BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041F20

Length=839
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACN40426.1|  unknown                                                 456   2e-158   Picea sitchensis
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     455   4e-158   
emb|CBI29424.3|  unnamed protein product                                454   6e-158   Vitis vinifera
gb|AAN33000.1|  alpha-tubulin 4                                         454   7e-158   Gossypium hirsutum [American cotton]
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          458   1e-157   
emb|CBI19330.3|  unnamed protein product                                456   2e-157   Vitis vinifera
emb|CBI25125.3|  unnamed protein product                                456   2e-157   Vitis vinifera
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   455   4e-157   Citrus sinensis [apfelsine]
emb|CBI22190.3|  unnamed protein product                                455   5e-157   Vitis vinifera
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     457   6e-157   
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    457   8e-157   
ref|XP_002510010.1|  tubulin alpha chain, putative                      457   1e-156   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           457   1e-156   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         457   1e-156   Pseudotsuga menziesii var. menziesii
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             456   1e-156   Citrus clementina [clementine]
ref|XP_002522104.1|  tubulin alpha chain, putative                      456   1e-156   Ricinus communis
ref|XP_007018369.1|  Tubulin alpha-2 chain                              456   1e-156   Theobroma cacao [chocolate]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         456   2e-156   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           456   2e-156   Betula pendula [white birch]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     456   2e-156   Eucalyptus grandis [rose gum]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        456   2e-156   Tarenaya hassleriana [spider flower]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              456   2e-156   Theobroma cacao [chocolate]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   456   2e-156   Fragaria vesca subsp. vesca
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        455   2e-156   
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             456   2e-156   Prunus persica
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          456   2e-156   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                456   2e-156   Pyrus x bretschneideri [bai li]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    455   2e-156   
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                456   2e-156   Elaeis guineensis
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             456   2e-156   Populus trichocarpa [western balsam poplar]
gb|ABK92552.1|  unknown                                                 456   2e-156   Populus trichocarpa [western balsam poplar]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    456   2e-156   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             456   2e-156   Citrus clementina [clementine]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                456   2e-156   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     455   2e-156   
gb|ABO47736.1|  alpha-tubulin                                           456   3e-156   Gossypium hirsutum [American cotton]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     456   3e-156   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     456   3e-156   Pyrus x bretschneideri [bai li]
gb|AGG37283.1|  alpha-tubulin 1                                         456   3e-156   Salix arbutifolia
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          455   3e-156   
dbj|BAP59012.1|  alpha tubulin                                          456   3e-156   Taxus cuspidata [ichii]
gb|AGG37287.1|  alpha-tubulin 5                                         456   3e-156   Salix arbutifolia
gb|AGG37285.1|  alpha-tubulin 3                                         456   3e-156   Salix arbutifolia
gb|KHG18997.1|  Tubulin alpha chain                                     456   3e-156   Gossypium arboreum [tree cotton]
ref|WP_039310890.1|  hypothetical protein                               456   3e-156   
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   455   4e-156   Populus euphratica
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                455   4e-156   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                455   4e-156   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     455   4e-156   Carthamus tinctorius
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     454   4e-156   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     455   5e-156   Nicotiana tomentosiformis
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         455   5e-156   Jatropha curcas
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     455   5e-156   Nicotiana sylvestris
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   455   5e-156   Vitis vinifera
gb|ABO47740.1|  alpha-tubulin                                           455   6e-156   Gossypium hirsutum [American cotton]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                455   6e-156   Populus euphratica
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     455   6e-156   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    454   7e-156   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        454   7e-156   Glycine max [soybeans]
gb|AIX10966.1|  tubulin                                                 454   7e-156   Ornithogalum longebracteatum [sea-onion]
gb|AAO23139.1|  alpha tubulin                                           454   8e-156   Populus tremuloides
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                454   8e-156   Nelumbo nucifera [Indian lotus]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             454   8e-156   Eutrema salsugineum [saltwater cress]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     454   8e-156   Nelumbo nucifera [Indian lotus]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    454   8e-156   Gossypium hirsutum [American cotton]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     454   8e-156   
gb|AHJ80818.1|  Tua1                                                    448   9e-156   Eragrostis tef [tef]
gb|ABO47739.1|  alpha-tubulin                                           454   9e-156   Gossypium hirsutum [American cotton]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              456   1e-155   
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             454   1e-155   Selaginella moellendorffii
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    454   1e-155   Gossypium hirsutum [American cotton]
ref|XP_001764722.1|  predicted protein                                  454   1e-155   
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                454   1e-155   Prunus dulcis [sweet almond]
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              453   1e-155   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                454   1e-155   Solanum tuberosum [potatoes]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     454   1e-155   Phoenix dactylifera
dbj|BAC24800.1|  alpha tubulin                                          454   1e-155   Physcomitrella patens
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    454   1e-155   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             454   1e-155   Populus trichocarpa [western balsam poplar]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                454   1e-155   Phoenix dactylifera
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   454   1e-155   Nicotiana tomentosiformis
gb|ABK92520.1|  unknown                                                 454   1e-155   Populus trichocarpa [western balsam poplar]
ref|XP_010093625.1|  Tubulin alpha chain                                454   2e-155   Morus notabilis
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             454   2e-155   Hordeum vulgare [barley]
emb|CDY25017.1|  BnaC02g39910D                                          452   2e-155   Brassica napus [oilseed rape]
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    453   2e-155   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         454   2e-155   Jatropha curcas
emb|CAB66336.1|  alpha-tubulin                                          453   2e-155   Betula pendula [white birch]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     453   2e-155   Vitis vinifera
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     453   2e-155   Sesamum indicum [beniseed]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              453   2e-155   Cucumis sativus [cucumbers]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 453   2e-155   Populus trichocarpa [western balsam poplar]
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     453   2e-155   
gb|ACN40181.1|  unknown                                                 453   2e-155   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     453   2e-155   Vitis vinifera
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              453   2e-155   Solanum lycopersicum
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             453   2e-155   Prunus persica
gb|ABB02631.1|  unknown                                                 453   2e-155   Solanum tuberosum [potatoes]
gb|AAO73546.1|  alpha-tubulin                                           453   3e-155   Ceratopteris richardii
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              453   3e-155   Camelina sativa [gold-of-pleasure]
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              453   3e-155   Nicotiana tomentosiformis
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              453   3e-155   
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              453   3e-155   Populus euphratica
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             453   3e-155   Selaginella moellendorffii
gb|ABQ59633.1|  alpha-tubulin 3                                         453   3e-155   Populus tremuloides
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        453   3e-155   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_849388.1|  tubulin alpha-6 chain                                 452   3e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                453   3e-155   Vitis vinifera
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                453   3e-155   Elaeis guineensis
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          453   3e-155   Malus domestica [apple tree]
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             453   3e-155   Prunus persica
emb|CAD13176.1|  alpha-tubulin                                          453   3e-155   Nicotiana tabacum [American tobacco]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     453   3e-155   Glycine max [soybeans]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                453   4e-155   Elaeis guineensis
gb|ABO47737.1|  alpha-tubulin                                           453   4e-155   Gossypium hirsutum [American cotton]
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    452   4e-155   Glycine max [soybeans]
gb|ACU19580.1|  unknown                                                 452   4e-155   Glycine max [soybeans]
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        453   4e-155   Brassica rapa
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              452   4e-155   Fragaria vesca subsp. vesca
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    452   4e-155   Glycine max [soybeans]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                453   4e-155   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              453   4e-155   Medicago truncatula
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        451   4e-155   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                452   4e-155   Cicer arietinum [garbanzo]
emb|CDY66630.1|  BnaCnng51680D                                          452   4e-155   Brassica napus [oilseed rape]
gb|KHN01709.1|  Tubulin alpha chain                                     452   4e-155   Glycine soja [wild soybean]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    452   4e-155   Gossypium raimondii
gb|KHG20487.1|  Tubulin alpha chain                                     452   5e-155   Gossypium arboreum [tree cotton]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     452   5e-155   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                452   5e-155   Cucumis sativus [cucumbers]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    452   6e-155   
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          452   6e-155   
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    452   6e-155   Tarenaya hassleriana [spider flower]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               452   7e-155   Pisum sativum [garden pea]
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    451   7e-155   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    452   7e-155   Arabis alpina [alpine rockcress]
dbj|BAB19779.1|  alpha tubulin                                          452   7e-155   Nicotiana tabacum [American tobacco]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              452   7e-155   Medicago truncatula
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              452   7e-155   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              452   8e-155   Oryza brachyantha
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   452   9e-155   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          452   9e-155   Citrus sinensis [apfelsine]
ref|NP_171974.1|  tubulin alpha-4 chain                                 452   9e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    452   9e-155   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                452   1e-154   Phoenix dactylifera
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          452   1e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                452   1e-154   Fragaria vesca subsp. vesca
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             451   1e-154   Capsella rubella
gb|AGE09583.1|  TUA1-like protein                                       451   1e-154   Eucalyptus cladocalyx
gb|KEH43997.1|  tubulin beta-1 chain                                    451   1e-154   Medicago truncatula
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   451   1e-154   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   451   1e-154   Malus domestica [apple tree]
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    451   1e-154   Brassica rapa
ref|NP_001289660.1|  tubulin alpha chain-like                           451   1e-154   Eucalyptus grandis [rose gum]
ref|NP_001067613.1|  Os11g0247300                                       451   1e-154   
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          452   1e-154   
gb|AFV46219.1|  hypothetical protein                                    451   2e-154   Scutellaria baicalensis [Baikal skullcap]
gb|AHZ58482.1|  alpha-tubulin                                           444   2e-154   Syntrichia caninervis
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        451   2e-154   Cucumis melo [Oriental melon]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             451   2e-154   Phaseolus vulgaris [French bean]
dbj|BAJ06362.1|  alpha-tubulin                                          451   2e-154   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   451   2e-154   Brachypodium distachyon [annual false brome]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              451   2e-154   Setaria italica
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             451   2e-154   Phaseolus vulgaris [French bean]
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                451   2e-154   Eucalyptus grandis [rose gum]
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                451   3e-154   Daucus carota [carrots]
gb|AHJ80822.1|  Tua1                                                    451   3e-154   Eragrostis tef [tef]
gb|ABQ59634.1|  alpha-tubulin 5                                         451   3e-154   Populus tremuloides
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        451   3e-154   
emb|CDP02221.1|  unnamed protein product                                451   3e-154   Coffea canephora [robusta coffee]
gb|AHJ80817.1|  Tua1                                                    451   3e-154   Eragrostis tef [tef]
ref|NP_001167663.1|  tubulin alpha-3 chain                              451   3e-154   Zea mays [maize]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    451   3e-154   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          451   3e-154   Miscanthus sinensis
emb|CAA06619.1|  alpha-tubulin 1                                        451   3e-154   Eleusine indica [crabgrass]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              450   3e-154   Glycine max [soybeans]
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             450   3e-154   Phaseolus vulgaris [French bean]
ref|NP_193232.1|  tubulin alpha-6 chain                                 450   4e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     450   4e-154   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              450   4e-154   Oryza brachyantha
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             450   4e-154   Selaginella moellendorffii
gb|ADW66593.1|  alpha tubulin                                           446   4e-154   Hirschfeldia incana [buchanweed]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   450   4e-154   Brassica rapa
gb|AIX10773.1|  alpha tubulin                                           450   4e-154   Panax notoginseng [san-qi]
ref|XP_002517492.1|  tubulin alpha chain, putative                      450   5e-154   Ricinus communis
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              450   6e-154   Camelina sativa [gold-of-pleasure]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        450   6e-154   Camelina sativa [gold-of-pleasure]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             449   6e-154   Phaseolus vulgaris [French bean]
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     449   6e-154   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              450   6e-154   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   450   6e-154   Zea mays [maize]
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          449   7e-154   
ref|NP_001291325.1|  tubulin alpha chain-like                           449   7e-154   Sesamum indicum [beniseed]
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    449   7e-154   Gossypium hirsutum [American cotton]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    449   7e-154   Glycine max [soybeans]
gb|ACH68563.1|  alpha-tubulin                                           449   9e-154   Solanum tuberosum [potatoes]
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             449   1e-153   Selaginella moellendorffii
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             449   1e-153   Hordeum vulgare [barley]
gb|ABD92930.1|  alpha tubulin-2A                                        449   1e-153   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             449   1e-153   Selaginella moellendorffii
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              449   1e-153   Nicotiana tomentosiformis
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     449   2e-153   Sesamum indicum [beniseed]
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             449   2e-153   Prunus persica
gb|ABG78593.1|  alpha-tubulin                                           449   2e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    447   2e-153   Citrus sinensis [apfelsine]
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             448   2e-153   
gb|ABV55999.1|  alpha-tubulin 7                                         448   2e-153   Populus tremuloides
gb|ABP65320.1|  alpha tubulin                                           448   2e-153   Capsicum annuum
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              448   2e-153   Nicotiana sylvestris
ref|NP_001051132.1|  Os03g0726100                                       448   2e-153   
gb|AGG37289.1|  alpha-tubulin 7                                         448   2e-153   Salix arbutifolia
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     448   2e-153   Populus euphratica
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              447   2e-153   Oryza sativa Japonica Group [Japonica rice]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             448   3e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    448   3e-153   Brassica rapa
gb|AHJ80816.1|  Tua1                                                    448   3e-153   Eragrostis tef [tef]
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                448   3e-153   Triticum aestivum [Canadian hard winter wheat]
gb|AHJ80815.1|  Tua1                                                    448   3e-153   Eragrostis tef [tef]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                448   3e-153   Nelumbo nucifera [Indian lotus]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              448   4e-153   Oryza brachyantha
gb|KHN42598.1|  Tubulin alpha-2 chain                                   447   4e-153   Glycine soja [wild soybean]
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        448   4e-153   
gb|KJB58757.1|  hypothetical protein B456_009G224800                    446   4e-153   Gossypium raimondii
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    447   5e-153   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             447   6e-153   Anemia phyllitidis
gb|ABO47742.1|  alpha-tubulin                                           447   7e-153   Gossypium hirsutum [American cotton]
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             447   7e-153   Selaginella moellendorffii
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              447   8e-153   Selaginella moellendorffii
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             447   9e-153   Citrus clementina [clementine]
emb|CAA62917.1|  alfa-tubulin                                           447   9e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                447   9e-153   Cucumis sativus [cucumbers]
ref|XP_005651460.1|  tubulin alpha chain                                447   1e-152   Coccomyxa subellipsoidea C-169
ref|XP_007032501.1|  Tubulin alpha-2 chain                              447   1e-152   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   446   1e-152   Nelumbo nucifera [Indian lotus]
dbj|BAJ98211.1|  predicted protein                                      446   1e-152   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002508010.1|  alpha tubulin 2                                    446   1e-152   Micromonas commoda
gb|AAB84298.1|  tubulin                                                 446   2e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_001777081.1|  predicted protein                                  446   2e-152   
ref|XP_005851144.1|  alpha-tubulin                                      446   2e-152   Chlorella variabilis
ref|XP_001782790.1|  predicted protein                                  446   2e-152   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             446   2e-152   Selaginella moellendorffii
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  446   2e-152   Brassica napus [oilseed rape]
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              446   2e-152   Solanum lycopersicum
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             446   2e-152   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                445   3e-152   Nicotiana tomentosiformis
gb|AHJ80823.1|  Tua1                                                    445   3e-152   Eragrostis tef [tef]
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              445   4e-152   Solanum tuberosum [potatoes]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                445   4e-152   Solanum lycopersicum
ref|XP_005643073.1|  tubulin alpha chain                                445   4e-152   Coccomyxa subellipsoidea C-169
emb|CAA62916.1|  alpha-tubulin                                          445   4e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             445   5e-152   Selaginella moellendorffii
ref|XP_010099392.1|  Tubulin alpha chain                                446   5e-152   
emb|CDO97305.1|  unnamed protein product                                445   5e-152   Coffea canephora [robusta coffee]
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             444   6e-152   Selaginella moellendorffii
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                444   7e-152   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010104543.1|  Tubulin alpha chain                                444   7e-152   
gb|ACY05960.1|  alpha-tubulin                                           441   1e-151   Haematococcus lacustris
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                444   2e-151   Tetrahymena pyriformis
gb|ACK76232.1|  alpha-tubulin                                           443   2e-151   Dimocarpus longan [longan]
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    443   2e-151   Tetrahymena thermophila SB210
ref|XP_010096739.1|  Tubulin alpha chain                                443   2e-151   
ref|XP_003058621.1|  alpha tubulin                                      443   2e-151   Micromonas pusilla CCMP1545
gb|AIA82433.1|  alpha-tubulin-like protein 01                           443   2e-151   Stentor coeruleus
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             442   5e-151   Chlamydomonas reinhardtii
gb|AAX63396.1|  alpha-tubulin                                           442   5e-151   Haematococcus lacustris
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   442   6e-151   Monoraphidium neglectum
ref|XP_001691876.1|  alpha tubulin 1                                    442   6e-151   Chlamydomonas reinhardtii
gb|AIA82437.1|  alpha-tubulin-like protein 06                           438   6e-151   Stentor coeruleus
gb|AEW46684.1|  beta-tubulin                                            442   6e-151   Ulva linza
ref|XP_002951007.1|  alpha tubulin                                      442   6e-151   Volvox carteri f. nagariensis
emb|CDP00974.1|  unnamed protein product                                441   1e-150   Coffea canephora [robusta coffee]
gb|KIZ03400.1|  Tubulin alpha chain                                     441   1e-150   Monoraphidium neglectum
gb|ACH70610.1|  alpha tubulin                                           441   1e-150   Ulva fasciata
gb|AAB86649.1|  alpha-tubulin                                           441   1e-150   Chloromonas sp. ANT1
emb|CBI16534.3|  unnamed protein product                                440   1e-150   Vitis vinifera
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   441   2e-150   Ichthyophthirius multifiliis
gb|ABC59068.2|  alpha tubulin 1                                         440   3e-150   Camellia sinensis [black tea]
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                440   4e-150   Erythranthe guttata [common monkey flower]
dbj|BAJ06364.1|  alpha-tubulin                                          440   4e-150   Alopecurus aequalis
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              440   4e-150   
emb|CDW82295.1|  alpha tubulin                                          440   4e-150   
gb|EJY81124.1|  Alpha tubulin,putative                                  439   6e-150   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           439   6e-150   
dbj|BAJ97454.1|  predicted protein                                      436   6e-150   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   439   7e-150   
gb|KJB83376.1|  hypothetical protein B456_013G244600                    432   7e-150   
emb|CAA67848.1|  alpha-tubulin                                          439   1e-149   
ref|XP_008606530.1|  tubulin alpha                                      434   1e-149   
gb|ABD92937.1|  alpha tubulin-4A                                        439   1e-149   
gb|ABD92936.1|  alpha tubulin-4D                                        439   1e-149   
gb|AAB08791.1|  alpha tubulin                                           438   2e-149   
ref|XP_001454509.1|  hypothetical protein                               438   2e-149   
ref|XP_001460309.1|  hypothetical protein                               437   2e-149   
emb|CAI38956.1|  alpha_tubulin,putative                                 438   2e-149   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   438   2e-149   
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        437   2e-149   
gb|KJB83377.1|  hypothetical protein B456_013G244600                    434   2e-149   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              438   2e-149   
gb|AAB86648.1|  alpha-tubulin                                           438   2e-149   
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              437   4e-149   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   437   5e-149   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   437   5e-149   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              437   6e-149   
emb|CDY42294.1|  BnaC02g09000D                                          437   6e-149   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              437   6e-149   
ref|XP_001770881.1|  predicted protein                                  437   6e-149   
ref|XP_002904194.1|  alpha-tubulin                                      437   6e-149   
ref|NP_197478.1|  tubulin alpha-3                                       437   7e-149   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              437   7e-149   
emb|CDP12358.1|  unnamed protein product                                437   7e-149   
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   437   7e-149   
emb|CDY44941.1|  BnaA02g04460D                                          437   7e-149   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             437   7e-149   
emb|CDX88875.1|  BnaA03g07740D                                          436   9e-149   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                436   9e-149   
gb|ETL99793.1|  tubulin alpha chain                                     433   9e-149   
gb|AEF79970.1|  alpha-tubulin protein                                   436   1e-148   
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              436   1e-148   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   436   1e-148   
gb|AAT09064.1|  alpha tubulin 2                                         436   1e-148   
gb|ACN40824.1|  unknown                                                 436   1e-148   
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        435   1e-148   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           437   2e-148   
gb|AAW57312.1|  alpha-tubulin                                           431   2e-148   
sp|P07304.2|TBA1_STYLE  RecName: Full=Tubulin alpha-1 chain             436   2e-148   
ref|XP_001455356.1|  hypothetical protein                               436   2e-148   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                436   2e-148   
gb|AAT09063.1|  alpha tubulin 1                                         436   2e-148   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             436   2e-148   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   435   2e-148   
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    435   3e-148   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        435   3e-148   
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             435   3e-148   
gb|AFC88824.1|  putative tubulin alpha-3 chain                          435   3e-148   
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650          435   4e-148   
gb|AEG74028.1|  alpha-tubulin                                           435   4e-148   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              435   4e-148   
ref|NP_001105440.1|  tubulin alpha-3 chain                              435   4e-148   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   434   6e-148   
ref|XP_002532068.1|  tubulin alpha chain, putative                      434   6e-148   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              434   7e-148   
ref|NP_001060075.1|  Os07g0574800                                       434   8e-148   
dbj|BAM28754.1|  tubulin                                                431   8e-148   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   434   9e-148   
emb|CAB77671.1|  alpha-tubulin                                          434   1e-147   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    434   1e-147   
gb|ETM30643.1|  tubulin alpha chain                                     433   1e-147   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              433   1e-147   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  433   2e-147   
gb|KJB80786.1|  hypothetical protein B456_013G115100                    433   2e-147   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              433   2e-147   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     433   2e-147   
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              433   2e-147   
ref|XP_003629736.1|  Alpha-tubulin                                      433   2e-147   
ref|XP_008872990.1|  tubulin alpha chain                                433   2e-147   
emb|CAL80740.1|  alpha-tubulin                                          433   2e-147   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          433   2e-147   
emb|CCI41153.1|  unnamed protein product                                433   2e-147   
ref|XP_008900864.1|  tubulin alpha chain                                433   2e-147   
gb|ETO82054.1|  tubulin alpha chain                                     433   2e-147   
ref|XP_002904195.1|  alpha-tubulin, putative                            433   2e-147   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    433   2e-147   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             433   2e-147   
gb|ETM52951.1|  tubulin alpha chain                                     433   2e-147   
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             433   2e-147   
ref|XP_001419217.1|  predicted protein                                  433   2e-147   
ref|XP_009842456.1|  tubulin alpha chain                                433   2e-147   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   433   2e-147   
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             432   3e-147   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   432   3e-147   
gb|ABD92943.1|  alpha tubulin-1B                                        432   3e-147   
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        432   3e-147   
emb|CAD26886.1|  alpha-tubulin                                          432   3e-147   
gb|ABD92942.1|  alpha tubulin-1D                                        432   4e-147   
gb|EPS70933.1|  tubulin alpha-6 chain                                   426   4e-147   
emb|CAD26887.1|  alpha-tubulin                                          432   5e-147   
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    431   5e-147   
emb|CAD26893.1|  alpha-tubulin                                          432   5e-147   
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    432   5e-147   
gb|AIC33057.1|  tubulin alpha-1 chain                                   432   5e-147   
ref|NP_001237301.1|  tubulin A                                          432   6e-147   
ref|NP_001105588.1|  tubulin alpha-6 chain                              432   6e-147   
emb|CAD24767.1|  alpha-tubulin                                          432   6e-147   
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    431   7e-147   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    432   7e-147   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   431   8e-147   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   431   9e-147   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              431   9e-147   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              431   1e-146   
dbj|BAJ06363.1|  alpha-tubulin                                          431   1e-146   
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   431   1e-146   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                431   1e-146   
ref|XP_673091.1|  hypothetical protein                                  424   2e-146   
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    431   2e-146   
sp|P09243.1|TBA2_STYLE  RecName: Full=Tubulin alpha-2 chain             430   2e-146   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             430   3e-146   
emb|CAD24765.1|  alpha-tubulin                                          430   3e-146   
emb|CAD26889.1|  alpha-tubulin                                          430   3e-146   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              430   3e-146   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              430   3e-146   
ref|XP_002675196.1|  alpha-tubulin                                      430   3e-146   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              430   3e-146   
ref|NP_001275271.1|  alpha-tubulin-like protein                         430   3e-146   
gb|AGG37290.1|  alpha-tubulin 8                                         430   3e-146   
gb|AGD80034.1|  alpha-tubulin 1                                         430   3e-146   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                430   4e-146   
emb|CAD26891.1|  alpha-tubulin                                          430   4e-146   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              430   4e-146   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   430   4e-146   
gb|AEN19682.1|  alpha-tubulin                                           428   5e-146   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              429   5e-146   
emb|CAE52514.1|  alpha tubulin                                          429   5e-146   
gb|AEN19681.1|  alpha-tubulin                                           427   5e-146   
emb|CAD24766.1|  alpha-tubulin                                          429   6e-146   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   429   6e-146   
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        429   7e-146   
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         429   7e-146   
emb|CAD26890.1|  alpha-tubulin                                          429   7e-146   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              429   7e-146   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             429   7e-146   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              429   8e-146   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   429   9e-146   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              429   1e-145   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             429   1e-145   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 429   1e-145   
ref|NP_001105324.1|  tubulin alpha-5 chain                              429   1e-145   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     429   1e-145   
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                428   1e-145   
gb|AGG37284.1|  alpha-tubulin 2                                         428   1e-145   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              428   1e-145   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             428   1e-145   
emb|CDP17586.1|  unnamed protein product                                428   2e-145   
gb|AEQ75493.1|  alpha-tubulin                                           427   2e-145   
gb|AGG37286.1|  alpha-tubulin 4                                         428   2e-145   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           428   2e-145   
ref|NP_001275086.1|  uncharacterized LOC102577521                       428   2e-145   
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              428   2e-145   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        427   3e-145   
gb|AGY80453.1|  tubulin                                                 427   3e-145   
ref|NP_001242878.1|  uncharacterized protein LOC100806907               427   3e-145   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                427   4e-145   
ref|XP_009833024.1|  tubulin alpha chain                                427   4e-145   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 427   4e-145   
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               427   4e-145   
ref|XP_007014666.1|  Tubulin alpha-5                                    427   5e-145   
gb|KHG26159.1|  Tubulin alpha-6 chain                                   427   5e-145   
ref|XP_008616224.1|  tubulin alpha chain                                427   5e-145   
gb|AAO63773.2|  alpha-tubulin 2                                         427   5e-145   
ref|XP_002364807.1|  tubulin alpha chain                                427   6e-145   
gb|KDO55010.1|  hypothetical protein CISIN_1g0157541mg                  423   6e-145   
gb|KDO30581.1|  tubulin alpha chain                                     427   6e-145   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              427   6e-145   
emb|CAB77672.1|  alpha-tubulin                                          427   7e-145   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              426   7e-145   
gb|ABO47735.1|  alpha-tubulin                                           426   8e-145   
emb|CAD26888.1|  alpha-tubulin                                          426   8e-145   
gb|ABO47741.1|  alpha-tubulin                                           426   9e-145   
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         426   1e-144   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              426   1e-144   
emb|CCC46467.1|  putative alpha tubulin, fragment                       419   2e-144   
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   426   2e-144   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     426   2e-144   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                426   2e-144   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    425   2e-144   
gb|ABV55994.1|  alpha-tubulin 6                                         425   3e-144   
ref|XP_002525416.1|  tubulin alpha chain, putative                      425   3e-144   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              425   3e-144   
gb|ABP65323.1|  alpha tubulin                                           425   4e-144   
emb|CAA77816.1|  alpha-Tubulin                                          425   4e-144   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   425   4e-144   
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             425   4e-144   
emb|CAD24768.1|  alpha-tubulin                                          425   4e-144   
sp|P28268.1|TBA_EUPVA  RecName: Full=Tubulin alpha chain                425   4e-144   
ref|XP_724313.1|  hypothetical protein                                  424   6e-144   
gb|ABO47738.1|  alpha-tubulin                                           424   6e-144   
emb|CAD26892.1|  alpha-tubulin                                          424   6e-144   
ref|XP_004221286.1|  tubulin alpha chain                                424   7e-144   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      416   7e-144   
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              424   7e-144   
ref|XP_001351526.1|  alpha-tubulin ii                                   424   8e-144   
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              424   8e-144   
ref|XP_008625823.1|  tubulin alpha chain                                424   8e-144   
ref|XP_001615123.1|  tubulin alpha chain                                424   8e-144   
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             416   8e-144   
gb|AAY78955.1|  alpha-tubulin II                                        424   9e-144   
ref|XP_003624633.1|  Alpha-tubulin                                      424   1e-143   
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             418   1e-143   
gb|AGG37288.1|  alpha-tubulin 6                                         424   1e-143   
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              424   1e-143   
ref|XP_008616225.1|  tubulin alpha chain                                423   1e-143   
emb|CDP14299.1|  unnamed protein product                                423   2e-143   
ref|XP_002779347.1|  Tubulin alpha chain, putative                      419   2e-143   
gb|ESL08706.1|  alpha tubulin                                           418   2e-143   
ref|XP_002767974.1|  Tubulin alpha chain, putative                      416   2e-143   
dbj|BAE01779.1|  unnamed protein product                                415   3e-143   
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 418   3e-143   
gb|EKG00415.1|  epsilon tubulin, putative                               420   3e-143   
gb|ABB16994.1|  unknown                                                 423   3e-143   
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             422   3e-143   
emb|CAA65329.1|  alpha-tubulin                                          422   3e-143   



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   456 bits (1174),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   455 bits (1171),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   454 bits (1167),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   454 bits (1169),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   458 bits (1179),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   456 bits (1174),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   456 bits (1172),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   455 bits (1171),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   455 bits (1171),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   457 bits (1175),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   457 bits (1175),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   457 bits (1175),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   457 bits (1175),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   457 bits (1175),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   456 bits (1174),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   456 bits (1174),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   456 bits (1174),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   456 bits (1174),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   455 bits (1170),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   455 bits (1170),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   455 bits (1171),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   456 bits (1172),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 235/240 (98%), Positives = 240/240 (100%), Gaps = 0/240 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  478
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  122

Query  479  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVS  658
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+S
Sbjct  123  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQIS  182

Query  659  TSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            TSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  183  TSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  242



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   455 bits (1171),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   455 bits (1171),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   455 bits (1171),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   455 bits (1171),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   454 bits (1169),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTY NLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYQNLNRLISQVISSL  238



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   455 bits (1170),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 237/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   455 bits (1170),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   455 bits (1170),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 237/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   455 bits (1170),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   455 bits (1170),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   455 bits (1170),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   455 bits (1170),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   454 bits (1169),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   454 bits (1169),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   454 bits (1169),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   454 bits (1169),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   454 bits (1169),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   454 bits (1169),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   454 bits (1169),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   454 bits (1169),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   454 bits (1169),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   448 bits (1153),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+S VISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSXVISSL  238



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   454 bits (1168),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   456 bits (1173),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/246 (96%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTF  280
            +  S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTF
Sbjct  43   AGQSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTF  102

Query  281  FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            FSETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  103  FSETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  162

Query  461  EIVDLCLDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIY  640
            EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+Y
Sbjct  163  EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY  222

Query  641  PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLIS  820
            PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+S
Sbjct  223  PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS  282

Query  821  QVISSL  838
            QVISSL
Sbjct  283  QVISSL  288



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   454 bits (1169),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   454 bits (1167),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   454 bits (1167),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   454 bits (1167),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGL SLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLASLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   454 bits (1167),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   452 bits (1163),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   453 bits (1165),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   454 bits (1167),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   453 bits (1166),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSL  238



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   453 bits (1166),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   453 bits (1166),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            +VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   452 bits (1163),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLGFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNL+RLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLSRLISQVISSL  238



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   453 bits (1165),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   453 bits (1165),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   452 bits (1164),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   452 bits (1164),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   453 bits (1165),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLSIERPTYTNLNRLVSQVISSL  238



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   452 bits (1164),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   452 bits (1164),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   453 bits (1165),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   453 bits (1165),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   451 bits (1160),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   452 bits (1164),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   452 bits (1163),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   452 bits (1164),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   452 bits (1164),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   452 bits (1164),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   452 bits (1164),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTY NLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYQNLNRLISQVISSL  238



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   452 bits (1164),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTY NLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYQNLNRLISQVISSL  238



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   452 bits (1164),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   452 bits (1164),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   452 bits (1163),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   452 bits (1163),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   451 bits (1160),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSL  238



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   452 bits (1163),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   452 bits (1163),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 236/238 (99%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLF PEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFRPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   452 bits (1163),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   452 bits (1163),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   452 bits (1163),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERP+YTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPSYTNLNRLVSQVISSL  238



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   452 bits (1162),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   452 bits (1162),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   452 bits (1162),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLSIERPTYTNLNRLVSQVISSL  238



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   452 bits (1163),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   452 bits (1162),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   452 bits (1162),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLSIERPTYTNLNRLVSQVISSL  238



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   452 bits (1162),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   451 bits (1161),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLSIERPTYTNLNRLVSQVISSL  238



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   451 bits (1161),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   451 bits (1161),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 235/238 (99%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQ+STS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQISTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   451 bits (1161),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYN VLS HSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNRVLSPHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   451 bits (1161),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   451 bits (1161),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009388503.1| PREDICTED: tubulin alpha chain isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   452 bits (1162),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/240 (98%), Positives = 238/240 (99%), Gaps = 0/240 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  478
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  155

Query  479  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVS  658
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVS
Sbjct  156  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVS  215

Query  659  TSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            T+VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSL
Sbjct  216  TAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSL  275



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   444 bits (1141),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD + GGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQ+ISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSL  238



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   451 bits (1159),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDIC+RSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   451 bits (1159),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYC+EHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+STS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDIC+RSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICKRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSL+EHT VAVLLDNEAIYDIC+RSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLVEHTTVAVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   451 bits (1160),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLSIERPTYTNLNRLVSQVISSL  238



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSL  238



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   450 bits (1158),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   450 bits (1158),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>ref|XP_008219157.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=442

 Score =   450 bits (1157),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002976230.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
 ref|XP_002987138.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ11714.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ22490.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
Length=451

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 238/238 (100%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAG+QVGNACWELYCLEHGIQPDGQMP+DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQVGNACWELYCLEHGIQPDGQMPTDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL+FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   446 bits (1148),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 231/236 (98%), Positives = 236/236 (100%), Gaps = 0/236 (0%)
 Frame = +2

Query  131  ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  310
            ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV
Sbjct  1    ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  60

Query  311  PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  490
            PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI
Sbjct  61   PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  120

Query  491  RKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVV  670
            RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVV
Sbjct  121  RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVV  180

Query  671  EPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            EPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  EPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  236



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   450 bits (1157),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   450 bits (1157),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLSIERPTYTNLNRLVSQVISSL  238



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   450 bits (1157),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLSIERPTYTNLNRLVSQVISSL  238



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   449 bits (1156),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_009357231.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   449 bits (1156),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   450 bits (1157),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   450 bits (1157),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_008352751.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=449

 Score =   449 bits (1156),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   449 bits (1156),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSL  238



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   449 bits (1156),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAF TFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFYTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   449 bits (1156),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSL  238



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   449 bits (1155),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 233/237 (98%), Positives = 235/237 (99%), Gaps = 0/237 (0%)
 Frame = +2

Query  128  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  307
            RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKH
Sbjct  1    RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKH  60

Query  308  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  487
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  120

Query  488  IRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSV  667
            IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSV
Sbjct  121  IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSV  180

Query  668  VEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNR ISQVISSL
Sbjct  181  VEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRFISQVISSL  237



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score =   449 bits (1155),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYD+CRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDLCRRSLDIERPTYTNLNRLISQVISSL  238



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   449 bits (1155),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   449 bits (1155),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA +LDNEAIYDICRRSLDIERPTYTNLNRL+SQ+ISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAAILDNEAIYDICRRSLDIERPTYTNLNRLVSQIISSL  238



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   449 bits (1154),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   449 bits (1154),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   449 bits (1154),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQP+GQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPEGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHY+IGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYSIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score =   447 bits (1151),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNRL+SQ+ISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVILDNEAIYDICRRSLDIERPTYTNLNRLVSQIISSL  238



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKE+AANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKENAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/238 (98%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLDFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            V EPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL
Sbjct  181  VDEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLAD+CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADSCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABF98643.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=433

 Score =   447 bits (1151),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DK VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKIVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYN VLS HSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNRVLSPHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>gb|AHJ80816.1| Tua1 [Eragrostis tef]
Length=451

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+S VISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSXVISSL  238



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGNYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   448 bits (1152),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 233/238 (98%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQ GIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQPGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   447 bits (1151),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVNLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLVSQVISSL  238



>ref|XP_008347837.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Malus domestica]
Length=459

 Score =   448 bits (1152),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 232/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   446 bits (1147),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 229/233 (98%), Positives = 233/233 (100%), Gaps = 0/233 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQ  823
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQ
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQ  233



>ref|XP_006338461.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Solanum tuberosum]
Length=434

 Score =   447 bits (1149),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSL  238



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   447 bits (1150),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNA WELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNARWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGG TGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGXTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   447 bits (1150),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERP YTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPAYTNLNRLVSQVISSL  238



>ref|XP_002962209.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
 ref|XP_002965123.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ33961.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ37469.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
Length=451

 Score =   447 bits (1150),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 227/238 (95%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002963092.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
 ref|XP_002980241.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ18501.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ36555.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
Length=451

 Score =   447 bits (1149),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 227/238 (95%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006431130.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 ref|XP_006482576.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Citrus sinensis]
 gb|ESR44370.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 gb|KDO72550.1| hypothetical protein CISIN_1g013066mg [Citrus sinensis]
Length=450

 Score =   447 bits (1149),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>emb|CAA62917.1| alfa-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   447 bits (1149),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPT+IDEVRTG YRQLFHPEQ+ISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTMIDEVRTGDYRQLFHPEQVISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTN NRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNRNRLVSQVISSL  238



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   447 bits (1149),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D T+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTLGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERP Y+NLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPNYSNLNRLVSQVISSL  238



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   447 bits (1149),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAV+LDNEA+YDICRRSLDIERPTYTNLNRLI+QVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAVYDICRRSLDIERPTYTNLNRLIAQVISSL  238



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   447 bits (1149),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGG DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGADAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPE LISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEHLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLEIERPTYTNLNRLVSQVISSL  238



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   446 bits (1148),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPS KTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSGKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   446 bits (1148),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 227/238 (95%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIH+GQAGIQ+GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAV+LDNEAIYDICRR LDIERPTYTNLNRLI+QVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRQLDIERPTYTNLNRLIAQVISSL  238



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   446 bits (1147),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQ GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDIERPTYTNLNRL+ QVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLVGQVISSL  238



>gb|AAB84298.1| tubulin [Oryza sativa Indica Group]
Length=451

 Score =   446 bits (1147),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQ FHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGLYRQFFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLEIERPTYTNLNRLVSQVISSL  238



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   446 bits (1147),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQ+ISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSL  238



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   446 bits (1147),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+V+LDNEA+YDICRRSLDIERPTYTNLNRLI+QVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVMLDNEAVYDICRRSLDIERPTYTNLNRLIAQVISSL  238



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   446 bits (1147),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQ+ISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSL  238



>ref|XP_002973792.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
 ref|XP_002983604.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ15505.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ24747.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
Length=451

 Score =   446 bits (1147),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 227/238 (95%), Positives = 237/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAV+LDNEAIYD+CRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDLCRRSLDIERPTYTNLNRLVSQVISSL  238



>gb|AAQ81585.1| putative tubulin alpha-2/alpha-4 chain [Brassica napus]
Length=450

 Score =   446 bits (1147),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            M ECISIH+GQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MGECISIHMGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV++LLDNEAIYDICRRSL+IERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLNIERPTYTNLNRLVSQVISSL  238



>ref|XP_004231960.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   446 bits (1146),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/238 (96%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTLGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRAGPYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   446 bits (1146),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/240 (97%), Positives = 237/240 (99%), Gaps = 2/240 (1%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG MPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQ--VISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQ  VISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQASVISSL  240



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   445 bits (1145),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSL  238



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   445 bits (1145),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAV VDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVSVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGK+SKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKESKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_006357741.1| PREDICTED: tubulin alpha-3 chain-like [Solanum tuberosum]
Length=451

 Score =   445 bits (1145),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 228/238 (96%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTLGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRAGPYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   445 bits (1145),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICR+SLDIERPTYTNLNRLISQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRKSLDIERPTYTNLNRLISQVISSL  238



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   445 bits (1145),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 228/238 (96%), Positives = 236/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDV+V+LDNEA+YDICRRSLDIERPTYTNLNRLI+QVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVMLDNEAVYDICRRSLDIERPTYTNLNRLIAQVISSL  238



>emb|CAA62916.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   445 bits (1145),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 235/238 (99%), Gaps = 0/238 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNT FSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTSFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQVISSL  838
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQVISSL
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSL  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752914777460