sbjct  91   MAFTATVLSWSILEYADQMDAVNLLDPAKDSLKWTTDYFVTAHPSDNVLYIQVGDPEVDH  150

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW+RPE M   RP+  I+A  P
Sbjct  151  PCWERPETMKGKRPVIKIDADTP  173



>ref|XP_003519870.1| PREDICTED: endoglucanase 24-like [Glycine max]
Length=535

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 144/206 (70%), Gaps = 3/206 (1%)
 Frame = +3

Query  195  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  374
            K  +K  +K    G  C WL V I+A  + V+  + +  K   G S+ P+    P     
Sbjct  4    KVNDKEPNKKHYVGALCWWLTVSIIAVLVVVAGVLSLITKFKFGHSNSPEFTSHPTNV--  61

Query  375  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
              QKY  AL++A+QFFDVQKSGKL + ++ WRGDSGL+DG   +LDLSKGMYDAGD MKF
Sbjct  62   -VQKYASALELALQFFDVQKSGKLENKRVWWRGDSGLRDGSEENLDLSKGMYDAGDHMKF  120

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+TATVL+W ILEYG +M  VKQL  A  SLKWITDYLVNAHP   VLYIQVGDP+
Sbjct  121  GFPLAFTATVLSWAILEYGGRMDAVKQLHYALDSLKWITDYLVNAHPFPEVLYIQVGDPE  180

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
            +DH CW+RPEDM E RPLT +N+S P
Sbjct  181  VDHNCWERPEDMKEKRPLTQVNSSFP  206



>ref|XP_003629333.1| Endoglucanase [Medicago truncatula]
 gb|AET03809.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=534

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY  +L++A+QFFDVQKSGK+ +N++ WRGDSGL+DG   +LDLSKG+YDAGDLMKFGFP
Sbjct  63   KYASSLQLALQFFDVQKSGKVQNNRVWWRGDSGLRDGSEENLDLSKGLYDAGDLMKFGFP  122

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W ILEYG+ M  VKQL+ A  SLKWITDYLVNAHP  +VLYIQVGDP++DH
Sbjct  123  MAFTATVLSWAILEYGNNMDAVKQLDYALESLKWITDYLVNAHPFADVLYIQVGDPEVDH  182

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW+RPE+MTE RPLT +N+S P
Sbjct  183  NCWERPENMTEKRPLTQVNSSFP  205



>ref|XP_006340729.1| PREDICTED: endoglucanase 2-like [Solanum tuberosum]
Length=526

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY +AL IAMQFFDVQKSGKLV+NKI+WRGDS L DG   +LDLS+GMYDAGD +KFGFP
Sbjct  52   KYANALSIAMQFFDVQKSGKLVNNKIAWRGDSALGDGSEVNLDLSRGMYDAGDHVKFGFP  111

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATV +W ILEYG+ M +V +L+ A  SLKWITD+L+NAHP +NVLYIQVGDP LDH
Sbjct  112  MAFTATVFSWAILEYGNHMNMVNELDNAHESLKWITDFLINAHPSENVLYIQVGDPKLDH  171

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW+RPE+MT  R LT +NAS P
Sbjct  172  TCWERPEEMTGKRLLTQVNASYP  194



>ref|NP_173423.1| glycosyl hydrolase 9B5 [Arabidopsis thaliana]
 sp|Q9FXI9.1|GUN2_ARATH RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12562.1|AC007797_22 Similar to endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAK82507.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AAM47371.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AEE29915.1| probably endoglucanase [Arabidopsis thaliana]
Length=515

 Score =   225 bits (574),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct  47   KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGF  106

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TATVL+W+ILEYGDQMA +  L+ AK SLKW TD+L+NAHP  NVLYIQVGDP  D
Sbjct  107  PMAFTATVLSWSILEYGDQMASLNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGDPVTD  166

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE MT  R LT I+   P
Sbjct  167  HKCWDRPETMTRKRTLTKIDTKTP  190



>ref|XP_004509346.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=533

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY  +L++A+QFFDVQKSGK+ +N++ WRGDSGL+DG  A+LDLSKGMYDAGDL+KFGFP
Sbjct  62   KYASSLQLALQFFDVQKSGKVQNNRVWWRGDSGLRDGIEANLDLSKGMYDAGDLIKFGFP  121

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TATVL+W ILEYG  M  V QL+ A  SL WITDYLVNAHP  +VLYIQVGDP++DH
Sbjct  122  MAFTATVLSWAILEYGHHMDAVNQLDYALDSLNWITDYLVNAHPFADVLYIQVGDPEVDH  181

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW+RPEDMTE RPLT IN+S P
Sbjct  182  NCWERPEDMTEKRPLTQINSSFP  204



>ref|XP_007156152.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
 gb|ESW28146.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
Length=534

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             QKY  AL++A+QFF VQKSGK+ + ++ WRGDSGL+DG  A LDLSKGMYDAGD +KFG
Sbjct  61   VQKYASALQLALQFFYVQKSGKVENQRVLWRGDSGLRDGSEADLDLSKGMYDAGDQIKFG  120

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TATVL+W ILEYGD+M  VKQL  A  SLKWITDYLVNAHP   VLYIQVGDP++
Sbjct  121  FPMAFTATVLSWAILEYGDRMDAVKQLHYALESLKWITDYLVNAHPFPEVLYIQVGDPEV  180

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CW+RPEDM E RPLT IN+S P
Sbjct  181  DHNCWERPEDMHEERPLTQINSSSP  205



>ref|XP_009149490.1| PREDICTED: endoglucanase 2 [Brassica rapa]
 ref|XP_009149491.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=525

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            + Y DALKIAMQFFD+QKSGKL +NKI+WRGDSGL+DG  A LDLSKG+YDAGD MKFGF
Sbjct  56   KNYADALKIAMQFFDIQKSGKLENNKITWRGDSGLEDGSEAGLDLSKGLYDAGDHMKFGF  115

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W+ILEYG  M  V QL+PAK SLKWITD+L++AHP  N+LYIQVGDP+ D
Sbjct  116  PMAFTATLLSWSILEYGHHMDSVNQLDPAKDSLKWITDFLIHAHPSANLLYIQVGDPETD  175

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW RPE M+  R LT I+   P
Sbjct  176  HKCWDRPETMSTKRTLTKIDTETP  199



>ref|XP_006383120.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
 gb|ERP60917.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
Length=530

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             +KY DAL+IA+QFFD QKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGDLMKFG
Sbjct  56   VKKYADALEIALQFFDGQKSGKLVNNRIGWRGDSGLLDGIEMNLDLSKGMYDAGDLMKFG  115

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TAT+L+W ILEY + M   KQL  A+ SLKWITD+L+NAHP +NVLYIQVGDP+L
Sbjct  116  FPMAFTATMLSWAILEYEENMKTAKQLGHARDSLKWITDFLINAHPSENVLYIQVGDPEL  175

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH+CW+RPE +   RPLT +N S P
Sbjct  176  DHQCWERPEAIRGIRPLTQVNTSFP  200



>gb|AEO97190.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97217.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=530

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
             +KY DAL+IA+QFFD QKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGDLMKFG
Sbjct  56   VKKYADALEIALQFFDGQKSGKLVNNRIGWRGDSGLLDGIEMNLDLSKGMYDAGDLMKFG  115

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
            FPMA+TAT+L+W ILEY + M   KQL  A+ SLKWITD+L+NAHP +NVLYIQVGDP+L
Sbjct  116  FPMAFTATMLSWAILEYEENMKTAKQLGHARDSLKWITDFLINAHPSENVLYIQVGDPEL  175

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH+CW+RPE +   RPLT +N S P
Sbjct  176  DHQCWERPEAIRGIRPLTQVNTSFP  200



>gb|KDO84821.1| hypothetical protein CISIN_1g036398mg [Citrus sinensis]
Length=514

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
              Y  ALKIAMQFFD+QKSGKLV+N+I WRGDSGLKDGK   LDLSKGMYDAGD +KFGF
Sbjct  43   HNYVAALKIAMQFFDIQKSGKLVNNQIKWRGDSGLKDGKEVDLDLSKGMYDAGDAVKFGF  102

Query  561  PMAYTATVLAWTILEYGDQMAV--VKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            P+A+TAT+L+WTILE G +M +  V QL+ AK S+KWITDYLVNAHP DNVLY+QVGD +
Sbjct  103  PLAFTATMLSWTILERGQRMGMEGVDQLQKAKDSVKWITDYLVNAHPKDNVLYVQVGDAE  162

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCWQRPE +T+++PL  IN + P
Sbjct  163  KDHKCWQRPESITDNKPLFQINTTAP  188



>ref|XP_006435158.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
 gb|ESR48398.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
Length=480

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
              Y  ALKIAMQFFD+QKSGKLV+N+I WRGDSGLKDGK   L+LSKGMYDAGD +KFGF
Sbjct  9    HNYVAALKIAMQFFDIQKSGKLVNNQIKWRGDSGLKDGKEVDLELSKGMYDAGDAVKFGF  68

Query  561  PMAYTATVLAWTILEYGDQMAV--VKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            P+A+TAT+L+WTILE G +M +  V QL+ AK S+KWITDYLVNAHP DNVLY+QVGD +
Sbjct  69   PLAFTATMLSWTILERGQRMGMEGVDQLQKAKDSVKWITDYLVNAHPKDNVLYVQVGDAE  128

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCWQRPE +T+++PL  IN + P
Sbjct  129  KDHKCWQRPESITDNKPLFQINTTAP  154



>ref|XP_006656489.1| PREDICTED: endoglucanase 18-like [Oryza brachyantha]
Length=519

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 135/190 (71%), Gaps = 6/190 (3%)
 Frame = +3

Query  243  CGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFF  422
            C WLLV+ + A    +  V V+ K+GG G   P      G PGAV  KY DAL +A+QFF
Sbjct  8    CCWLLVLALMALAVTAAVVFVRYKNGGQGFPFP------GVPGAVDHKYTDALGVALQFF  61

Query  423  DVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTIL  602
             VQKSGKLV+N I WRGDS L DGK A LDLSKGMYDAGD MKFGFPMA+TAT+L+W+IL
Sbjct  62   QVQKSGKLVNNTIHWRGDSALDDGKEAGLDLSKGMYDAGDHMKFGFPMAFTATMLSWSIL  121

Query  603  EYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPEDMTESR  782
            EYGD M+   Q + A  +L WI DYLVNAHP D+VLYIQVGDP  DHKCW+RPE M E R
Sbjct  122  EYGDAMSAADQRDSAMDALHWIMDYLVNAHPSDDVLYIQVGDPKADHKCWERPEKMAEKR  181

Query  783  PLTXINASVP  812
            PLT I    P
Sbjct  182  PLTKITPKSP  191



>gb|KHN00484.1| Endoglucanase 24 [Glycine soja]
Length=509

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 138/199 (69%), Gaps = 3/199 (2%)
 Frame = +3

Query  195  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  374
            K  +K  +K       C WL V I+A  + V+  + +  K   G S+ P+    P     
Sbjct  4    KVNDKEPNKKHYVSALCWWLTVSIIAVLVVVAGVLSLITKFKFGHSNSPEFTSHPTNV--  61

Query  375  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
              QKY  AL++A+QFFDVQKSGKL + ++ WRGDSGL+DG   +LDLSKGMYDAGD MKF
Sbjct  62   -VQKYASALELALQFFDVQKSGKLENKRVWWRGDSGLRDGSEENLDLSKGMYDAGDHMKF  120

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+TATVL+W ILEYG +M  VKQL  A  SLKWITDYLVNAHP   VLYIQVGDP+
Sbjct  121  GFPLAFTATVLSWAILEYGGRMDAVKQLHYALDSLKWITDYLVNAHPFPEVLYIQVGDPE  180

Query  735  LDHKCWQRPEDMTESRPLT  791
            +DH CW+RPEDM E RPLT
Sbjct  181  VDHNCWERPEDMKEKRPLT  199



>ref|XP_003563568.1| PREDICTED: endoglucanase 18-like [Brachypodium distachyon]
Length=516

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 135/193 (70%), Gaps = 17/193 (9%)
 Frame = +3

Query  243  CGWLLvvivaaaigvsifvLVKKKHGGGG---SSEPDaapvpgppgavTQKYGDALKIAM  413
            C WLLV+ + A    +  V V+ K+GGGG   S +P              KY +AL +A+
Sbjct  8    CCWLLVLTLVALGITAAVVFVRHKNGGGGVPGSVDP--------------KYAEALAVAL  53

Query  414  QFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAW  593
            QFF VQKSGKLV N+I WRGDS + DG+ A LDLSKGMYDAGD +KFGFPMA+TAT+L+W
Sbjct  54   QFFQVQKSGKLVKNEIPWRGDSAVDDGQEAGLDLSKGMYDAGDHIKFGFPMAFTATMLSW  113

Query  594  TILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPEDMT  773
            ++LEYG  M   +Q + A  +L+WI DYL+NAHP D+ LYIQVGDP+ DHKCW+RPE M+
Sbjct  114  SVLEYGGAMRAARQRDSALDALRWIMDYLLNAHPSDDELYIQVGDPEADHKCWERPETMS  173

Query  774  ESRPLTXINASVP  812
            E RPLT I A  P
Sbjct  174  EKRPLTKITAKSP  186



>gb|EAZ02358.1| hypothetical protein OsI_24462 [Oryza sativa Indica Group]
Length=518

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             KY DAL +A+QFF VQKSGKLV+N I WRGDS L DGK A +DLSKGMYDAGD MKFGF
Sbjct  48   HKYADALAVALQFFQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGF  107

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W++LEYGD M    Q + A  +L WI DYLVNAHP D+VLYIQVGDP  D
Sbjct  108  PMAFTATMLSWSVLEYGDAMRAADQRDSAIDALNWIMDYLVNAHPSDDVLYIQVGDPKAD  167

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPE M E RPLT I  + P
Sbjct  168  HKCWERPEKMKEKRPLTKITPNSP  191



>ref|NP_001058583.1| Os06g0715300 [Oryza sativa Japonica Group]
 sp|Q5Z9P8.1|GUN18_ORYSJ RecName: Full=Endoglucanase 18; AltName: Full=Endo-1,4-beta glucanase 
18 [Oryza sativa Japonica Group]
 dbj|BAD53575.1| putative endo-beta-1,4-D-glucanase [Oryza sativa Japonica Group]
 dbj|BAF20497.1| Os06g0715300 [Oryza sativa Japonica Group]
Length=518

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             KY DAL +A+QFF VQKSGKLV+N I WRGDS L DGK A +DLSKGMYDAGD MKFGF
Sbjct  48   HKYADALAVALQFFQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGF  107

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W++LEYGD M    Q + A  +L WI DYLVNAHP D+VLYIQVGDP  D
Sbjct  108  PMAFTATMLSWSVLEYGDAMRAADQRDSAIDALNWIMDYLVNAHPSDDVLYIQVGDPKAD  167

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPE M E RPLT I    P
Sbjct  168  HKCWERPEKMKEKRPLTKITPKSP  191



>gb|ABE02649.1| putative glucanase/cellulase [Hordeum vulgare subsp. vulgare]
 gb|ABE02656.1| putative glucanase/cellulase [Hordeum vulgare]
Length=179

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +3

Query  300  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  479
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  480  GLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSL  659
             + DG+ A LDLS+GMYDAGD +KFGFPMA+TAT+L+W++LEYG  M   KQ + A  +L
Sbjct  78   AVDDGQEAGLDLSRGMYDAGDHIKFGFPMAFTATMLSWSVLEYGGAMEAAKQRDSAIDAL  137

Query  660  KWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPEDMTESRP  785
            +WI DYLVNAHP  +VLYIQVGDP++DHKCW+RPE M+E RP
Sbjct  138  RWIMDYLVNAHPSHDVLYIQVGDPEVDHKCWERPETMSEKRP  179



>dbj|BAK04397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 125/171 (73%), Gaps = 9/171 (5%)
 Frame = +3

Query  300  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  479
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  480  GLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSL  659
             + DG+ A LDLS+GMYDAGD +KFGFPMA+TAT+L+W++LEYG  M   KQ + A  +L
Sbjct  78   AVDDGQEAGLDLSRGMYDAGDHIKFGFPMAFTATMLSWSVLEYGGAMEAAKQRDSAIDAL  137

Query  660  KWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPEDMTESRPLTXINASVP  812
            +WI DYLVNAHP  +VLYIQVGDP++DHKCW+RPE M+E RPLT I A  P
Sbjct  138  RWIMDYLVNAHPSHDVLYIQVGDPEVDHKCWERPETMSEKRPLTKITAKSP  188



>ref|XP_006829372.1| hypothetical protein AMTR_s02175p00005920, partial [Amborella 
trichopoda]
 gb|ERM96788.1| hypothetical protein AMTR_s02175p00005920, partial [Amborella 
trichopoda]
Length=240

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  438  GKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQ  617
            GKL +N ISWRGDS L DGK  +LDLSKGMYDAGD MKFGFPMA+T TVL+WTILEYGDQ
Sbjct  1    GKLHNNPISWRGDSALDDGKEVTLDLSKGMYDAGDHMKFGFPMAFTGTVLSWTILEYGDQ  60

Query  618  MAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPEDMTESRPLTXI  797
            M   + L PA  SLKWITDYLVNAHP +NVLYIQVG+P  DH CW+RPEDM E RPLT +
Sbjct  61   MKAAQHLTPAIDSLKWITDYLVNAHPSENVLYIQVGNPKDDHACWERPEDMKEKRPLTQV  120

Query  798  NASVP  812
            N S P
Sbjct  121  NTSTP  125



>ref|XP_010530451.1| PREDICTED: endoglucanase 2-like [Tarenaya hassleriana]
Length=501

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 114/143 (80%), Gaps = 8/143 (6%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            +Y DAL +A++FFDVQ+SGKLV N+ISWRGDSGL+DG+   +DLSKGMYDAGD +KFGFP
Sbjct  49   EYTDALSVALEFFDVQRSGKLVKNRISWRGDSGLRDGREEKVDLSKGMYDAGDHIKFGFP  108

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+TAT+L+WTILEYG +        PA  SL+WITD+L+NAH   NVLYIQVGDP+LDH
Sbjct  109  MAFTATILSWTILEYGGR--------PATDSLRWITDFLLNAHVSPNVLYIQVGDPELDH  160

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPE M+E RPLT IN   P
Sbjct  161  NCWDRPETMSEIRPLTQINREKP  183



>emb|CDY44194.1| BnaC05g15510D [Brassica napus]
Length=1131

 Score =   213 bits (543),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 118/159 (74%), Gaps = 15/159 (9%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQK---------------SGKLVDNKISWRGDSGLKDGKSASLDL  515
            + Y DALKIAMQFFD+QK               +GKL +NKI+WRGDSGL+DG  A LDL
Sbjct  56   KNYADALKIAMQFFDIQKCKSSTLLAEHTHLTPAGKLENNKITWRGDSGLEDGSEAGLDL  115

Query  516  SKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHP  695
            SKG+YDAGD MKFG PMA+TAT+L+W+ILEYG  M  V QLEPAK SLKWITD+L++AHP
Sbjct  116  SKGLYDAGDHMKFGLPMAFTATLLSWSILEYGHHMDSVNQLEPAKDSLKWITDFLIHAHP  175

Query  696  DDNVLYIQVGDPDLDHKCWQRPEDMTESRPLTXINASVP  812
              NVLYIQVGDP+ DHKCW RPE M+  R LT I+   P
Sbjct  176  SANVLYIQVGDPETDHKCWDRPETMSTKRTLTKIDTETP  214



>ref|XP_002439027.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
 gb|EER90394.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Length=522

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY +AL +A++FF VQKSGKLV+N I WRGDS L+DG+ A LDLSKGMYDAGD MKFGF 
Sbjct  52   KYAEALAVALRFFQVQKSGKLVNNTIPWRGDSALRDGEDAKLDLSKGMYDAGDHMKFGFT  111

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+T T+L+W++LEYGD M    Q + A  +L WI ++LVNAHP D+VLYIQVGDP  DH
Sbjct  112  LAFTGTMLSWSVLEYGDAMRAAHQRDAAMDALGWIMEFLVNAHPSDDVLYIQVGDPKSDH  171

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW+RPE M+E RPLT I A  P
Sbjct  172  KCWERPETMSEKRPLTKITAKSP  194



>ref|XP_004966453.1| PREDICTED: endoglucanase 18-like [Setaria italica]
Length=521

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY +AL +A+QFF VQKSGKLV N+I WRGDS L DG+ A LDLSKGMYDAGD MKFGF 
Sbjct  51   KYAEALAVALQFFQVQKSGKLVRNEIPWRGDSALDDGEEAKLDLSKGMYDAGDHMKFGFT  110

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+T T+L+W++LEYGD M    Q + A  +L WI D+LVNAHP D+VLYIQVGDP  DH
Sbjct  111  LAFTGTMLSWSVLEYGDAMRAAGQRDAAMDALGWIMDFLVNAHPSDDVLYIQVGDPKADH  170

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW+RPE M+E RPLT I    P
Sbjct  171  KCWERPETMSEKRPLTKITTKSP  193



>ref|NP_001288527.1| uncharacterized protein LOC103626453 precursor [Zea mays]
 gb|AFW69494.1| hypothetical protein ZEAMMB73_138975 [Zea mays]
 gb|AGG19095.1| cellulase [Zea mays]
Length=521

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            KY +AL +A++FF VQKSGKLV+N I WRGDS L+DG+ A LDLS+GMYDAGD +KFGF 
Sbjct  51   KYAEALAVALRFFQVQKSGKLVNNTIPWRGDSALRDGEDAKLDLSRGMYDAGDHVKFGFT  110

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W++LEYGD M+  +Q + A  +L WI ++LVNAHP D+VLYIQVGDP  DH
Sbjct  111  MAFTGTMLSWSVLEYGDAMSDAQQRDAAMDALGWIMEFLVNAHPSDDVLYIQVGDPKSDH  170

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCW+RPE M+E RPLT I A  P
Sbjct  171  KCWERPETMSEKRPLTKITAKSP  193



>gb|KHN45917.1| Endoglucanase 2 [Glycine soja]
Length=570

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  420  FDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTI  599
            F    +G+LVD+KISWRG+S LKDG  A LDLSKGMYDA D MKFGFPMA+ ATVL+W+I
Sbjct  110  FRFFATGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDARDNMKFGFPMAFMATVLSWSI  169

Query  600  LEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPEDMTES  779
            LEYGDQM  V QL+ A+ SLKWITD+L+NAHP +NVLYIQVGDP  DHKCW++PE +TE 
Sbjct  170  LEYGDQMDHVGQLDAAQDSLKWITDFLINAHPSENVLYIQVGDPVADHKCWEKPEAITEE  229

Query  780  RPLTXINASVP  812
            RPL  +NAS P
Sbjct  230  RPLIQVNASCP  240


 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  411  MQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLA  590
            MQFFD+QKSGKLVDNKISWRG+S LKDG  A LDL+KGMYDAGD MKFGFPMA+TATVL+
Sbjct  1    MQFFDIQKSGKLVDNKISWRGNSALKDGSQAKLDLTKGMYDAGDNMKFGFPMAFTATVLS  60

Query  591  WTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQV  722
            W+ILEYGDQM  V QL+ A+ SLKWITDYL+NAHP +NVLYIQV
Sbjct  61   WSILEYGDQMDHVGQLDAAQDSLKWITDYLINAHPSENVLYIQV  104



>gb|ABK24648.1| unknown [Picea sitchensis]
Length=532

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 137/204 (67%), Gaps = 8/204 (4%)
 Frame = +3

Query  210  MGDKSRSKGGWCGWLLv--vivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  383
            MG  ++S  GW  WLL   +         + +L  +KH     S    +PVPGPPGA++Q
Sbjct  1    MGAVAKSSKGWIWWLLSLGIAAFVVTAAVLTILHSRKH-----SHHHVSPVPGPPGAISQ  55

Query  384  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            KY  ALK+A+ FF +QK+GKL  DN I WRGDS L DG    +DLS GMYDAGD +KFG 
Sbjct  56   KYAQALKVALTFFPIQKAGKLPNDNPIPWRGDSALSDGNDVGVDLSGGMYDAGDHIKFGL  115

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W +LEYGDQM    QL  A+ ++KWITDYL+ AHP  NVLY+QVG+  +D
Sbjct  116  PMAFTATLLSWGVLEYGDQMDAAHQLGAAQLAIKWITDYLIKAHPSSNVLYVQVGNASID  175

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPE M E RP   ++AS P
Sbjct  176  HKCWERPEVMKEKRPTLKVDASSP  199



>gb|EMT32027.1| Endoglucanase 24 [Aegilops tauschii]
Length=504

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 104/144 (72%), Gaps = 18/144 (13%)
 Frame = +3

Query  435  SGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGD  614
            +GKLVDN+I WRGDS L DGK A LDLSKG+YDAGD MKF FPMA+TATVLAW++LEYGD
Sbjct  13   AGKLVDNQIPWRGDSALNDGKEAKLDLSKGLYDAGDHMKFTFPMAFTATVLAWSVLEYGD  72

Query  615  QMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQ------------------VGDPDLD  740
            QM   KQL+PA  +L+W++D+L+ AHP +NV YIQ                  VGDPDLD
Sbjct  73   QMTAAKQLDPALDALRWVSDFLIAAHPSENVFYIQVNGLRHVLGVRMTVCSVEVGDPDLD  132

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CWQRPE MTE RPLT IN   P
Sbjct  133  HDCWQRPETMTEKRPLTQINPKNP  156



>gb|KHN21266.1| Endoglucanase 24 [Glycine soja]
Length=185

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            QKY  ALK AMQFFDVQKSG+LVD+KISWRG+S LKDG  A LDLSKGMYDAGD MKFGF
Sbjct  66   QKYRTALKTAMQFFDVQKSGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDAGDNMKFGF  125

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQ  719
             MA+TATV +W+ILEYGDQM  V QL+ A+ SLKWITD+L+NAHP +NVLYIQ
Sbjct  126  SMAFTATVQSWSILEYGDQMDHVGQLDAAQYSLKWITDFLINAHPSENVLYIQ  178



>gb|EMS54236.1| Endoglucanase 18 [Triticum urartu]
Length=485

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  432  KSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYG  611
            ++GKLV N+I WRGDS + DG++A LDLS+GMYDAGD +KFGFP+A+TAT+L+W++LEYG
Sbjct  29   EAGKLVKNEIPWRGDSAVDDGQAAGLDLSRGMYDAGDHIKFGFPLAFTATMLSWSVLEYG  88

Query  612  DQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPEDMTESRPLT  791
              M   KQ + A  +L+WI DYLVNAHP D+VLYIQVGDP+ DHKCW+RPE M+E RPLT
Sbjct  89   GAMEAAKQRDSALDALRWIMDYLVNAHPADDVLYIQVGDPEADHKCWERPETMSEKRPLT  148

Query  792  XINASVP  812
             I A+ P
Sbjct  149  KITANSP  155



>ref|XP_002961546.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
 gb|EFJ36806.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
Length=562

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            KY + LKI++QFFD+QKSGKL  DN I WRGDS L DG  A +DLS GMYDAGD +KFGF
Sbjct  90   KYAEPLKISLQFFDIQKSGKLPPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGDYIKFGF  149

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W+ILEY  +    +QL    GSLKWITDYL+ AH  +N LY QVG P LD
Sbjct  150  PMAFTATILSWSILEYRKEYTATQQLHSVTGSLKWITDYLIKAHASENELYFQVGSPRLD  209

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW+R E M  +RP   ++ S P
Sbjct  210  HACWERAEKMDTARPSFKLDPSHP  233



>ref|XP_002971269.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
 gb|EFJ27867.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
Length=561

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
            KY + LKI++QFFD+QKSGKL  DN I WRGDS L DG  A +DLS GMYDAGD +KFGF
Sbjct  90   KYAEPLKISLQFFDIQKSGKLPPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGDYIKFGF  149

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W+ILEY  +    +QL    GSLKWITDYL+ AH  +N LY QVG P LD
Sbjct  150  PMAFTATILSWSILEYRKEYTATQQLHSVTGSLKWITDYLIKAHASENELYFQVGSPRLD  209

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW+R E M  +RP   ++ S P
Sbjct  210  HACWERAEKMDTARPSFKLDPSHP  233



>gb|KJB58119.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=424

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  525  MYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDN  704
            MYDAGD MKFGFPMA+TATVL+W ILEYGDQMA V QLEPA+ SLKWITD+L+NAHP DN
Sbjct  1    MYDAGDHMKFGFPMAFTATVLSWAILEYGDQMAAVNQLEPAQQSLKWITDFLINAHPKDN  60

Query  705  VLYIQVGDPDLDHKCWQRPEDMTESRPLTXINASVP  812
            VLYIQVGDPDLDHKCW+RPE+M E RPLT +N +VP
Sbjct  61   VLYIQVGDPDLDHKCWERPENMKEKRPLTQVNITVP  96



>ref|XP_002978046.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
 gb|EFJ20703.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
Length=551

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 100/146 (68%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
             +++   L++AM+F D QKSGKL  DN I WRGDS L DGK   LDLSKGM+DAGD +KF
Sbjct  69   VERFSKPLELAMRFLDAQKSGKLPKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGDNVKF  128

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFPMA+TAT+LAW+ILEY        QL+ A  SL+W+TDY V AHP  N L+ QVG P 
Sbjct  129  GFPMAFTATILAWSILEYRSGYNASGQLQSALESLQWLTDYFVAAHPSKNELFFQVGSPS  188

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CW++PE M   RP   +N S P
Sbjct  189  SDHVCWEKPETMDTPRPCLSVNTSKP  214



>gb|ACC63522.1| putative glucanase/cellulase [Hordeum vulgare subsp. vulgare]
Length=179

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 101/141 (72%), Gaps = 9/141 (6%)
 Frame = +3

Query  300  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  479
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  480  GLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSL  659
             + DG+ A LDLS+GMYDAGD +KFGFPMA+TAT+L+W++LEYG  M   KQ + A  +L
Sbjct  78   AVDDGQEAGLDLSRGMYDAGDHIKFGFPMAFTATMLSWSVLEYGGAMEAAKQRDSAIDAL  137

Query  660  KWITDYLVNAHPDDNVLYIQV  722
            +WI DYLVNAHP  +VLYIQV
Sbjct  138  RWIMDYLVNAHPSHDVLYIQV  158



>ref|XP_006294088.1| hypothetical protein CARUB_v10023082mg [Capsella rubella]
 gb|EOA26986.1| hypothetical protein CARUB_v10023082mg [Capsella rubella]
Length=494

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
               YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DLS G YDAGD +KF
Sbjct  33   NSNYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGFDAHIDLSGGYYDAGDNVKF  92

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+   ++ E A  +LKW TDYL+ AHP+ NVLY QVGD +
Sbjct  93   GFPLAFTTTMLAWSCVEMESQLKAHEEHENALAALKWATDYLIKAHPEPNVLYGQVGDAN  152

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
            LDH CW RPEDMT  RP   I+A  P
Sbjct  153  LDHACWMRPEDMTTPRPSYRIDAQHP  178



>ref|XP_002966695.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
 gb|EFJ32722.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
Length=472

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +3

Query  411  MQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTATVL  587
            M+F D QKSGKL  DN I WRGDS L DGK   LDLSKGM+DAGD +KFGFPMA+TAT+L
Sbjct  1    MRFLDAQKSGKLPKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGDNVKFGFPMAFTATIL  60

Query  588  AWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDHKCWQRPED  767
            AW+ILEY        QL+ A  SL+W+TDY V AHP  N L+ QVG P  DH CW++PE 
Sbjct  61   AWSILEYRSGYNASGQLQSALESLQWLTDYFVAAHPSKNELFFQVGSPSSDHVCWEKPET  120

Query  768  MTESRPLTXINASVP  812
            M   RP   +N S P
Sbjct  121  MDTPRPCLSVNTSKP  135



>ref|XP_006843620.1| hypothetical protein AMTR_s00007p00146230 [Amborella trichopoda]
 gb|ERN05295.1| hypothetical protein AMTR_s00007p00146230 [Amborella trichopoda]
Length=209

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG+AL  ++ +F+ Q+SGKL    ++ WRGDS L DG S  +DL+ G YDAGD MKFGFP
Sbjct  27   YGEALDKSLLYFEAQRSGKLPTSQRVLWRGDSALSDGHSVGVDLTGGYYDAGDNMKFGFP  86

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+LAW+++E+G+++    QL+ A  ++ W T+YL+ AH  DNVLY QVGD   DH
Sbjct  87   MAFTVTMLAWSVVEFGEELKATSQLDHAMNAIWWGTEYLMKAHIKDNVLYGQVGDGSSDH  146

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    IN + P
Sbjct  147  NCWQRPEDMTTPRTPYVINETNP  169



>ref|XP_006413937.1| hypothetical protein EUTSA_v10027553mg [Eutrema salsugineum]
 gb|ESQ55390.1| hypothetical protein EUTSA_v10027553mg [Eutrema salsugineum]
Length=494

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYGEALTNSLLYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHIDLTGGYYDAGDNMKF  90

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+   K+ E    +LKW TD+L+ AHP+ NVLY QVGD +
Sbjct  91   GFPLAFTTTMLAWSSIEMASQLKAHKEYENVLTALKWATDFLIKAHPEPNVLYGQVGDGN  150

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CW RPEDMT  RP   I+A  P
Sbjct  151  SDHACWMRPEDMTTPRPTYRIDAQHP  176



>emb|CDY47674.1| BnaC04g03850D [Brassica napus]
Length=493

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            ++ YG+AL   + +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  33   SRHYGEALTKTLLYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  92

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+   K+ +    +LKW TDYL+ AHP+ N+LY QVGD +
Sbjct  93   GFPLAFTTTMLAWSSVEMASQLKAHKEHKNVLAALKWATDYLIKAHPESNILYGQVGDGN  152

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH+CW RPEDMT  RP   I+A  P
Sbjct  153  SDHECWMRPEDMTTPRPSYRIDAQHP  178



>emb|CDX74668.1| BnaA05g04140D [Brassica napus]
Length=493

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            ++ YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  33   SRHYGEALTKSLFYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  92

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+   K+ +    +LKW TDYL+ AHP+ NVLY QVGD +
Sbjct  93   GFPLAFTTTMLAWSSVEMASQLKAHKEHKNVLAALKWATDYLIKAHPEPNVLYGQVGDGN  152

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CW RPEDMT  RP   I+A  P
Sbjct  153  SDHACWMRPEDMTTPRPSYRIDAQHP  178



>ref|XP_009143046.1| PREDICTED: endoglucanase 14-like [Brassica rapa]
Length=493

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            ++ YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  33   SRHYGEALTKSLFYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  92

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+   K+ +    +LKW TDYL+ AHP+ NVLY QVGD +
Sbjct  93   GFPLAFTTTMLAWSSVEMASQLKAHKEHKNVLAALKWATDYLIKAHPEPNVLYGQVGDGN  152

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CW RPEDMT  RP   I+A  P
Sbjct  153  SDHACWMRPEDMTTPRPSYRIDAQHP  178



>ref|NP_181984.1| glycosyl hydrolase 9B11 [Arabidopsis thaliana]
 sp|Q8S8Q4.2|GUN14_ARATH RecName: Full=Endoglucanase 14; AltName: Full=Endo-1,4-beta glucanase 
14; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27458.1| putative glucanase [Arabidopsis thaliana]
 dbj|BAD43652.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10438.1| glycosyl hydrolase 9B11 [Arabidopsis thaliana]
Length=491

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 104/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            ++ YGDAL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   SRNYGDALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  90

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+  T+LAW+ +E   Q+   ++ E A  +LKW TD+L+ AHP+ NVLY QVGD +
Sbjct  91   GFPLAFFTTMLAWSNIEMATQLKAHQEQENALAALKWATDFLIKAHPEPNVLYGQVGDGN  150

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH+CW RPEDMT  RP   I+A  P
Sbjct  151  SDHECWMRPEDMTTPRPSFRIDAQHP  176



>ref|XP_006840110.1| hypothetical protein AMTR_s00224p00022980 [Amborella trichopoda]
 gb|ERN01785.1| hypothetical protein AMTR_s00224p00022980 [Amborella trichopoda]
Length=121

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +3

Query  525  MYDAGDLMKFGFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDN  704
            MYDAGD MKFGFPMA+TATVL WTILEYGDQM   + L PA  +LKWITDYLVNAHP +N
Sbjct  1    MYDAGDHMKFGFPMAFTATVLLWTILEYGDQMKAAQHLAPALDALKWITDYLVNAHPSEN  60

Query  705  VLYIQVGDPDLDHKCWQRPEDMTESRPLTXINASV  809
            VLYIQVG+P  DH CW+RPEDM E RPLT +N S 
Sbjct  61   VLYIQVGNPKDDHACWERPEDMKEKRPLTQVNTST  95



>ref|XP_002881965.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58224.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
               YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  33   NSNYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKF  92

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+    + E    +L+W TDYL+ AHP+ NVLY QVGD +
Sbjct  93   GFPLAFTTTMLAWSSVEMESQLKAHHEHENTLAALRWATDYLIKAHPEPNVLYGQVGDGN  152

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
            LDH CW RPEDMT  RP   I+A  P
Sbjct  153  LDHACWMRPEDMTTPRPSYRIDAQHP  178



>ref|XP_001772307.1| predicted protein [Physcomitrella patens]
 gb|EDQ62778.1| predicted protein [Physcomitrella patens]
Length=629

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 105/143 (73%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YGDAL  A+++F+ Q+SG+L   +++SWRGDSGL DG+   LDLS G YDAGD +KFG P
Sbjct  29   YGDALDKAVKYFEAQRSGRLPPGHRVSWRGDSGLHDGQQEGLDLSGGYYDAGDNVKFGLP  88

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MAYT T+L+W+++EY  Q+   +QL+ A  ++KW TDY + AHP+ NVL+ +VGD D DH
Sbjct  89   MAYTITMLSWSVIEYKHQLQASRQLDYALEAIKWGTDYFIKAHPEPNVLWGEVGDGDSDH  148

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT SR    I+++ P
Sbjct  149  DCWMRPEDMTTSRKAYKIDSNNP  171



>ref|XP_011085126.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 14-like [Sesamum 
indicum]
Length=489

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            T  YG AL  ++ F++ Q+SGKL  N +I WRGDS L DGKSA +DL  G YDAGD +KF
Sbjct  26   TVDYGAALTKSLLFYEAQRSGKLPPNQRIRWRGDSALSDGKSARIDLVGGYYDAGDNVKF  85

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFPMA+T T+LAW+++E+  Q+    +L  A  S+KW TDYL+ AHP+ NVLY +VGD  
Sbjct  86   GFPMAFTVTMLAWSVVEFEPQLQARNELSNALRSIKWGTDYLIKAHPEPNVLYGEVGDGG  145

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT  R +  I+   P
Sbjct  146  SDHACWQRPEDMTTPRTVYRIDEQHP  171



>emb|CDP12150.1| unnamed protein product [Coffea canephora]
Length=618

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y  AL  ++ FF+ Q+SG L  N ++ WRG+SGL DGK + +DL+ G YDAGD +KFG P
Sbjct  29   YSQALSKSILFFEAQRSGYLPRNQRVQWRGNSGLNDGKPSGVDLTGGYYDAGDNVKFGLP  88

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDYL+ AHP  NVLY +VGD + DH
Sbjct  89   MAFTVTMMSWSIIEYGGQMAASGELSHAMDAIKWGTDYLIKAHPQPNVLYGEVGDGNTDH  148

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+ S P
Sbjct  149  YCWQRPEDMTTSRAAYRIDPSNP  171



>gb|EAZ38281.1| hypothetical protein OsJ_22659 [Oryza sativa Japonica Group]
Length=494

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 92/144 (64%), Gaps = 24/144 (17%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             KY DAL +A+QFF                        + A +DLSKGMYDAGD MKFGF
Sbjct  48   HKYADALAVALQFF------------------------QEAGIDLSKGMYDAGDHMKFGF  83

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+TAT+L+W++LEYGD M    Q + A  +L WI DYLVNAHP D+VLYIQVGDP  D
Sbjct  84   PMAFTATMLSWSVLEYGDAMRAADQRDSAIDALNWIMDYLVNAHPSDDVLYIQVGDPKAD  143

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            HKCW+RPE M E RPLT I    P
Sbjct  144  HKCWERPEKMKEKRPLTKITPKSP  167



>ref|XP_006343864.1| PREDICTED: endoglucanase 6-like [Solanum tuberosum]
Length=625

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              YG+AL  +  F++ Q+SG L  N ++ WRG+SGL DGK++ +DL  G YDAGD +KFG
Sbjct  23   HNYGEALSKSFLFYEAQRSGYLPHNQRVQWRGNSGLNDGKASGIDLVGGYYDAGDNVKFG  82

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
             PMA+T T+L+W+ILEYG QMA   +L  A  ++KW TDYL+ AHP+  VLY +VGD + 
Sbjct  83   LPMAFTVTMLSWSILEYGRQMAASGELSHAMDAVKWGTDYLLKAHPEPYVLYGEVGDGNT  142

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPEDMT SR    I+ + P
Sbjct  143  DHYCWQRPEDMTTSRAAYRIDPNHP  167



>ref|XP_010508282.1| PREDICTED: endoglucanase 15-like [Camelina sativa]
Length=493

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             Y DAL  ++ FF+ Q+SGKL    +++WRGDS L+DG  A ++L+ G YDAGD MKFGF
Sbjct  35   NYADALTKSILFFEAQRSGKLPAKQRVTWRGDSALRDGADAHVNLAGGYYDAGDNMKFGF  94

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            P+A+T T+LAW+ +E   Q+   K+ + A  ++KW TDYL+NAHP  NVLY QVGD   D
Sbjct  95   PLAFTTTMLAWSSVEMESQLKARKEHQNALAAIKWATDYLINAHPQPNVLYGQVGDGASD  154

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+A  P
Sbjct  155  HACWMRPEDMTTPRPSYRIDAQHP  178



>dbj|BAF01119.1| putative glucanase [Arabidopsis thaliana]
Length=404

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL +D ++ WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  29   NYGEALTKSLLYFEAQRSGKLPLDQRVIWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  88

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            P+A+T T+LAW+ +E   Q+   ++      +L+W TDYL+ AHP+ NVLY QVGD +LD
Sbjct  89   PLAFTTTMLAWSSVEMESQLKAHQEHGNTLAALRWATDYLIKAHPEPNVLYGQVGDANLD  148

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+   P
Sbjct  149  HACWMRPEDMTTPRPSYRIDPQHP  172



>ref|XP_002881964.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58223.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  90

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+  T+LAW+ +E   Q+   ++ E A  +LKW TD+L+ AHP+ NVLY QVGD +
Sbjct  91   GFPLAFMTTMLAWSNIEMASQLKAHQEQENALAALKWATDFLIKAHPEPNVLYGQVGDGN  150

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CW RPEDMT  RP   I+A  P
Sbjct  151  SDHGCWMRPEDMTTPRPSFRIDAQHP  176



>ref|XP_002509954.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF51341.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=224

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 99/146 (68%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
               YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KF
Sbjct  25   AHDYGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKATGVDLVGGYYDAGDNVKF  84

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            G PMA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+  VLY +VGD +
Sbjct  85   GLPMAFTITMMSWSIIEYGKQMAASGELGHAIDAVKWGTDYFIKAHPEPYVLYGEVGDGN  144

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT  R    I+ S P
Sbjct  145  SDHYCWQRPEDMTTDRRAYKIDPSNP  170



>gb|ABR10607.1| endo-beta-1,4-glucanase [Mangifera indica]
Length=619

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L    +++WRG+SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  29   YGQALTKSILFFEAQRSGYLPHTQRVTWRGNSGLNDGKASGVDLVGGYYDAGDNVKFGLP  88

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W+++EYG QMA   +L+ A  ++KW TDYL+ AHP+ NVLY +VGD   DH
Sbjct  89   MAFTVTMLSWSVIEYGKQMAATGELDHAMDAIKWGTDYLIKAHPEPNVLYGEVGDGSTDH  148

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    ++ S P
Sbjct  149  YCWQRPEDMTTDRRAYKVDPSNP  171



>ref|NP_001234172.1| endo-beta-1,4-D-glucanase precursor [Solanum lycopersicum]
 gb|AAD08699.1| endo-beta-1,4-D-glucanase [Solanum lycopersicum]
Length=625

 Score =   164 bits (416),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              YG+AL  +  F++ Q+SG L  N ++ WRG+SGL DGK++ +DL  G YDAGD +KFG
Sbjct  23   HNYGEALSKSFLFYEAQRSGYLPRNQRVQWRGNSGLNDGKASGIDLVGGYYDAGDNVKFG  82

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
             PMA+T T+L+W+ILEYG QMA   +L  A  ++KW TDYL+ AHP+  VLY +VGD + 
Sbjct  83   LPMAFTVTMLSWSILEYGRQMAASGELSHAMDAVKWGTDYLLKAHPEPYVLYGEVGDGNT  142

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPEDMT SR    I+ + P
Sbjct  143  DHYCWQRPEDMTTSRAAYRIDPNHP  167



>emb|CDX74666.1| BnaA05g04120D [Brassica napus]
Length=489

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
             MA+T T+LAW+ +E   ++   K+ +    ++KW TDYL+NAHP+ NVLY QVGD + D
Sbjct  91   SMAFTTTMLAWSSVEMESELKTYKEHDNVLAAIKWATDYLINAHPEPNVLYGQVGDGNSD  150

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+A  P
Sbjct  151  HACWMRPEDMTTPRPSYRIDAQHP  174



>ref|XP_009143044.1| PREDICTED: endoglucanase 12-like [Brassica rapa]
Length=489

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
             MA+T T+LAW+ +E   ++   K+ +    ++KW TDYL+NAHP+ NVLY QVGD + D
Sbjct  91   SMAFTTTMLAWSSVEMESELKTYKEHDNVLAAIKWATDYLINAHPEPNVLYGQVGDGNSD  150

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+A  P
Sbjct  151  HACWMRPEDMTTPRPSYRIDAQHP  174



>gb|KDO76513.1| hypothetical protein CISIN_1g006835mg [Citrus sinensis]
Length=526

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  23   YGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLP  82

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  83   MAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDH  142

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  143  NCWQRPEDMTTDRRAYKIDPSNP  165



>ref|XP_008232281.1| PREDICTED: endoglucanase 14-like [Prunus mume]
Length=292

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YGDAL  ++ +++ Q+SGKL  N ++ WRGDSGLKDG  A +DL  G YDAGD +KFGFP
Sbjct  28   YGDALTKSLLYYEAQRSGKLPPNQRVQWRGDSGLKDGSDAGVDLVGGYYDAGDNVKFGFP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W+ +E+G ++    +L  A  ++KW TDYLV AH   NVLY ++GD D DH
Sbjct  88   MAFTITMLSWSTIEFGSKLDAKSELSNALDAIKWGTDYLVKAHAAPNVLYGEIGDGDSDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            +CWQRPEDMT  R    I+   P
Sbjct  148  ECWQRPEDMTTPRTTFKIDEQHP  170



>gb|EEE56313.1| hypothetical protein OsJ_05399 [Oryza sativa Japonica Group]
Length=306

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              YG+AL  ++ +F+ Q+SG+L  + ++ WRG SGL DG    +DL  G YDAGD +KFG
Sbjct  28   HDYGEALSKSLLYFEAQRSGRLPYNQRVRWRGHSGLTDGLEQGVDLVGGYYDAGDHVKFG  87

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
             PMA+T T+L+W++LEYG+++A   +L  A  ++KW TDY + AH   NVL+ QVGD D 
Sbjct  88   LPMAFTVTMLSWSVLEYGEEIAAAGELGHALHAIKWGTDYFIKAHTHPNVLWTQVGDGDS  147

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPEDMT SR    ++A  P
Sbjct  148  DHYCWQRPEDMTTSRHAYKVDAENP  172



>gb|KDO76512.1| hypothetical protein CISIN_1g006835mg [Citrus sinensis]
Length=629

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  23   YGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLP  82

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  83   MAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDH  142

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  143  NCWQRPEDMTTDRRAYKIDPSNP  165



>ref|XP_006439358.1| hypothetical protein CICLE_v10019301mg [Citrus clementina]
 gb|ESR52598.1| hypothetical protein CICLE_v10019301mg [Citrus clementina]
Length=629

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  23   YGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLP  82

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  83   MAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDH  142

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  143  NCWQRPEDMTTDRRAYKIDPSNP  165



>ref|XP_002269618.1| PREDICTED: endoglucanase 14-like [Vitis vinifera]
Length=481

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ +F+ Q+SGKL  N +  WRGDS LKDG  A +DL  G YDAGD +KFGFP
Sbjct  25   YGSALTKSILYFEAQRSGKLPSNQRAKWRGDSALKDGGDAGVDLVGGYYDAGDNVKFGFP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
             A+T T+L+W+++++G Q++  K+L+ A  ++KW TDY + AHP  NVLY QVGD D DH
Sbjct  85   QAFTVTMLSWSVIDFGSQLSAKKELDNALAAIKWGTDYFIKAHPQANVLYGQVGDGDADH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+   P
Sbjct  145  ACWQRPEDMTTPRTSYKIDEQHP  167



>emb|CBI25463.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ +F+ Q+SGKL  N +  WRGDS LKDG  A +DL  G YDAGD +KFGFP
Sbjct  25   YGSALTKSILYFEAQRSGKLPSNQRAKWRGDSALKDGGDAGVDLVGGYYDAGDNVKFGFP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
             A+T T+L+W+++++G Q++  K+L+ A  ++KW TDY + AHP  NVLY QVGD D DH
Sbjct  85   QAFTVTMLSWSVIDFGSQLSAKKELDNALAAIKWGTDYFIKAHPQANVLYGQVGDGDADH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+   P
Sbjct  145  ACWQRPEDMTTPRTSYKIDEQHP  167



>gb|KEH21214.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=517

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N ++SWR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  29   YGQALSKSIMFFEAQRSGYLPHNQRVSWRSHSGLQDGKASGVDLVGGYYDAGDNVKFGLP  88

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  N+LY +VGD + DH
Sbjct  89   MAFTVTMMSWSIIEYGKQMASSGELGHAMEAVKWGTDYFIKAHPQPNLLYGEVGDGNTDH  148

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCWQRPEDMT  R    ++ S P
Sbjct  149  KCWQRPEDMTTDRRAYKVDPSNP  171



>ref|XP_010230628.1| PREDICTED: endoglucanase 2-like isoform X3 [Brachypodium distachyon]
Length=618

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ F + Q+SG L  + +I+WR +SGL DGK+  +DL+ G YDAGD +KFG P
Sbjct  25   YGTALSKSILFLEAQRSGTLPSSQRIAWRANSGLLDGKANGVDLTGGYYDAGDNVKFGLP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG+QMA   QL+ A  ++KW TDY + AHP+ NVLY +VGD D DH
Sbjct  85   MAFTVTMMSWSIVEYGEQMAAAGQLDHAVEAVKWGTDYFIKAHPEANVLYGEVGDGDSDH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  145  SCWQRPEDMTTSRQAYRLDTQHP  167



>ref|XP_010230629.1| PREDICTED: endoglucanase 2-like isoform X4 [Brachypodium distachyon]
Length=608

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ F + Q+SG L  + +I+WR +SGL DGK+  +DL+ G YDAGD +KFG P
Sbjct  25   YGTALSKSILFLEAQRSGTLPSSQRIAWRANSGLLDGKANGVDLTGGYYDAGDNVKFGLP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG+QMA   QL+ A  ++KW TDY + AHP+ NVLY +VGD D DH
Sbjct  85   MAFTVTMMSWSIVEYGEQMAAAGQLDHAVEAVKWGTDYFIKAHPEANVLYGEVGDGDSDH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  145  SCWQRPEDMTTSRQAYRLDTQHP  167



>ref|XP_003565659.1| PREDICTED: endoglucanase 2-like isoform X2 [Brachypodium distachyon]
Length=618

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ F + Q+SG L  + +I+WR +SGL DGK+  +DL+ G YDAGD +KFG P
Sbjct  25   YGTALSKSILFLEAQRSGTLPSSQRIAWRANSGLLDGKANGVDLTGGYYDAGDNVKFGLP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG+QMA   QL+ A  ++KW TDY + AHP+ NVLY +VGD D DH
Sbjct  85   MAFTVTMMSWSIVEYGEQMAAAGQLDHAVEAVKWGTDYFIKAHPEANVLYGEVGDGDSDH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  145  SCWQRPEDMTTSRQAYRLDTQHP  167



>ref|XP_010230627.1| PREDICTED: endoglucanase 2-like isoform X1 [Brachypodium distachyon]
Length=621

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ F + Q+SG L  + +I+WR +SGL DGK+  +DL+ G YDAGD +KFG P
Sbjct  25   YGTALSKSILFLEAQRSGTLPSSQRIAWRANSGLLDGKANGVDLTGGYYDAGDNVKFGLP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG+QMA   QL+ A  ++KW TDY + AHP+ NVLY +VGD D DH
Sbjct  85   MAFTVTMMSWSIVEYGEQMAAAGQLDHAVEAVKWGTDYFIKAHPEANVLYGEVGDGDSDH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  145  SCWQRPEDMTTSRQAYRLDTQHP  167



>ref|XP_009626013.1| PREDICTED: endoglucanase 6-like [Nicotiana tomentosiformis]
Length=624

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              YG+AL  +  F++ Q+SG L  N ++ WRG+SGL DGK++ +DL  G YDAGD +KFG
Sbjct  22   HNYGEALSKSFLFYEAQRSGYLPHNQRVHWRGNSGLNDGKASGIDLVGGYYDAGDNVKFG  81

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
             PMA+T T+++W+ILEYG QMA   +L  A  ++KW TDYL+ AHP+  VLY +VGD + 
Sbjct  82   LPMAFTITMMSWSILEYGRQMAASGELGHAMDAVKWGTDYLLKAHPEPYVLYGEVGDGNT  141

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPEDMT SR    I+ + P
Sbjct  142  DHYCWQRPEDMTTSRAAYRIDPNHP  166



>ref|XP_009601304.1| PREDICTED: endoglucanase 6 [Nicotiana tomentosiformis]
Length=624

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  +  F++ Q+SG L  D ++ WRG+SGL DGK++ +DL  G YDAGD +KF
Sbjct  30   SHNYGEALSKSFLFYEAQRSGYLPHDQRVQWRGNSGLLDGKASGVDLVGGYYDAGDNVKF  89

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            G PMA+T T+++W+I+EYG QM    +L  A  ++KW TDYL+ AHP+ NVLY +VGD  
Sbjct  90   GLPMAFTVTMMSWSIIEYGKQMGESGELSNAIDAVKWGTDYLLKAHPEPNVLYGEVGDGT  149

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT SR    I+ S P
Sbjct  150  TDHYCWQRPEDMTTSRAAYRIDPSRP  175



>ref|XP_004503629.1| PREDICTED: endoglucanase 6-like [Cicer arietinum]
Length=626

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L +N ++SWR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  28   YGQALSKSIMFFEAQRSGFLPNNQRVSWRSHSGLQDGKASGIDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGKQMATSGELGHAMEAVKWGTDYFIKAHPQPNVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCWQRPEDMT  R    I+ + P
Sbjct  148  KCWQRPEDMTTDRHGYKIDPNNP  170



>gb|AAL30454.1|AF362949_1 endo-beta-1,4-glucanase precursor [Nicotiana tabacum]
Length=624

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  +  F++ Q+SG L  D ++ WRG+SGL DGK++ +DL  G YDAGD +KF
Sbjct  30   SHNYGEALSKSFLFYEAQRSGYLPHDQRVQWRGNSGLLDGKASGVDLVGGYYDAGDNVKF  89

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            G PMA+T T+++W+I+EYG QM    +L  A  ++KW TDYL+ AHP+ NVLY +VGD  
Sbjct  90   GLPMAFTVTMMSWSIIEYGKQMGESGELSNAIDAVKWGTDYLLKAHPEPNVLYGEVGDGT  149

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT SR    I+ S P
Sbjct  150  TDHYCWQRPEDMTTSRAAYRIDPSRP  175



>ref|XP_010943262.1| PREDICTED: endoglucanase 11-like [Elaeis guineensis]
Length=549

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y DAL  ++ +F+ Q+SG L  N +ISWRG SGL DG    +DL  G YDAGD +KFG P
Sbjct  55   YRDALSKSLLYFEAQRSGHLPYNQRISWRGHSGLTDGLEQGVDLVGGYYDAGDNVKFGLP  114

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W+++EYG+++A   ++E A  ++KW TDY + AH   NVL+IQVGD D DH
Sbjct  115  MAFTITMLSWSVMEYGEEIAAAGEIEHAMEAIKWGTDYFIKAHTQPNVLWIQVGDGDTDH  174

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+A  P
Sbjct  175  YCWQRPEDMTTSRKAYKIDAENP  197



>gb|EYU23364.1| hypothetical protein MIMGU_mgv1a004112mg [Erythranthe guttata]
Length=543

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L    ++ WRG+SGL DGK   +DL  G YDAGD +KFG P
Sbjct  31   YGQALTKSILFFEAQRSGYLPGSQRVQWRGNSGLNDGKLNGVDLVGGYYDAGDNVKFGLP  90

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W+ILEYG QM    +L  A  ++KW TDYL+ AHP+ NVLY +VGD + DH
Sbjct  91   MAFTVTMLSWSILEYGKQMGASGELGHAIDAVKWGTDYLIKAHPEPNVLYGEVGDGNTDH  150

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+ S P
Sbjct  151  NCWQRPEDMTTSRAAYRIDPSHP  173



>ref|NP_181985.1| glycosyl hydrolase 9B12  [Arabidopsis thaliana]
 sp|O80497.1|GUN15_ARATH RecName: Full=Endoglucanase 15; AltName: Full=Endo-1,4-beta glucanase 
15; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27459.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10439.1| glycosyl hydrolase 9B12 [Arabidopsis thaliana]
Length=492

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 100/146 (68%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
               YG+AL  ++ +F+ Q+SGKL +D ++ WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   NSNYGEALTKSLLYFEAQRSGKLPLDQRVIWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  90

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+   ++      +L+W TDYL+ AHP+ NVLY QVGD +
Sbjct  91   GFPLAFTTTMLAWSSVEMESQLKAHQEHGNTLAALRWATDYLIKAHPEPNVLYGQVGDAN  150

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
            LDH CW RPEDMT  RP   I+   P
Sbjct  151  LDHACWMRPEDMTTPRPSYRIDPQHP  176



>ref|XP_006850530.1| hypothetical protein AMTR_s00159p00033510 [Amborella trichopoda]
 gb|ERN12111.1| hypothetical protein AMTR_s00159p00033510 [Amborella trichopoda]
Length=621

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YGDAL  ++ FF+ Q+SG L  N ++ WR DSGL DGK++ +DL  G YDAGD +KFG P
Sbjct  24   YGDALSKSIMFFEAQRSGYLPGNQRVKWRADSGLHDGKASGVDLVGGYYDAGDNVKFGLP  83

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W++LEYG QM    +L  A  ++KW TDY + AHP+ NV Y +VGD + DH
Sbjct  84   MAFTITMMSWSVLEYGKQMGSNGELGHAMDAIKWGTDYFIKAHPEPNVFYGEVGDGNTDH  143

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDM+ SR    I+ S P
Sbjct  144  YCWQRPEDMSTSRSAYRIDPSNP  166



>ref|XP_010512853.1| PREDICTED: endoglucanase 14 [Camelina sativa]
Length=491

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG    +DL+ G YDAGD MKFGFP
Sbjct  34   YGEALTKSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDVHVDLTGGYYDAGDNMKFGFP  93

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            +A+T T+LAW+ +E   Q+ V ++ E    +LKW TDYL+ AHP+ +VLY QVG+ + DH
Sbjct  94   LAFTTTMLAWSSIEMASQLKVHQEYENVLAALKWATDYLIKAHPEPDVLYGQVGEGNSDH  153

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT  RP   I+A  P
Sbjct  154  GCWMRPEDMTTPRPSFRIDAQHP  176



>emb|CDX74667.1| BnaA05g04130D [Brassica napus]
Length=433

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+T T+LAW+ +E+  ++   K+      ++KW TDY + AHP+ NVLY QVGD   D
Sbjct  91   PMAFTTTMLAWSSVEWESELKAHKEHRNVLDAIKWATDYFIKAHPEPNVLYGQVGDGKSD  150

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+A  P
Sbjct  151  HACWMRPEDMTTPRPSYRIDAQHP  174



>gb|KEH21213.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=627

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N ++SWR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  29   YGQALSKSIMFFEAQRSGYLPHNQRVSWRSHSGLQDGKASGVDLVGGYYDAGDNVKFGLP  88

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  N+LY +VGD + DH
Sbjct  89   MAFTVTMMSWSIIEYGKQMASSGELGHAMEAVKWGTDYFIKAHPQPNLLYGEVGDGNTDH  148

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            KCWQRPEDMT  R    ++ S P
Sbjct  149  KCWQRPEDMTTDRRAYKVDPSNP  171



>ref|XP_008812558.1| PREDICTED: endoglucanase 19-like [Phoenix dactylifera]
Length=617

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR DSGL DGK+  +DL  G YDAGD +KFG P
Sbjct  24   YGKALSKSILFFEAQRSGYLPSNQRVTWRADSGLLDGKANGVDLVGGYYDAGDNVKFGLP  83

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T++AW+I EYG QMA   +L  A  ++KW TDYL+ AHP+ +VLY +VGD + DH
Sbjct  84   MAFTITMMAWSIAEYGKQMAATGELGHAMEAVKWGTDYLIKAHPEPHVLYGEVGDGNSDH  143

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+A  P
Sbjct  144  YCWQRPEDMTTSRMAYRIDADHP  166



>ref|XP_006643916.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 2-like [Oryza brachyantha]
Length=608

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ +++ Q+SG L  + +I+WR  SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  15   YGKALSKSILYYEAQRSGVLPQSQRIAWRASSGLADGKANGVDLVGGYYDAGDNVKFGLP  74

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T++AW++LEYG+QMA   +L  A  ++KW TDY V AHP+ NVLY +VGD D DH
Sbjct  75   MAFTVTMMAWSVLEYGEQMAAAGELGHAVEAIKWGTDYFVKAHPEPNVLYAEVGDGDSDH  134

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  135  NCWQRPEDMTTSRQAYRLDPQNP  157



>ref|XP_006476392.1| PREDICTED: endoglucanase 6-like [Citrus sinensis]
Length=629

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK++  DL  G YDAGD +KFG P
Sbjct  23   YGQALSKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGADLVGGYYDAGDNVKFGLP  82

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  83   MAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDH  142

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  143  NCWQRPEDMTTDRRAYKIDPSNP  165



>ref|NP_001289239.1| endoglucanase 6-like precursor [Pyrus x bretschneideri]
 gb|AGR44453.1| endo-1,4-beta-D-glucanase 2 [Pyrus x bretschneideri]
Length=620

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  28   YGQALSNSILFFEAQRSGYLPPNQRVTWRSNSGLYDGKANGVDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGSQMAASGELGHAMDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT +R    I+ S P
Sbjct  148  YCWQRPEDMTTNRQAYKISPSNP  170



>gb|KCW72408.1| hypothetical protein EUGRSUZ_E00858 [Eucalyptus grandis]
Length=529

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L    +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  27   YGQALSKSILFFEAQRSGYLPSTQRVTWRANSGLSDGKASGVDLVGGYYDAGDNVKFGLP  86

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+ILEYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  87   MAFTVTMMSWSILEYGKQMAAGGELSHAIDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  146

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  147  YCWQRPEDMTTDRKAYRIDQSNP  169



>ref|XP_009358597.1| PREDICTED: endoglucanase 6-like [Pyrus x bretschneideri]
Length=620

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  28   YGQALSNSILFFEAQRSGYLPPNQRVTWRSNSGLYDGKANGVDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGSQMAASGELGHAMDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT +R    I+ S P
Sbjct  148  YCWQRPEDMTTNRQAYKISPSNP  170



>ref|XP_010314503.1| PREDICTED: endoglucanase 6-like [Solanum lycopersicum]
Length=617

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  +  F++ Q+SG L  D ++ WRG+SGL DGK++ +DL  G YDAGD +KF
Sbjct  25   SHNYGEALSKSFLFYEAQRSGYLPRDQRVQWRGNSGLNDGKASGVDLVGGYYDAGDNVKF  84

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            G PMA+T T+++W+I+EYG QM+   +L  A  ++KW TDYL+ AHP+ +VLY +VGD  
Sbjct  85   GLPMAFTVTMMSWSIIEYGKQMSESGELSNAIDAVKWGTDYLLKAHPEPHVLYGEVGDGT  144

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT SR    I+ S P
Sbjct  145  TDHYCWQRPEDMTTSRAAYRIDPSRP  170



>ref|XP_008374318.1| PREDICTED: endoglucanase 6-like [Malus domestica]
Length=620

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  28   YGQALSNSILFFEAQRSGFLPPNQRVTWRSNSGLYDGKANGVDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGSQMAASGELXHAMDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT +R    I+ S P
Sbjct  148  YCWQRPEDMTTNRQAYKISPSNP  170



>gb|EYU26800.1| hypothetical protein MIMGU_mgv1a019325mg [Erythranthe guttata]
Length=474

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +++YG+AL  ++ F++ Q+SGKL  D ++ WRGDS L DGK+  +DL  G YDAGD +KF
Sbjct  23   SREYGEALTKSLLFYEAQRSGKLPPDQRVQWRGDSALHDGKTGGIDLVGGYYDAGDNVKF  82

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFPMAYT T+LAW+++E+G+ +    +   A  ++KW TDY++ AHP+ NVLY +VGD  
Sbjct  83   GFPMAYTVTMLAWSVVEFGNNLKARNEYWNALKAVKWGTDYMMKAHPEPNVLYGEVGDGG  142

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT  R +  I+   P
Sbjct  143  SDHACWQRPEDMTTPRTVYKIDDHNP  168



>emb|CDX74664.1| BnaA05g04100D [Brassica napus]
Length=489

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+T T+LAW+ +E+  ++   K+      ++KW TDY + AHP+ NVLY QVGD   D
Sbjct  91   PMAFTTTMLAWSSVEWESELKAHKEHRNVLDAIKWATDYFIKAHPEPNVLYGQVGDGKSD  150

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+A  P
Sbjct  151  HACWMRPEDMTTPRPSYRIDAQHP  174



>gb|KFK37261.1| hypothetical protein AALP_AA4G234600 [Arabis alpina]
Length=688

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG+AL  ++ +F+ Q+SGKL ++ ++ WRGDS L+DG  A +DL+ G YDAGD MKFGFP
Sbjct  227  YGEALTKSLLYFEAQRSGKLPLNQRVDWRGDSALRDGSDAHIDLTGGYYDAGDNMKFGFP  286

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+LAW+ +E   ++    + E    ++KW TDYL+ AHP+ NVLY QVGD + DH
Sbjct  287  MAFTTTMLAWSSVEMTSELMGHMEHENVLAAIKWATDYLIKAHPEPNVLYGQVGDANSDH  346

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT  RP   I+A  P
Sbjct  347  ACWMRPEDMTTPRPSYRIDAQHP  369



>ref|XP_009797971.1| PREDICTED: endoglucanase 6-like isoform X2 [Nicotiana sylvestris]
Length=613

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  +  F++ Q+SG L  D ++ WRG+SGL DGK++ +DL  G YDAGD +KF
Sbjct  19   SHNYGEALSKSFLFYEAQRSGYLPHDQRVQWRGNSGLLDGKASGVDLVGGYYDAGDNVKF  78

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            G PMA+T T+++W+I+EYG QM    +L     ++KW TDYL+ AHP+ NVLY +VGD  
Sbjct  79   GLPMAFTVTMMSWSIIEYGKQMGESGELSNGMDAVKWGTDYLLKAHPEPNVLYGEVGDGT  138

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT SR    I+ S P
Sbjct  139  TDHYCWQRPEDMTTSRAAYRIDPSRP  164



>ref|XP_009143042.1| PREDICTED: endoglucanase 14-like [Brassica rapa]
Length=489

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            PMA+T T+LAW+ +E+  ++   K+      ++KW TDY + AHP+ NVLY QVGD   D
Sbjct  91   PMAFTTTMLAWSSVEWESELKAHKEHRNVLDAIKWATDYFIKAHPEPNVLYGQVGDGKSD  150

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+A  P
Sbjct  151  HACWMRPEDMTTPRPSYRIDAQHP  174



>ref|XP_002454930.1| hypothetical protein SORBIDRAFT_03g001560 [Sorghum bicolor]
 gb|EES00050.1| hypothetical protein SORBIDRAFT_03g001560 [Sorghum bicolor]
Length=654

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y  AL  ++ +F+ Q+SG+L    ++SWR DSGL+DGK+  +DL  G YDAGD +KFG P
Sbjct  46   YRQALSKSILYFEAQRSGRLPGSQRVSWRADSGLRDGKANGVDLVGGYYDAGDNVKFGLP  105

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W++LEYG QMA   +L  A  ++KW TDYLV AHP+ NVLY +VGD D DH
Sbjct  106  MAFTVTMMSWSVLEYGKQMAAAGELGHAVEAIKWGTDYLVKAHPEPNVLYGEVGDGDSDH  165

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT SR    ++   P
Sbjct  166  DCWMRPEDMTTSRQAYRLDPQNP  188



>ref|XP_003525345.1| PREDICTED: endoglucanase 6 [Glycine max]
 gb|KHM99903.1| Endoglucanase 6 [Glycine soja]
Length=624

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  26   YGQALSKSLLFFEAQRSGYLPHNQRVTWRAHSGLQDGKASGVDLVGGYYDAGDNVKFGLP  85

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  86   MAFTVTMMSWSIIEYGKQMAASGELGHAMEAVKWGTDYFIKAHPQPNVLYGEVGDGNTDH  145

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  146  YCWQRPEDMTTDRHAYKIDPSNP  168



>gb|ACT54546.1| endo-1,4-beta-glucanase [Dimocarpus longan]
Length=546

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  23   YGQALTKSILFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLP  82

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  83   MAFTVTMMSWSIIEYGKQMAANGELGHAMDAVKWGTDYFIKAHPQPNVLYGEVGDGNTDH  142

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  143  YCWQRPEDMTTDRRAYKIDPSNP  165



>dbj|BAC22691.1| endo-1,4-beta-D-glucanase [Pyrus communis]
Length=620

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  28   YGQALSNSILFFEAQRSGFLPPNQRVTWRSNSGLYDGKANGVDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGSQMAASGELGHAMDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT +R    I+ S P
Sbjct  148  YCWQRPEDMTTNRQAYKISPSNP  170



>ref|XP_010413050.1| PREDICTED: endoglucanase 14-like [Camelina sativa]
Length=479

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG+AL  ++ +F+ Q+SGKL  N +++WRG+S L+DG    +DL+ G YDAGD MKFGFP
Sbjct  22   YGEALTKSLLYFEAQRSGKLPPNQRVTWRGNSALRDGSDVHVDLTGGYYDAGDNMKFGFP  81

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+LAW+ +E   Q+ V ++ E    +LKW TDYL+ AHP+ +VLY QVG+   DH
Sbjct  82   MAFTTTMLAWSSIEMASQLKVHQEYENVLAALKWATDYLIKAHPEPDVLYGQVGEGYSDH  141

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT  RP   I+A  P
Sbjct  142  GCWMRPEDMTTPRPSFRIDAQHP  164



>emb|CDY47675.1| BnaC04g03840D [Brassica napus]
Length=489

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
             +A+T T+LAW+ +E   ++   K+ E    ++KW TDYL+NAHP+ NVLY QVGD   D
Sbjct  91   SLAFTTTMLAWSSVEMESELKTYKEHENVLAAIKWATDYLINAHPEPNVLYGQVGDGYSD  150

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+   P
Sbjct  151  HACWMRPEDMTTPRPSYRIDVQHP  174



>ref|XP_010452662.1| PREDICTED: endoglucanase 15-like [Camelina sativa]
Length=493

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             Y DAL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A ++L+ G YDAGD +KFGF
Sbjct  35   NYADALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGADAHVNLAGGYYDAGDNVKFGF  94

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            P+A+T T+LAW+ +E   Q+   K+ + A  +LKW TDYL+NAHP  NVLY QVGD   D
Sbjct  95   PLAFTTTMLAWSSVEMESQLKARKEHQNALAALKWATDYLINAHPQPNVLYGQVGDGASD  154

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  R    I+A  P
Sbjct  155  HACWMRPEDMTTPRTSYRIDAQHP  178



>ref|XP_010055859.1| PREDICTED: endoglucanase 6-like [Eucalyptus grandis]
 gb|KCW72407.1| hypothetical protein EUGRSUZ_E00858 [Eucalyptus grandis]
Length=617

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L    +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  27   YGQALSKSILFFEAQRSGYLPSTQRVTWRANSGLSDGKASGVDLVGGYYDAGDNVKFGLP  86

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+ILEYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  87   MAFTVTMMSWSILEYGKQMAAGGELSHAIDAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  146

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  147  YCWQRPEDMTTDRKAYRIDQSNP  169



>ref|XP_010266498.1| PREDICTED: endoglucanase 19 [Nelumbo nucifera]
Length=629

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL   + FF+ Q+SG L  N +I WR DSGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  31   YGQALSKGILFFEAQRSGYLPGNQRIQWRADSGLQDGKASGVDLVGGYYDAGDNVKFGLP  90

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDYL+ AHP   VLY +VGD + DH
Sbjct  91   MAFTITMMSWSIIEYGKQMAATGELGHAMDAVKWGTDYLIKAHPQPYVLYGEVGDGNTDH  150

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+A+ P
Sbjct  151  YCWQRPEDMTTDRRAYKIDANNP  173



>ref|XP_008655784.1| PREDICTED: endoglucanase 2-like isoform X2 [Zea mays]
Length=644

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y +AL  ++ +F+ Q+SG+L    +++WR DSGL DGK+  +DL  G YDAGD +KFG P
Sbjct  35   YREALSKSILYFEAQRSGRLPGSQRVAWRADSGLLDGKANGVDLVGGYYDAGDNVKFGLP  94

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+++EYGDQMA   +L  A  ++KW TDYLV AHP+ NVLY +VGD D DH
Sbjct  95   MAFTVTMMSWSVIEYGDQMAAAGELGHATDAIKWGTDYLVKAHPEPNVLYGEVGDGDSDH  154

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT SR    ++   P
Sbjct  155  DCWMRPEDMTTSRQAYRLDPQNP  177



>ref|XP_009797970.1| PREDICTED: endoglucanase 6-like isoform X1 [Nicotiana sylvestris]
Length=620

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  +  F++ Q+SG L  D ++ WRG+SGL DGK++ +DL  G YDAGD +KF
Sbjct  26   SHNYGEALSKSFLFYEAQRSGYLPHDQRVQWRGNSGLLDGKASGVDLVGGYYDAGDNVKF  85

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            G PMA+T T+++W+I+EYG QM    +L     ++KW TDYL+ AHP+ NVLY +VGD  
Sbjct  86   GLPMAFTVTMMSWSIIEYGKQMGESGELSNGMDAVKWGTDYLLKAHPEPNVLYGEVGDGT  145

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT SR    I+ S P
Sbjct  146  TDHYCWQRPEDMTTSRAAYRIDPSRP  171



>gb|ABC94542.1| endo-1,4-beta-glucanase, partial [Glycine max]
Length=602

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  4    YGQALSKSLLFFEAQRSGYLPHNQRVTWRAHSGLQDGKASGVDLVGGYYDAGDNVKFGLP  63

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  64   MAFTVTMMSWSIIEYGKQMAASGELGHAMEAVKWGTDYFIKAHPQANVLYGEVGDGNTDH  123

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    ++ S P
Sbjct  124  YCWQRPEDMTTDRHAYKVDPSNP  146



>ref|XP_008341511.1| PREDICTED: endoglucanase 6 [Malus domestica]
Length=628

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  28   YGQALSKSILFFEAQRSGFLPRNQRVTWRSNSGLYDGKANGVDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGKQMAASGELGHAMEAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT +R    I+ S P
Sbjct  148  YCWQRPEDMTTNRRAYKISPSNP  170



>ref|NP_001288408.1| endoglucanase 2-like precursor [Zea mays]
 gb|AGG19101.1| cellulase [Zea mays]
Length=624

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y +AL  ++ +F+ Q+SG+L    +++WR DSGL DGK+  +DL  G YDAGD +KFG P
Sbjct  35   YREALSKSILYFEAQRSGRLPGSQRVAWRADSGLLDGKANGVDLVGGYYDAGDNVKFGLP  94

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+++EYGDQMA   +L  A  ++KW TDYLV AHP+ NVLY +VGD D DH
Sbjct  95   MAFTVTMMSWSVIEYGDQMAAAGELGHATDAIKWGTDYLVKAHPEPNVLYGEVGDGDSDH  154

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT SR    ++   P
Sbjct  155  DCWMRPEDMTTSRQAYRLDPQNP  177



>ref|XP_007220712.1| hypothetical protein PRUPE_ppa021556mg, partial [Prunus persica]
 gb|EMJ21911.1| hypothetical protein PRUPE_ppa021556mg, partial [Prunus persica]
Length=463

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YGDAL  ++ +++ Q+SGKL  N ++ WRGDSGLKDG  A +DL  G YDAGD +KFGFP
Sbjct  6    YGDALTKSLLYYEAQRSGKLPPNQRVQWRGDSGLKDGSDAGVDLVGGYYDAGDNVKFGFP  65

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W+ +E+G ++    +L  A  ++KW TDYL+ AH   NVLY ++GD D DH
Sbjct  66   MAFTITMLSWSTIEFGSKLEAKSELSNALDAIKWGTDYLIKAHAAPNVLYGEIGDGDSDH  125

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            +CWQRPEDMT  R    I+   P
Sbjct  126  ECWQRPEDMTTPRTTFKIDEQHP  148



>ref|XP_009346446.1| PREDICTED: endoglucanase 6-like [Pyrus x bretschneideri]
Length=628

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  28   YGQALSKSILFFEAQRSGFLPRNQRVTWRSNSGLYDGKANGVDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+ NVLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGKQMAASGELGHAMEAVKWGTDYFIKAHPEPNVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT +R    I+ S P
Sbjct  148  YCWQRPEDMTTNRRAYKISPSNP  170



>ref|XP_008655783.1| PREDICTED: endoglucanase 2-like isoform X1 [Zea mays]
 gb|AFW80424.1| hypothetical protein ZEAMMB73_262292 [Zea mays]
Length=645

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y +AL  ++ +F+ Q+SG+L    +++WR DSGL DGK+  +DL  G YDAGD +KFG P
Sbjct  35   YREALSKSILYFEAQRSGRLPGSQRVAWRADSGLLDGKANGVDLVGGYYDAGDNVKFGLP  94

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+++EYGDQMA   +L  A  ++KW TDYLV AHP+ NVLY +VGD D DH
Sbjct  95   MAFTVTMMSWSVIEYGDQMAAAGELGHATDAIKWGTDYLVKAHPEPNVLYGEVGDGDSDH  154

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CW RPEDMT SR    ++   P
Sbjct  155  DCWMRPEDMTTSRQAYRLDPQNP  177



>ref|XP_011101037.1| PREDICTED: endoglucanase 6 [Sesamum indicum]
Length=626

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N ++ WRG+SGL DGK + +DL  G YDAGD +KFG P
Sbjct  32   YGQALSKSILFFEAQRSGYLPRNQRVQWRGNSGLSDGKISGVDLVGGYYDAGDNVKFGLP  91

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+ILEYG QM    +L  A  ++KW TDYL+ AHP+  VLY +VGD + DH
Sbjct  92   MAFTITMMSWSILEYGRQMGASGELGHALDAVKWGTDYLIKAHPEPYVLYGEVGDGNTDH  151

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+ S P
Sbjct  152  YCWQRPEDMTTSRAAYKIDPSHP  174



>ref|XP_010913688.1| PREDICTED: endoglucanase 6 [Elaeis guineensis]
Length=626

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  24   YGKALSKSILFFEAQRSGYLPSNQRVTWRANSGLLDGKANGVDLVGGYYDAGDNVKFGLP  83

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T++AW+I EYG QMA   +L  A  ++KW TDYL+ AHP+  VLY +VGD + DH
Sbjct  84   MAFTITMMAWSIAEYGKQMAATGELGHAMEAVKWGTDYLIKAHPEPYVLYGEVGDGNSDH  143

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+A+ P
Sbjct  144  YCWQRPEDMTTSRMAYRIDANHP  166



>ref|XP_009764063.1| PREDICTED: endoglucanase 6-like [Nicotiana sylvestris]
Length=624

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              YG+AL  +  F++ Q+SG L  N ++ WRG+SGL DGK++ +DL  G YDAGD +KFG
Sbjct  22   HNYGEALSKSFLFYEAQRSGYLPHNQRVHWRGNSGLNDGKASGIDLVGGYYDAGDNVKFG  81

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
             PMA+T T+++W+ILEYG QM    +L  A  ++KW TDYL+ AHP+  VLY +VGD + 
Sbjct  82   LPMAFTITMMSWSILEYGRQMGASGELGHAMDAVKWGTDYLLKAHPEPYVLYGEVGDGNT  141

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPEDMT SR    I+ + P
Sbjct  142  DHFCWQRPEDMTTSRAAYRIDPNHP  166



>ref|XP_007160157.1| hypothetical protein PHAVU_002G297600g [Phaseolus vulgaris]
 gb|ESW32151.1| hypothetical protein PHAVU_002G297600g [Phaseolus vulgaris]
Length=622

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  26   YGQALSKSLLFFEAQRSGYLPHNQRVTWRAHSGLQDGKASGVDLVGGYYDAGDNVKFGLP  85

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  86   MAFTVTMMSWSIIEYGKQMAANGELGHAMEAVKWGTDYFIKAHPQANVLYGEVGDGNTDH  145

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  146  YCWQRPEDMTTDRHAYKIDPSNP  168



>ref|XP_003566424.1| PREDICTED: endoglucanase 15-like isoform X1 [Brachypodium distachyon]
Length=631

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL+ ++ +F+ Q+SG L  D K++WR  SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  31   YGMALRKSILYFEAQRSGMLPADQKVTWRASSGLFDGKANGVDLVGGYYDAGDNVKFGLP  90

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+ILEY +QMA   +L+ A  ++KW TDY + AHP+ +VLY +VGD D DH
Sbjct  91   MAFTVTMMSWSILEYVEQMAAAGELQNAMDAVKWGTDYFIKAHPEPDVLYGEVGDGDTDH  150

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  151  SCWQRPEDMTTSRQAFRVDPQNP  173



>ref|XP_010231596.1| PREDICTED: endoglucanase 15-like isoform X2 [Brachypodium distachyon]
Length=617

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL+ ++ +F+ Q+SG L  D K++WR  SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  31   YGMALRKSILYFEAQRSGMLPADQKVTWRASSGLFDGKANGVDLVGGYYDAGDNVKFGLP  90

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+ILEY +QMA   +L+ A  ++KW TDY + AHP+ +VLY +VGD D DH
Sbjct  91   MAFTVTMMSWSILEYVEQMAAAGELQNAMDAVKWGTDYFIKAHPEPDVLYGEVGDGDTDH  150

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  151  SCWQRPEDMTTSRQAFRVDPQNP  173



>ref|NP_181982.1| glycosyl hydrolase 9B9 [Arabidopsis thaliana]
 sp|O64889.1|GUN12_ARATH RecName: Full=Endoglucanase 12; AltName: Full=Endo-1,4-beta glucanase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27456.1| putative cellulase [Arabidopsis thaliana]
 gb|AAM14965.1| putative cellulase [Arabidopsis thaliana]
 gb|AEC10436.1| glycosyl hydrolase 9B9 [Arabidopsis thaliana]
Length=491

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  Y +AL+ ++ +F+ Q+SGKL  N K++WRGDS LKDG  A +DL+ G YDAGD MKF
Sbjct  31   STNYAEALQKSLLYFEAQRSGKLPPNQKVTWRGDSALKDGSDAHIDLTGGYYDAGDNMKF  90

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E G ++    +   +  +LKW TDYL+ AHP  NVLY QVG+ +
Sbjct  91   GFPLAFTTTMLAWSNIEMGSELRAHHEQGNSLRALKWATDYLIKAHPQPNVLYGQVGEGN  150

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCW RPEDMT  R    I+A  P
Sbjct  151  SDHKCWMRPEDMTTPRTSYRIDAQHP  176



>ref|XP_003530388.1| PREDICTED: endoglucanase 6-like [Glycine max]
Length=625

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  27   YGQALSKSLLFFEAQRSGYLPHNQRVTWRAHSGLQDGKASGVDLVGGYYDAGDNVKFGLP  86

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  87   MAFTVTMMSWSIIEYGKQMAASGELGHAMEAVKWGTDYFIKAHPQANVLYGEVGDGNTDH  146

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    ++ S P
Sbjct  147  YCWQRPEDMTTDRHAYKVDPSNP  169



>gb|KHN16746.1| Endoglucanase 6 [Glycine soja]
Length=594

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR  SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  27   YGQALSKSLLFFEAQRSGYLPHNQRVTWRAHSGLQDGKASGVDLVGGYYDAGDNVKFGLP  86

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP  NVLY +VGD + DH
Sbjct  87   MAFTVTMMSWSIIEYGKQMAASGELGHAMEAVKWGTDYFIKAHPQANVLYGEVGDGNTDH  146

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    ++ S P
Sbjct  147  YCWQRPEDMTTDRHAYKVDPSNP  169



>ref|XP_008232258.1| PREDICTED: endoglucanase 14-like [Prunus mume]
Length=485

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YGDAL  ++ +++ Q+SGKL  N ++ WRGDSGLKDG  A +DL  G YDAGD +KFGFP
Sbjct  28   YGDALTKSLLYYEAQRSGKLPPNQRVQWRGDSGLKDGSDAGVDLVGGYYDAGDNVKFGFP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W+ +E+G ++    +L  A  ++KW TDYLV AH   NVLY ++GD D DH
Sbjct  88   MAFTITMLSWSTIEFGSKLDAKSELSNALDAIKWGTDYLVKAHAAPNVLYGEIGDGDSDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
            +CWQRPEDMT  R    I+   P
Sbjct  148  ECWQRPEDMTTPRTTFKIDEQHP  170



>ref|XP_006360711.1| PREDICTED: endoglucanase 6-like [Solanum tuberosum]
Length=617

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL  +  F++ Q+SG L  D ++ WRG+SGL DGK++ +DL  G YDAGD +KF
Sbjct  25   SHNYGEALSKSFLFYEAQRSGYLPHDQRVQWRGNSGLNDGKASGVDLVGGYYDAGDNVKF  84

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            G PMA+T T+++W+I+EYG QM+   +L  A  ++KW  DYL+ AHP+ +VLY +VGD  
Sbjct  85   GLPMAFTVTMMSWSIIEYGKQMSESGELSNAIDAIKWGADYLLKAHPEPHVLYGEVGDGT  144

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DH CWQRPEDMT SR    I+ S P
Sbjct  145  TDHYCWQRPEDMTTSRAAYRIDPSRP  170



>ref|XP_006397635.1| hypothetical protein EUTSA_v10001734mg [Eutrema salsugineum]
 gb|ESQ39088.1| hypothetical protein EUTSA_v10001734mg [Eutrema salsugineum]
Length=493

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +3

Query  384  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  560
             YG+AL  ++ +F+ Q+SGKL  + +++WRGDS L+DG    +DL+ G YDAGD MKFGF
Sbjct  34   NYGEALTKSLLYFEAQRSGKLPWNQRVNWRGDSALRDGSDNHVDLTGGYYDAGDNMKFGF  93

Query  561  PMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLD  740
            P+A+  T+LAW+ +E   Q+   K+ E    +LKW TDYL+ AHP+ NVLY QVGD   D
Sbjct  94   PLAFMTTMLAWSSIEMASQLKAHKEDENVLAALKWATDYLIKAHPEANVLYGQVGDGKSD  153

Query  741  HKCWQRPEDMTESRPLTXINASVP  812
            H CW RPEDMT  RP   I+A  P
Sbjct  154  HDCWIRPEDMTTPRPSYRIDAQYP  177



>ref|XP_010915660.1| PREDICTED: endoglucanase 19-like [Elaeis guineensis]
Length=626

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL   + FF+ Q+SG L  N +++WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  25   YGKALSKGILFFEAQRSGYLPSNQRVTWRANSGLHDGKANGVDLVGGYYDAGDNVKFGLP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDYL+ AHP+ NVLY +VGD + DH
Sbjct  85   MAFTITMMSWSIVEYGKQMAGSGELGHAMDAVKWGTDYLMKAHPEPNVLYGEVGDGNTDH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+ + P
Sbjct  145  ACWQRPEDMTTSRQAYRIDVNHP  167



>ref|XP_004149748.1| PREDICTED: endoglucanase 6-like [Cucumis sativus]
 ref|XP_004162365.1| PREDICTED: endoglucanase 6-like [Cucumis sativus]
 gb|KGN53401.1| hypothetical protein Csa_4G051530 [Cucumis sativus]
Length=619

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL+DGK++ +DL  G YDAGD +KFG P
Sbjct  25   YGQALTKSLLFFEAQRSGYLPHNQRVNWRANSGLQDGKASGVDLVGGYYDAGDNVKFGLP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+  VLY +VGD + DH
Sbjct  85   MAFTVTMMSWSIIEYGKQMATNGELSHALDAVKWGTDYFIKAHPEPYVLYGEVGDGNTDH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  145  YCWQRPEDMTTDRHAYKIDPSNP  167



>ref|XP_008239042.1| PREDICTED: endoglucanase 6 [Prunus mume]
Length=620

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L +N +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  28   YGQALSKSILFFEAQRSGFLPNNQRVTWRANSGLYDGKASGVDLVGGYYDAGDNVKFGLP  87

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP+  VLY +VGD + DH
Sbjct  88   MAFTVTMMSWSIIEYGKQMAASGELAHAMEAVKWGTDYFIKAHPEPYVLYGEVGDGNTDH  147

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  148  YCWQRPEDMTTDRRAYKISPSNP  170



>gb|EMT23865.1| hypothetical protein F775_52481 [Aegilops tauschii]
Length=520

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y  ALK ++ +F+ Q+SG L  D +++WR  SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  32   YAMALKKSLLYFEAQRSGALPPDQRVTWRASSGLFDGKANGVDLVGGYYDAGDNVKFGLP  91

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+ILEYG QMA   +L+ A  ++KW TDY + AHP+ +VLY +VGD D DH
Sbjct  92   MAFTVTMMSWSILEYGKQMAASGELKNAMDAVKWGTDYFIKAHPEPDVLYGEVGDGDTDH  151

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  152  TCWQRPEDMTTSRQAFRVDPQNP  174



>ref|XP_006648310.1| PREDICTED: endoglucanase 5-like [Oryza brachyantha]
Length=568

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              YG+AL  ++ +F+ Q+SG+L  N ++ WRG SGL DG    +DL  G YDAGD +KFG
Sbjct  29   HDYGEALSKSLLYFEAQRSGRLPHNQRVRWRGHSGLTDGLEQGVDLVGGYYDAGDHVKFG  88

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
             PMA+T T+L+W+++EYGD++A   +L  A  ++KW TDY + AH   NVL+ QVGD D 
Sbjct  89   LPMAFTITMLSWSVVEYGDEIAAAGELAHALHAIKWGTDYFIKAHTHPNVLWTQVGDGDS  148

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPEDMT SR    ++A  P
Sbjct  149  DHYCWQRPEDMTTSRHAYKVDAENP  173



>ref|XP_002881963.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58222.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=490

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  YG+AL+ ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYGEALRNSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKF  90

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+    +   +  +LKW TD+L+ AHP+ NVLY QVG+ +
Sbjct  91   GFPLAFTTTMLAWSNIEMASQLRAHHEKGNSLRALKWATDFLIKAHPEPNVLYGQVGEGN  150

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCW RPEDMT  R    I+A  P
Sbjct  151  SDHKCWMRPEDMTTPRTSFRIDAQHP  176



>gb|EAY84498.1| hypothetical protein OsI_05874 [Oryza sativa Indica Group]
Length=349

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = +3

Query  381  QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  557
              YG+AL  ++ +F+ Q+SG+L  N ++ WRG SGL DG    +DL  G YDAGD +KFG
Sbjct  28   HDYGEALSKSLLYFEAQRSGRLPYNQRVRWRGHSGLTDGLEQGVDLVGGYYDAGDHVKFG  87

Query  558  FPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDL  737
             PMA+T T+L+W++LEYG+++A   +L  A  ++KW TDY + AH   NVL+ QVGD D 
Sbjct  88   LPMAFTVTMLSWSVLEYGEEIAAAGELGHALHAIKWGTDYFIKAHTHPNVLWTQVGDGDS  147

Query  738  DHKCWQRPEDMTESRPLTXINASVP  812
            DH CWQRPEDMT SR    ++A  P
Sbjct  148  DHYCWQRPEDMTTSRHAYKVDAENP  172



>ref|NP_181983.1| glycosyl hydrolase 9B10 [Arabidopsis thaliana]
 sp|O64890.1|GUN13_ARATH RecName: Full=Endoglucanase 13; AltName: Full=Endo-1,4-beta glucanase 
13; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27457.1| putative glucanase [Arabidopsis thaliana]
 gb|AAM14964.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10437.1| glycosyl hydrolase 9B10 [Arabidopsis thaliana]
Length=490

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 100/146 (68%), Gaps = 1/146 (1%)
 Frame = +3

Query  378  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  554
            +  Y +ALK ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYAEALKNSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKF  90

Query  555  GFPMAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPD  734
            GFP+A+T T+LAW+ +E   Q+    +   A  +LKW TDYL+ AHP  NVLY QVG+ +
Sbjct  91   GFPLAFTTTMLAWSNIEMASQLRAHHEKGNALRALKWATDYLIKAHPQPNVLYGQVGEGN  150

Query  735  LDHKCWQRPEDMTESRPLTXINASVP  812
             DHKCW RPEDMT  R    I+A  P
Sbjct  151  SDHKCWMRPEDMTTPRTSYRIDAQHP  176



>ref|XP_011005905.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=317

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YGDAL+ ++ +F+ Q+SG+L  + +++WR  SGL DG    +DL  G YDAGD +KFG P
Sbjct  45   YGDALRKSLLYFESQRSGRLPYNQRVTWRHHSGLTDGLEQGVDLVGGYYDAGDHVKFGLP  104

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W ++E+  Q+A+  +LE A  ++KW TDY + AH   NVL+ +VGD D DH
Sbjct  105  MAFTVTMLSWNVIEFQHQIAIAGELEHALEAIKWGTDYFIKAHTSPNVLWAEVGDGDTDH  164

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+ + P
Sbjct  165  YCWQRPEDMTTSRQAYKIDENNP  187



>ref|XP_010096825.1| Endoglucanase 6 [Morus notabilis]
 gb|EXB66085.1| Endoglucanase 6 [Morus notabilis]
Length=478

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK++ +DL  G YDAGD +KFG P
Sbjct  27   YGQALSKSLLFFEAQRSGYLPHNQRVTWRANSGLNDGKASGVDLVGGYYDAGDNVKFGLP  86

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDY + AHP   VLY +VGD + DH
Sbjct  87   MAFTVTMVSWSIIEYGKQMAANGELSHAMDAVKWGTDYFIKAHPQPYVLYGEVGDGNSDH  146

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT  R    I+ S P
Sbjct  147  YCWQRPEDMTTDRRAYRIDPSNP  169



>ref|XP_008783846.1| PREDICTED: endoglucanase 19-like [Phoenix dactylifera]
Length=626

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ FF+ Q+SG L  N +++WR +SGL DGK+  ++L  G YDAGD +KFG P
Sbjct  25   YGKALSKSILFFEAQRSGYLPSNQRVTWRANSGLLDGKANGVNLVGGYYDAGDNVKFGLP  84

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W+I+EYG QMA   +L  A  ++KW TDYL+ AHP+ NVLY +VGD + DH
Sbjct  85   MAFTITMMSWSIVEYGKQMAGSGELGHAMDAVKWGTDYLIKAHPEPNVLYGEVGDGNTDH  144

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+ + P
Sbjct  145  SCWQRPEDMTTSRQAYRIDVNHP  167



>ref|XP_002301602.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE80875.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
Length=333

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YGDAL+ ++ +F+ Q+SG+L  + +++WR  SGL DG    +DL  G YDAGD +KFG P
Sbjct  45   YGDALRKSLLYFESQRSGRLPYNQRVTWRHHSGLTDGLEQGVDLVGGYYDAGDHVKFGLP  104

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+L+W ++E+  Q+AV  +LE A  ++KW TDY + AH   NVL+ +VGD D DH
Sbjct  105  MAFTVTMLSWNVIEFQHQIAVAGELEHALEAIKWGTDYFIKAHTSPNVLWAEVGDGDTDH  164

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    I+ + P
Sbjct  165  YCWQRPEDMTTSRQAYKIDENNP  187



>ref|NP_001042423.1| Os01g0220100 [Oryza sativa Japonica Group]
 sp|Q5NAT0.1|GUN2_ORYSJ RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; AltName: Full=OsCel9A; AltName: Full=OsGLU5; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAD81360.1| putative endo-beta-1,4-glucanase [Oryza sativa Japonica Group]
 dbj|BAD81426.1| putative endo-beta-1,4-glucanase [Oryza sativa Japonica Group]
 dbj|BAF04337.1| Os01g0220100 [Oryza sativa Japonica Group]
 dbj|BAF37260.1| endo-beta-1,4-D-glucanase [Oryza sativa]
 gb|EAZ11064.1| hypothetical protein OsJ_00909 [Oryza sativa Japonica Group]
Length=640

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ +F+ Q+SG L    +I+WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  41   YGMALSKSILYFEAQRSGVLPGSQRIAWRANSGLADGKANGVDLVGGYYDAGDNVKFGLP  100

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T++AW+++EYG++MA   +L  A  ++KW TDY   AHP+ NVLY +VGD D DH
Sbjct  101  MAFTVTMMAWSVIEYGEEMAAAGELGHAVEAIKWGTDYFAKAHPEPNVLYAEVGDGDSDH  160

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  161  NCWQRPEDMTTSRQAYRLDPQNP  183



>gb|EAY73052.1| hypothetical protein OsI_00928 [Oryza sativa Indica Group]
Length=640

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            YG AL  ++ +F+ Q+SG L    +I+WR +SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  41   YGMALSKSILYFEAQRSGVLPGSQRIAWRANSGLADGKANGVDLVGGYYDAGDNVKFGLP  100

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T++AW+++EYG++MA   +L  A  ++KW TDY   AHP+ NVLY +VGD D DH
Sbjct  101  MAFTVTMMAWSVIEYGEEMAAAGELGHAVEAIKWGTDYFAKAHPEPNVLYAEVGDGDSDH  160

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDMT SR    ++   P
Sbjct  161  NCWQRPEDMTTSRQAYRLDPQNP  183



>ref|XP_002440792.1| hypothetical protein SORBIDRAFT_09g006670 [Sorghum bicolor]
 gb|EES19222.1| hypothetical protein SORBIDRAFT_09g006670 [Sorghum bicolor]
Length=627

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 1/143 (1%)
 Frame = +3

Query  387  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  563
            Y  ALK  + +F+ Q+SG L  N +++WRG+SGL DGK+  +DL  G YDAGD +KFG P
Sbjct  29   YASALKKTILYFEAQRSGVLPPNQRVTWRGNSGLFDGKANGVDLVGGYYDAGDNVKFGLP  88

Query  564  MAYTATVLAWTILEYGDQMAVVKQLEPAKGSLKWITDYLVNAHPDDNVLYIQVGDPDLDH  743
            MA+T T+++W ILEYG QMA   +L  A  ++KW TDY + AHP+  VLY +VGD D DH
Sbjct  89   MAFTVTMMSWGILEYGRQMAAAGELRNAMDAVKWGTDYFIKAHPEPEVLYGEVGDGDTDH  148

Query  744  KCWQRPEDMTESRPLTXINASVP  812
             CWQRPEDM+ SR    I+   P
Sbjct  149  SCWQRPEDMSTSRQSFRIDPQNP  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1646677518220