BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041D07

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB03784.1|  catalase                                                460   9e-158   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          456   2e-156   Ipomoea batatas [batate]
gb|AIX10947.1|  putative catalase                                       405   1e-136   Gardenia jasminoides
gb|AHF21552.1|  catalase                                                404   9e-136   Hylocereus undatus [dragon fruit]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 403   1e-135   Manihot esculenta [manioc]
gb|ABB51561.1|  truncated catalase 2                                    400   3e-135   Avicennia marina
gb|AGC65520.1|  catalase                                                401   9e-135   Eriobotrya japonica [loquat]
gb|AGE15298.2|  catalase 1                                              401   1e-134   Eriobotrya japonica [loquat]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          401   1e-134   Avicennia marina
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          401   1e-134   Amborella trichopoda
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 400   1e-134   Eucalyptus grandis [rose gum]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     397   2e-134   Eucalyptus grandis [rose gum]
gb|ACL27272.1|  catalase                                                400   3e-134   Nicotiana benthamiana
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      399   4e-134   Nicotiana sylvestris
emb|CCP37650.1|  catalase-1                                             399   4e-134   Nicotiana tabacum [American tobacco]
gb|AAB71764.1|  catalase 1                                              399   5e-134   Nicotiana tabacum [American tobacco]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      399   8e-134   Eucalyptus grandis [rose gum]
gb|AFU48609.1|  catalase 1                                              397   2e-133   Nicotiana benthamiana
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 397   3e-133   Vitis vinifera
dbj|BAC79443.1|  catalase                                               397   4e-133   Acacia ampliceps
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      397   4e-133   Solanum tuberosum [potatoes]
ref|NP_001268098.1|  catalase                                           397   5e-133   Vitis vinifera
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      395   5e-133   Nelumbo nucifera [Indian lotus]
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      397   5e-133   
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      396   6e-133   Nicotiana tomentosiformis
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                396   7e-133   Erythranthe guttata [common monkey flower]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      396   1e-132   Nelumbo nucifera [Indian lotus]
ref|NP_001237556.1|  catalase-1/2                                       395   2e-132   Glycine max [soybeans]
ref|NP_001291326.1|  catalase isozyme 1                                 395   2e-132   Sesamum indicum [beniseed]
ref|NP_001235974.1|  catalase-3                                         395   3e-132   Glycine max [soybeans]
gb|ACJ76836.3|  catalase                                                395   3e-132   Dimocarpus longan [longan]
gb|ABM47415.1|  catalase                                                394   6e-132   Prunus avium [gean]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 394   7e-132   Cucumis melo [Oriental melon]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             392   7e-132   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      394   8e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             392   9e-132   
gb|KJB17474.1|  hypothetical protein B456_003G002800                    392   9e-132   Gossypium raimondii
gb|KJB17473.1|  hypothetical protein B456_003G002800                    394   9e-132   Gossypium raimondii
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 392   1e-131   
ref|NP_001234186.1|  catalase isozyme 2                                 393   1e-131   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               393   1e-131   Ricinus communis
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              393   1e-131   Cicer arietinum [garbanzo]
gb|KHG12976.1|  Catalase isozyme 2                                      393   2e-131   Gossypium arboreum [tree cotton]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               393   2e-131   Gossypium hirsutum [American cotton]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             393   2e-131   Populus trichocarpa [western balsam poplar]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                393   2e-131   Erythranthe guttata [common monkey flower]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    392   2e-131   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 391   2e-131   
gb|AAR84577.1|  catalase 1b                                             391   2e-131   Lotus japonicus
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             392   2e-131   Phaseolus vulgaris [French bean]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          392   3e-131   Vigna radiata var. radiata [golden gram]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      392   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007046520.1|  Catalase 2                                         392   3e-131   Theobroma cacao [chocolate]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     392   3e-131   Eucalyptus grandis [rose gum]
gb|ADZ45555.1|  catalase                                                392   3e-131   Vigna radiata [mung bean]
ref|XP_007018034.1|  Catalase 2                                         392   4e-131   
gb|AAC19397.1|  leaf catalase                                           392   4e-131   Mesembryanthemum crystallinum
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          392   4e-131   Soldanella alpina
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      392   4e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADZ45556.1|  catalase                                                392   5e-131   Vigna radiata [mung bean]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           392   5e-131   
gb|ABV55108.1|  catalase 2                                              392   5e-131   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             392   5e-131   
gb|AAR84578.1|  catalase 1a                                             392   5e-131   Lotus japonicus
gb|KEH36313.1|  catalase heme-binding enzyme                            389   5e-131   Medicago truncatula
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           391   5e-131   Sesamum indicum [beniseed]
gb|ABF93811.1|  Catalase-1, putative, expressed                         387   6e-131   Oryza sativa Japonica Group [Japonica rice]
emb|CDP07287.1|  unnamed protein product                                391   6e-131   Coffea canephora [robusta coffee]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 391   8e-131   
gb|KJB14250.1|  hypothetical protein B456_002G115900                    391   1e-130   Gossypium raimondii
gb|ACJ71245.1|  catalase 2                                              387   1e-130   Vigna unguiculata
gb|AJE26131.1|  catalase                                                390   1e-130   Salix matsudana [tortured willow]
gb|ACJ71244.1|  catalase 2                                              387   1e-130   Vigna unguiculata
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              390   1e-130   Populus euphratica
ref|XP_002521709.1|  catalase, putative                                 390   1e-130   Ricinus communis
gb|AET97564.1|  catalase                                                390   1e-130   Ziziphus jujuba [Chinese jujube]
gb|ACJ22771.1|  catalase 1                                              390   1e-130   Jatropha curcas
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             387   1e-130   
ref|NP_001289779.1|  catalase isozyme 1                                 390   1e-130   Nelumbo nucifera [Indian lotus]
gb|AAD17933.1|  catalase                                                390   1e-130   Brassica juncea [brown mustard]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      390   2e-130   Nicotiana tomentosiformis
gb|AAF71742.1|AF248491_1  catalase                                      390   2e-130   Raphanus sativus
gb|AAD17935.1|  catalase                                                390   2e-130   Brassica juncea [brown mustard]
gb|AAC19398.1|  root catalase                                           390   2e-130   Mesembryanthemum crystallinum
gb|AFN81243.1|  catalase 1                                              390   2e-130   Brassica rapa subsp. pekinensis [bai cai]
gb|ACA50528.1|  putative catalase 2                                     390   2e-130   Brassica napus [oilseed rape]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      389   2e-130   Phoenix dactylifera
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 390   2e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437527.1|  PREDICTED: catalase-2                              390   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      390   2e-130   Nicotiana sylvestris
gb|AAO17721.1|  catalase                                                390   2e-130   Hypericum perforatum
gb|AAB62892.1|  catalase-1                                              390   2e-130   Nicotiana glutinosa
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         390   2e-130   Camelina sativa [gold-of-pleasure]
gb|AHF27430.1|  catalase                                                390   3e-130   Cucurbita moschata [ayote]
ref|XP_009138342.1|  PREDICTED: catalase-2                              390   3e-130   Brassica rapa
gb|KHG25152.1|  Catalase isozyme 1                                      389   3e-130   Gossypium arboreum [tree cotton]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         389   3e-130   Camelina sativa [gold-of-pleasure]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      389   3e-130   Fragaria vesca subsp. vesca
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       389   3e-130   Triticum aestivum [Canadian hard winter wheat]
gb|ADM96039.1|  catalase                                                389   3e-130   Cucumis sativus [cucumbers]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             389   4e-130   Prunus persica
ref|NP_001237571.1|  catalase-4                                         389   4e-130   Glycine max [soybeans]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      389   4e-130   Cucumis melo [Oriental melon]
ref|NP_001031791.1|  catalase 2                                         389   4e-130   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            389   4e-130   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                389   5e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64220.1|  catalase                                               389   5e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             389   5e-130   
gb|KEH36312.1|  catalase heme-binding enzyme                            389   5e-130   Medicago truncatula
ref|XP_002306976.2|  catalase family protein                            389   5e-130   
ref|XP_009149539.1|  PREDICTED: catalase-3                              390   5e-130   Brassica rapa
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               389   5e-130   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
dbj|BAH19523.1|  AT4G35090                                              388   5e-130   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240021.1|  catalase                                           389   6e-130   Glycine max [soybeans]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      389   6e-130   Solanum lycopersicum
ref|XP_001784759.1|  predicted protein                                  389   6e-130   
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         389   7e-130   Jatropha curcas
gb|ADC95629.1|  catalase                                                389   7e-130   Bruguiera gymnorhiza [Burma mangrove]
dbj|BAJ33995.1|  unnamed protein product                                389   7e-130   Eutrema halophilum
gb|KFK30147.1|  catalase                                                389   7e-130   Arabis alpina [alpine rockcress]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      389   8e-130   Prunus mume [ume]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             389   8e-130   Eutrema salsugineum [saltwater cress]
gb|ACJ11733.1|  catalase                                                389   8e-130   Gossypium hirsutum [American cotton]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       389   8e-130   Cucumis sativus [cucumbers]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      389   9e-130   Vitis vinifera
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      389   9e-130   
gb|AAD17936.1|  catalase                                                388   9e-130   Brassica juncea [brown mustard]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      388   9e-130   Cucumis melo [Oriental melon]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             389   9e-130   Eutrema salsugineum [saltwater cress]
gb|AAF61734.1|AF243519_1  catalase 4                                    388   1e-129   Helianthus annuus
gb|AIZ77475.1|  catalase                                                388   1e-129   Triticum aestivum [Canadian hard winter wheat]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               388   1e-129   Cucurbita pepo
ref|XP_010692546.1|  PREDICTED: catalase                                388   1e-129   Beta vulgaris subsp. vulgaris [field beet]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               388   1e-129   Ricinus communis
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              389   1e-129   Brassica rapa
gb|AIA61608.1|  catalase                                                388   1e-129   Gynostemma pentaphyllum [jiaogulan]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      388   1e-129   Elaeis guineensis
ref|NP_973873.1|  catalase 3                                            386   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          388   1e-129   Amborella trichopoda
gb|AAD30291.2|AF139538_1  catalase 2                                    388   1e-129   Raphanus sativus
ref|XP_002301920.1|  catalase family protein                            388   1e-129   Populus trichocarpa [western balsam poplar]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    388   1e-129   Gossypium raimondii
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 388   1e-129   Solanum tuberosum [potatoes]
emb|CAD42908.1|  catalase                                               388   1e-129   Prunus persica
gb|AAG61140.2|AF332973_1  catalase 2                                    388   1e-129   Zantedeschia aethiopica [arum-lily]
gb|AHB72694.1|  catalase                                                388   1e-129   Beta vulgaris subsp. maritima [sea beet]
emb|CAI43948.1|  catalase                                               388   1e-129   Populus deltoides
gb|ABY21704.1|  catalase-1 precursor                                    388   2e-129   Panax ginseng [Asiatic ginseng]
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              387   2e-129   
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         388   2e-129   Tarenaya hassleriana [spider flower]
dbj|BAH37035.1|  catalase 1                                             387   2e-129   Pisum sativum [garden pea]
tpg|DAA43177.1|  TPA: catalase2                                         387   2e-129   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      387   2e-129   Phoenix dactylifera
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              387   2e-129   
ref|XP_010530333.1|  PREDICTED: catalase-2                              387   2e-129   Tarenaya hassleriana [spider flower]
emb|CDY29519.1|  BnaA06g14510D                                          387   2e-129   Brassica napus [oilseed rape]
gb|AAD30292.1|AF139539_1  catalase 3                                    387   2e-129   Raphanus sativus
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             387   2e-129   Capsella rubella
ref|XP_009110221.1|  PREDICTED: catalase-3                              387   2e-129   Brassica rapa
gb|AHF27433.1|  catalase                                                387   2e-129   Cucurbita maxima [Boston marrow]
gb|AFU90823.1|  catalase                                                385   3e-129   Populus x beijingensis
gb|ABK24453.1|  unknown                                                 387   3e-129   Picea sitchensis
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         387   3e-129   Brassica rapa
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               387   3e-129   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDY33636.1|  BnaC08g19360D                                          387   3e-129   Brassica napus [oilseed rape]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 387   3e-129   Populus euphratica
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             387   3e-129   Capsella rubella
emb|CDY31878.1|  BnaC07g15280D                                          387   3e-129   Brassica napus [oilseed rape]
gb|AAM65021.1|  unknown                                                 387   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 387   3e-129   Prunus mume [ume]
ref|NP_564120.1|  catalase 3                                            387   3e-129   Arabidopsis thaliana [mouse-ear cress]
gb|AAX88799.1|  catalase                                                387   3e-129   Euphorbia characias
gb|AAF19965.1|AF207906_1  catalase 1                                    387   3e-129   Zantedeschia aethiopica [arum-lily]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             387   3e-129   Prunus persica
ref|NP_001031073.1|  catalase 3                                         387   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      387   4e-129   Populus euphratica
gb|ACB11496.1|  catalase                                                387   4e-129   Pinus sylvestris [Scotch pine]
emb|CAD42909.1|  catalase                                               387   4e-129   Prunus persica
gb|ACV92695.1|  catalase                                                387   4e-129   Brassica oleracea
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               387   4e-129   Cucurbita pepo
dbj|BAA34714.1|  catalase                                               387   4e-129   Oryza sativa [red rice]
gb|AFD29285.1|  catalase                                                387   5e-129   Vicia faba [broad bean]
ref|NP_001048861.1|  Os03g0131200                                       387   5e-129   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    387   5e-129   Arabis alpina [alpine rockcress]
dbj|BAH56915.1|  AT1G20620                                              386   6e-129   Arabidopsis thaliana [mouse-ear cress]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               386   6e-129   Gossypium hirsutum [American cotton]
gb|AEQ30070.1|  catalase                                                386   7e-129   Litchi chinensis [litchi]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         386   7e-129   Tarenaya hassleriana [spider flower]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         386   7e-129   Oryza brachyantha
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      386   7e-129   Elaeis guineensis
gb|ACH63223.1|  catalase                                                386   7e-129   Rheum australe [Himalayan rhubarb]
prf||1906388A  catalase                                                 386   7e-129
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             384   8e-129   
emb|CDY01364.1|  BnaA07g11370D                                          388   9e-129   
tpg|DAA43178.1|  TPA: catalase2                                         387   9e-129   
dbj|BAJ90861.1|  predicted protein                                      386   9e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFU90822.1|  catalase                                                385   9e-129   Populus tomentosa [Chinese white poplar]
ref|XP_010061175.1|  PREDICTED: catalase-like                           386   9e-129   Eucalyptus grandis [rose gum]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              386   9e-129   
gb|AAB86582.2|  catalase                                                385   1e-128   Raphanus sativus
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 385   1e-128   Tarenaya hassleriana [spider flower]
gb|AAF61733.1|AF243518_1  catalase 3                                    385   1e-128   Helianthus annuus
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             385   1e-128   
ref|XP_009106100.1|  PREDICTED: catalase-2                              385   1e-128   Brassica rapa
gb|AGV54297.1|  peroxisomal catalase                                    385   1e-128   Phaseolus vulgaris [French bean]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      385   1e-128   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 385   1e-128   Phoenix dactylifera
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      385   1e-128   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69543.1|  catalase                                                385   1e-128   Genlisea aurea
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             385   2e-128   Selaginella moellendorffii
emb|CAG23920.1|  catalase                                               385   2e-128   Festuca arundinacea [tall fescue]
ref|XP_003558892.1|  PREDICTED: catalase-1                              385   2e-128   Brachypodium distachyon [annual false brome]
gb|ACL35349.1|  catalase                                                385   2e-128   Picea glauca
gb|AFR53082.1|  CAT                                                     385   2e-128   Anthurium andraeanum [flamingo-lily]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             385   2e-128   Phaseolus vulgaris [French bean]
ref|XP_001752315.1|  predicted protein                                  385   2e-128   
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 385   3e-128   Phoenix dactylifera
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             384   3e-128   Citrus clementina [clementine]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      384   3e-128   
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     387   4e-128   Eucalyptus grandis [rose gum]
emb|CAA45564.1|  catalase                                               384   5e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094556.1|  Catalase isozyme 1                                 384   6e-128   Morus notabilis
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      384   6e-128   Phoenix dactylifera
emb|CDY01363.1|  BnaA07g11360D                                          384   7e-128   
ref|XP_009103333.1|  PREDICTED: catalase-1                              384   7e-128   Brassica rapa
emb|CAE82295.1|  catalase                                               384   7e-128   Homogyne alpina
gb|AAM97541.1|  catalase 2                                              383   8e-128   Capsicum annuum
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      383   9e-128   Citrus sinensis [apfelsine]
dbj|BAA34205.1|  catalase                                               383   9e-128   Oryza sativa Japonica Group [Japonica rice]
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            383   1e-127   Pisum sativum [garden pea]
emb|CDY31877.1|  BnaC07g15270D                                          383   1e-127   Brassica napus [oilseed rape]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             383   1e-127   Citrus clementina [clementine]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    383   1e-127   Arabis alpina [alpine rockcress]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         383   1e-127   Setaria italica
emb|CDX72514.1|  BnaC07g45360D                                          382   1e-127   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             383   1e-127   Eutrema salsugineum [saltwater cress]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              383   2e-127   Populus euphratica
ref|XP_010498496.1|  PREDICTED: catalase-3                              382   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      382   2e-127   
emb|CDP01803.1|  unnamed protein product                                382   2e-127   Coffea canephora [robusta coffee]
gb|AAM97542.1|  catalase 3                                              382   2e-127   Capsicum annuum
gb|AAK67359.2|AF390210_1  catalase                                      381   5e-127   Suaeda salsa
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         381   5e-127   Tarenaya hassleriana [spider flower]
gb|ADU56198.1|  catalase                                                381   7e-127   Musa acuminata AAA Group [Cavendish banana]
gb|AIS20825.1|  CAT                                                     381   8e-127   Pyrus x bretschneideri [bai li]
gb|AAC49807.1|  catalase 3                                              380   9e-127   Arabidopsis thaliana [mouse-ear cress]
gb|ADU56199.1|  catalase                                                380   1e-126   Hevea brasiliensis [jebe]
emb|CDX69111.1|  BnaC01g03420D                                          380   1e-126   
gb|ACL81498.1|  catalase                                                380   1e-126   Ginkgo biloba [ginkgo]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 380   1e-126   Elaeis guineensis
emb|CDY31488.1|  BnaC05g15970D                                          380   2e-126   Brassica napus [oilseed rape]
gb|AGT16310.1|  catalase                                                379   3e-126   Saccharum hybrid cultivar R570
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          379   3e-126   Helianthus annuus
gb|AHA50082.1|  catalase                                                379   4e-126   Eleutherococcus senticosus
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               379   4e-126   Cucurbita pepo
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               379   4e-126   Zea mays [maize]
gb|AIP93616.1|  CAT1                                                    379   4e-126   Bassia scoparia [burning bush]
prf||1803522A  catalase                                                 379   5e-126
ref|XP_010692544.1|  PREDICTED: catalase-like                           379   5e-126   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF61732.1|AF243517_1  catalase 2                                    379   6e-126   Helianthus annuus
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      379   7e-126   Brachypodium distachyon [annual false brome]
gb|AIU99487.1|  catalase                                                378   1e-125   Saccharum hybrid cultivar ROC22
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               378   1e-125   Zea mays [maize]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               378   1e-125   Solanum tuberosum [potatoes]
prf||2104177A  catalase                                                 377   1e-125
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      378   2e-125   Brachypodium distachyon [annual false brome]
ref|NP_001274863.1|  catalase isozyme 1                                 377   2e-125   Solanum tuberosum [potatoes]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          377   2e-125   
gb|AGI65617.1|  catalase                                                376   2e-125   Fragaria x ananassa
ref|NP_001058635.1|  Os06g0727200                                       377   2e-125   
dbj|BAJ88747.1|  predicted protein                                      379   2e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU99480.1|  catalase                                                377   2e-125   Saccharum spontaneum [fodder cane]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    377   2e-125   Oryza sativa Indica Group [Indian rice]
gb|ADQ28492.1|  catalase                                                377   2e-125   Aeluropus littoralis
ref|NP_001234827.1|  catalase isozyme 1                                 377   3e-125   Solanum lycopersicum
ref|XP_002510677.1|  catalase, putative                                 391   3e-125   
gb|AIU99488.1|  catalase                                                377   3e-125   Saccharum hybrid cultivar ROC22
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    377   3e-125   Oryza brachyantha
gb|AAC17731.1|  catalase 1                                              377   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            377   3e-125   
gb|AFW66787.1|  catalase3                                               377   3e-125   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    377   3e-125   
emb|CDP07288.1|  unnamed protein product                                377   4e-125   
ref|NP_001241808.1|  catalase isozyme B                                 376   4e-125   
gb|AIU99481.1|  catalase                                                376   5e-125   
emb|CDX76313.1|  BnaA08g10870D                                          376   5e-125   
gb|ABC01913.1|  catalase isozyme 1-like protein                         376   5e-125   
emb|CDY17510.1|  BnaC03g65530D                                          375   6e-125   
gb|AIM43584.1|  catalase                                                376   6e-125   
gb|AFW66788.1|  catalase3                                               376   6e-125   
ref|NP_001105310.1|  catalase isozyme 2                                 376   7e-125   
gb|AIU99486.1|  catalase                                                376   7e-125   
gb|AAR97905.1|  catalase                                                376   7e-125   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               376   7e-125   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      376   8e-125   
gb|AIU99479.1|  catalase                                                375   1e-124   
ref|NP_001105415.1|  catalase isozyme 1                                 375   1e-124   
ref|XP_005645077.1|  catalase                                           375   1e-124   
emb|CAA85470.1|  catalase                                               375   1e-124   
emb|CDY29518.1|  BnaA06g14520D                                          375   1e-124   
emb|CDY52649.1|  BnaAnng11640D                                          374   2e-124   
emb|CAA42720.1|  catalase-1                                             375   2e-124   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 389   2e-124   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     375   2e-124   
gb|AAB07026.1|  catalase 1                                              375   2e-124   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         375   2e-124   
gb|AHZ13843.1|  catalase                                                375   2e-124   
gb|AAY59707.1|  catalase                                                374   2e-124   
gb|AAG43363.1|AF151368_1  catalase                                      374   3e-124   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 374   3e-124   
ref|XP_009149540.1|  PREDICTED: catalase-1                              374   4e-124   
ref|NP_001045673.1|  Os02g0115700                                       374   5e-124   
gb|ABN71233.2|  catalase                                                374   5e-124   
dbj|BAA34204.1|  catalase                                               374   6e-124   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           374   6e-124
emb|CDY31490.1|  BnaC05g15990D                                          373   7e-124   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             373   7e-124   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               373   7e-124   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      373   1e-123   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          373   1e-123
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          373   1e-123   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      373   1e-123   
gb|ABB72796.1|  catalase isozyme 1-like protein                         372   2e-123   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      372   2e-123   
gb|AII23739.1|  catalase                                                372   2e-123   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      372   2e-123   
gb|AIU99484.1|  catalase                                                372   2e-123   
dbj|BAA05494.1|  catalase                                               372   3e-123   
gb|AFW66785.1|  catalase3 isoform 1                                     379   3e-123   
emb|CDY40645.1|  BnaA03g53180D                                          371   3e-123   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               372   3e-123   
gb|ADY02963.1|  catalase                                                372   3e-123   
dbj|BAJ92414.1|  predicted protein                                      372   4e-123   
gb|AIU99482.1|  catalase                                                372   4e-123   
ref|XP_010477308.1|  PREDICTED: catalase-1                              372   4e-123   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         371   4e-123   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 373   4e-123   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 371   4e-123   
gb|AIU99485.1|  catalase                                                371   4e-123   
gb|AGT16188.1|  catalase                                                371   5e-123   
gb|AGT16054.1|  catalase                                                371   5e-123   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    371   5e-123   
gb|AGT16203.1|  catalase                                                371   6e-123   
gb|AIU99483.1|  catalase                                                371   6e-123   
emb|CAA43814.1|  catalase                                               371   6e-123   
gb|AAB70006.1|  catalase                                                371   7e-123   
ref|XP_001696763.1|  catalase/peroxidase                                370   8e-123   
dbj|BAF91369.1|  catalase                                               370   2e-122   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 370   2e-122   
gb|AGT15888.1|  catalase                                                369   3e-122   
gb|AAC48918.1|  salicylic acid binding catalase                         369   4e-122   
gb|EMT05040.1|  Catalase-1                                              370   6e-122   
emb|CAH61266.1|  catalase                                               369   6e-122   
gb|ABK24543.1|  unknown                                                 368   9e-122   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               368   1e-121   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 367   1e-121   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               367   2e-121   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                367   2e-121   
ref|XP_001779509.1|  predicted protein                                  367   2e-121   
gb|AJF34884.1|  catalase                                                367   3e-121   
gb|AAP80622.1|AF475100_1  catalase isozyme                              358   4e-121   
gb|EMS51034.1|  Catalase isozyme 2                                      367   4e-121   
emb|CAA73663.1|  catalase                                               366   5e-121   
gb|ABK24449.1|  unknown                                                 366   5e-121   
gb|AAR14052.2|  catalase                                                365   6e-121   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          365   1e-120   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   368   1e-120   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         365   1e-120   
gb|AAF79625.1|AC027665_26  F5M15.5                                      379   2e-120   
ref|XP_002950455.1|  catalase                                           364   4e-120   
gb|EMS61345.1|  Catalase isozyme 1                                      367   5e-120   
gb|ADN94253.1|  catalase                                                363   8e-120   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             362   1e-119   
ref|XP_002890395.1|  F5M15.5                                            375   3e-119   
ref|NP_001105416.1|  catalase isozyme 3                                 360   1e-118   
gb|EMT06167.1|  Catalase isozyme 2                                      364   5e-118   
gb|KDD77132.1|  catalase                                                358   6e-118   
dbj|BAQ21275.1|  catalase                                               357   9e-118   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        357   1e-117   
gb|ABB88582.1|  catalase                                                355   7e-117   
gb|ABK41476.1|  catalase                                                355   9e-117   
ref|XP_011396830.1|  Catalase isozyme 2                                 352   2e-115   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          343   6e-112   
gb|ADR01107.1|  catalase 3                                              335   2e-110   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          338   2e-110   
gb|AHG98056.1|  catalase                                                332   2e-110   
gb|AHF27432.1|  catalase                                                338   2e-110   
dbj|BAH20307.1|  AT1G20620                                              336   1e-109   
gb|AHF27429.1|  catalase                                                336   1e-109   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       334   1e-109   
gb|AAC84138.1|  catalase                                                323   8e-109   
ref|XP_011022275.1|  PREDICTED: catalase-like                           327   4e-106   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              326   1e-105   
ref|XP_005708279.1|  catalase                                           326   2e-105   
ref|XP_005536240.1|  catalase                                           318   4e-102   
gb|AAL38024.1|AF443179_1  catalase                                      307   1e-101   
gb|AIR77003.1|  catalase                                                308   3e-101   
gb|ABR16304.1|  unknown                                                 313   1e-100   
gb|ACJ71242.1|  catalase 1                                              299   2e-98    
gb|ADI58890.1|  catalase                                                295   8e-98    
gb|AAD37788.1|AF149283_1  catalase 1                                    298   1e-95    
gb|AII80275.1|  catalase                                                293   9e-95    
gb|ACY30463.1|  catalase                                                293   2e-94    
gb|AEG89525.1|  catalase                                                287   5e-92    
gb|AEA86312.1|  catalase isozyme                                        278   5e-91    
ref|XP_005642928.1|  catalase                                           285   2e-89    
emb|CBI29557.3|  unnamed protein product                                274   2e-89    
emb|CAB16750.1|  catalase                                               278   2e-89    
gb|ACJ71243.1|  catalase 2                                              274   1e-88    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    279   7e-88    
gb|AFC01205.1|  catalase                                                273   1e-87    
gb|AEQ94083.1|  putative catalase                                       274   1e-87    
emb|CAB56850.1|  catalase                                               278   2e-87    
ref|XP_005647994.1|  catalase-domain-containing protein                 280   2e-87    
gb|KHG11966.1|  Catalase isozyme 2                                      273   6e-87    
ref|XP_005644653.1|  catalase-domain-containing protein                 280   7e-87    
emb|CAC37634.1|  catalase 1                                             271   1e-86    
gb|AAN78323.1|  catalase1                                               267   2e-86    
gb|ABY74514.1|  catalase                                                267   4e-86    
ref|XP_005712277.1|  unnamed protein product                            275   2e-85    
gb|AAO12509.1|  catalase                                                263   7e-85    
ref|WP_028402967.1|  catalase                                           272   2e-84    
emb|CAP74531.1|  putative Td650 protein                                 263   7e-84    
emb|CDP01802.1|  unnamed protein product                                268   3e-83    
gb|EJF09706.1|  catalase                                                267   2e-82    
ref|WP_040574212.1|  catalase                                           268   2e-82    
emb|CDW92180.1|  putative catalase                                      260   2e-82    
emb|CDW92181.1|  putative catalase                                      258   7e-82    
ref|WP_035405433.1|  catalase                                           265   7e-82    
dbj|GAE06714.1|  catalase                                               258   9e-82    
ref|WP_011983963.1|  catalase                                           264   3e-81    
ref|WP_024632816.1|  MULTISPECIES: catalase                             261   3e-80    
ref|WP_018669668.1|  catalase                                           261   3e-80    
ref|WP_001069151.1|  catalase                                           261   3e-80    
ref|WP_017674668.1|  catalase                                           261   4e-80    
ref|WP_026975362.1|  catalase                                           261   4e-80    
ref|WP_043068684.1|  catalase                                           260   4e-80    
ref|WP_001069182.1|  MULTISPECIES: catalase                             260   6e-80    
ref|WP_036667842.1|  catalase                                           260   6e-80    
ref|WP_036640075.1|  catalase                                           260   7e-80    
ref|WP_006207005.1|  catalase                                           260   8e-80    
ref|WP_036612802.1|  catalase                                           259   1e-79    
ref|WP_034700019.1|  catalase                                           260   1e-79    
ref|WP_035435964.1|  catalase                                           259   2e-79    
ref|WP_043936623.1|  MULTISPECIES: catalase                             259   2e-79    
ref|WP_017691823.1|  catalase                                           259   2e-79    
gb|AAS40190.1|  catalase                                                258   2e-79    
ref|WP_026798903.1|  catalase                                           259   2e-79    
ref|WP_001069183.1|  catalase                                           259   2e-79    
ref|WP_001069184.1|  MULTISPECIES: catalase                             259   2e-79    
ref|WP_001069181.1|  MULTISPECIES: catalase                             259   2e-79    
ref|WP_016103618.1|  catalase                                           259   2e-79    
ref|WP_038413367.1|  catalase                                           259   2e-79    
ref|WP_044741157.1|  catalase                                           259   2e-79    
ref|WP_001069180.1|  MULTISPECIES: catalase                             258   3e-79    
ref|WP_002162341.1|  catalase                                           258   3e-79    
ref|WP_016122096.1|  catalase                                           258   3e-79    
ref|WP_002130360.1|  catalase                                           258   3e-79    
ref|WP_023521416.1|  catalase                                           258   3e-79    
ref|WP_001069185.1|  catalase                                           258   3e-79    
ref|WP_043072359.1|  catalase                                           258   3e-79    
ref|WP_001069176.1|  MULTISPECIES: catalase                             258   3e-79    
ref|WP_042982436.1|  catalase                                           258   3e-79    
ref|WP_001069177.1|  MULTISPECIES: catalase                             258   3e-79    
ref|WP_001069179.1|  MULTISPECIES: catalase                             258   3e-79    
ref|WP_017673056.1|  catalase                                           258   3e-79    
ref|WP_026590478.1|  catalase                                           258   3e-79    
ref|WP_016088914.1|  catalase                                           258   3e-79    
ref|WP_033673856.1|  catalase                                           258   3e-79    
ref|WP_001069190.1|  catalase                                           258   3e-79    
ref|WP_002125906.1|  MULTISPECIES: catalase                             258   4e-79    
ref|WP_001069175.1|  catalase                                           258   4e-79    
ref|WP_001069189.1|  catalase                                           258   4e-79    
ref|WP_002202803.1|  catalase                                           258   4e-79    
ref|WP_002011249.1|  catalase                                           258   4e-79    
ref|WP_002201400.1|  catalase                                           258   4e-79    
ref|WP_002194469.1|  catalase                                           258   4e-79    
ref|WP_001069178.1|  catalase                                           258   4e-79    
ref|WP_002170801.1|  MULTISPECIES: catalase                             258   4e-79    
ref|WP_044306649.1|  catalase                                           258   4e-79    
ref|WP_001069174.1|  catalase                                           258   4e-79    
ref|WP_002149880.1|  catalase                                           258   4e-79    
ref|WP_002030287.1|  MULTISPECIES: catalase                             258   4e-79    
ref|WP_015737807.1|  catalase                                           258   4e-79    
ref|WP_016101561.1|  catalase                                           258   4e-79    
ref|WP_001069168.1|  catalase                                           258   4e-79    
ref|WP_000184219.1|  catalase                                           258   4e-79    
ref|WP_001069173.1|  catalase                                           258   4e-79    
ref|WP_002087018.1|  catalase                                           258   4e-79    
ref|WP_016104158.1|  catalase                                           258   4e-79    
ref|WP_002134937.1|  catalase                                           258   4e-79    
ref|WP_001069172.1|  catalase                                           258   5e-79    
ref|WP_044437756.1|  catalase                                           258   5e-79    
ref|WP_002188737.1|  catalase                                           258   5e-79    
ref|WP_001069169.1|  MULTISPECIES: catalase                             258   5e-79    
ref|WP_000184218.1|  catalase                                           258   5e-79    
ref|WP_001069170.1|  catalase                                           258   5e-79    
ref|WP_016093086.1|  catalase                                           258   5e-79    
ref|WP_016113754.1|  catalase                                           258   5e-79    
ref|WP_002158904.1|  catalase                                           258   5e-79    



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   460 bits (1183),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 217/225 (96%), Positives = 220/225 (98%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDPSKYRPSSSFNTPFC TN GAPVWNN CALTVGSRGPILLEDYHL+EKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVKMYTREGN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTREGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINK+GK NYVKFH
Sbjct  181  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKEGKANYVKFH  225



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   456 bits (1174),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 216/225 (96%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDPSKYRPSSSFNTPFC TN GAPVWNN CALTVGSRGPILLEDYHLVEKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVKMYTR GN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINK+GK NYVKFH
Sbjct  181  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKEGKANYVKFH  225



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   405 bits (1042),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/225 (83%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FNTPF  TN G PVWNN  ALTVG+RGPILLEDYHLVEK+ N+TRERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPD IHA KPNPKSHIQE+WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVRDAMKFPDSIHALKPNPKSHIQESWRILDFFSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWFYDDVGIP DYRHMEGFG+H +T+INK GK +YVKFH
Sbjct  181  ESLSTFAWFYDDVGIPQDYRHMEGFGIHAYTLINKAGKAHYVKFH  225



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   404 bits (1037),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFNT F  TN GAPVWNN  A+T+G RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ER+VHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLNTF W +DDVGIP DYRHMEGFGV+TF+ IN+DGKV+YVKFH
Sbjct  181  ESLNTFGWLFDDVGIPQDYRHMEGFGVNTFSFINRDGKVHYVKFH  225



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSS NTPF  T+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WRI D+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRIFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP DYRHMEGFGVHTFT INK GKV YVKFH
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHTFTFINKAGKVTYVKFH  225



>gb|ABB51561.1| truncated catalase 2 [Avicennia marina]
Length=424

 Score =   400 bits (1027),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KY PSSSFNTP   TNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL TFAWFYDDVGIP DYRHMEGFGVH++T+INK GKVNYVKFH
Sbjct  181  ESLLTFAWFYDDVGIPQDYRHMEGFGVHSYTLINKAGKVNYVKFH  225



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   401 bits (1030),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL TFA+ +DDVG+P DYRHMEGFGVH++T+I+K GKV+YVKFH
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHSYTLISKAGKVHYVKFH  225



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL TFA+ +DDVG+P DYRHMEGFGVH++T+I+K GKV+YVKFH
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHSYTLISKAGKVHYVKFH  225



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KY PSSSFNTP   TNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL TFAWFYDDVGIP DYRHMEGFGVH++T+INK GKVNYVKFH
Sbjct  181  ESLLTFAWFYDDVGIPQDYRHMEGFGVHSYTLINKAGKVNYVKFH  225



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FTRER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ER+VHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQENWRILD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDPMKFPDVIHAFKPNPKSHIQENWRILDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWFYDDVGIPTDYRHMEGFGV  +T++NK GK    KFH
Sbjct  181  ESLSTFAWFYDDVGIPTDYRHMEGFGVSAYTLLNKAGKATLAKFH  225



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   400 bits (1029),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F  TN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD IHAFKPNPKS+IQE WRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFFSHQP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFH
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKTGKTNYVKFH  225



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F  TN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFH
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFH  225



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFC TN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  225



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   399 bits (1026),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFC TN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  225



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   399 bits (1026),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFC TN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  225



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   399 bits (1026),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFC TN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  225



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   399 bits (1024),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F  TN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFH
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFH  225



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   397 bits (1021),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 205/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  85   DPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPE  264
            DP KYRPSS+FN+PFC TN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  265  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  444
            RVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  445  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  624
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPE  180

Query  625  SLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            SL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  SLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  224



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+P+  TN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+ +DDVG+P DYRHMEGFGVHTFT+INK GK NYVKFH
Sbjct  181  ESLSTFAFLFDDVGVPQDYRHMEGFGVHTFTLINKAGKANYVKFH  225



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   397 bits (1019),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FNTPF  TN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFTRER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ S+LP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSYLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+P DYRHMEG  V+T+T+INK GKV+YVKFH
Sbjct  181  ESLHTFMFLFDDVGVPQDYRHMEGSSVNTYTLINKAGKVHYVKFH  225



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   397 bits (1019),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFC TN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+IN+ GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINRAGKSTYVKFH  225



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   397 bits (1019),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+P+  TN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+ +DDVGIP DYRHMEGFGVHTFT++NK GK NYVKFH
Sbjct  181  ESLSTFAFLFDDVGIPQDYRHMEGFGVHTFTLLNKAGKANYVKFH  225



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLINKTGKAHYVKFH  225



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   397 bits (1019),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F  TN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP DYRHMEGFGVH FT INK GK NYVKFH
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFH  225



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   396 bits (1018),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+ FC TN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  225



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   396 bits (1018),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DDVG+P DYRHM+G GV+T+T+INK GKVNYVKFH
Sbjct  181  ESLNMFTFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKVNYVKFH  225



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLINKTGKAHYVKFH  225



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF  TN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLINKAGKALYVKFH  225



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF  TN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLINKAGKAVYVKFH  225



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K  PSS+FN PF  TN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F RER P
Sbjct  1    MDPYKPIPSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARERTP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSHIQE+WRILD+ +H+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHIQESWRILDFCAHIP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF WFYDDVGIP DYRHMEGFGV T+T+INK GKV+YVKFH
Sbjct  181  ESLSTFTWFYDDVGIPQDYRHMEGFGVQTYTLINKAGKVHYVKFH  225



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   394 bits (1012),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F+TPF  TN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQENWRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQENWRILDFFSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+FYDD+GIP DYRHMEG  VH +T+I+K GKV+YVKFH
Sbjct  181  ESLHTFAFFYDDLGIPQDYRHMEGSSVHAYTLISKAGKVHYVKFH  225



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   394 bits (1011),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS++NTPF  TN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+ +INK+GKV+YVKFH
Sbjct  181  ESLHMFTFLFDDLGIPQDYRHMDGSGVNTYNLINKEGKVHYVKFH  225



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   392 bits (1006),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFH  225



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   394 bits (1011),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F  TN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T +NK+GKVNYVKFH
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFVNKEGKVNYVKFH  225



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFH  225



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKAHYVKFH  225



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   394 bits (1011),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKAHYVKFH  225



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL TFA+ +DDVG+P DYRHMEGFGVH +T+I+K GKV+YVKFH
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHAYTLISKAGKVHYVKFH  225



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFC TN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+IN+ GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINRAGKSTYVKFH  225



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   393 bits (1009),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS FNTPF  TN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSH+QENWRI D+LSH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWRIFDFLSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+   +  DD+GIP DYRHMEG GV+T+T+INK GKV+YVKFH
Sbjct  181  ESLHMLTFLLDDLGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFH  225



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   393 bits (1009),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKALYVKFH  225



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFH  225



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF++PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GVHT+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFH  225



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFH  225



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR PGVQTP+IVRFSTVIHERGSPE+IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GKVNYVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKVNYVKFH  225



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FNT F  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHMEG GV+T+T+INK GKV+YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFH  225



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL TFA+ +DDVG+P DYRHMEGFGVH +T+I+K GKV+YVKFH
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHAYTLISKAGKVHYVKFH  225



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+P DYRHM+GFGV+T+T+INK GKV YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKVVYVKFH  225



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPS++FN+PF  TN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHM+GFGV+T+T+I+K GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLISKAGKPHYVKFH  225



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFH  225



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F  TN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T INK+GKVNYVKFH
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFINKEGKVNYVKFH  225



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+P DYRHM+G GVHT+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGSGVHTYTLINKAGKAQYVKFH  225



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   392 bits (1006),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FNT F  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHMEG GV+T+T+INK GKV+YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFH  225



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFH  225



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   392 bits (1007),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFH  225



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   392 bits (1007),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+P+  TN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+PTDYRHMEG GV+T+T+I+K GKV+YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPTDYRHMEGSGVNTYTLISKSGKVHYVKFH  225



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYR SS+FNTPF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFH  225



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F  TN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T INK+GKVNYVKFH
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFINKEGKVNYVKFH  225



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFH  225



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPS +FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T F  TN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T ++K+GKVNYVKFH
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFVSKEGKVNYVKFH  225



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   392 bits (1008),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFH  225



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+P DYRHM+GFGV+T+T+INK GKV YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKVVYVKFH  225



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   389 bits (1000),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+++INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYSLINKAGKAVYVKFH  225



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   391 bits (1005),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPS +FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   387 bits (995),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFH  225



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   391 bits (1005),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVGIP DYRHMEGFGV+T+T+I+K GK +YVKFH
Sbjct  181  ESLHMFTFLFDDVGIPQDYRHMEGFGVNTYTLIDKAGKASYVKFH  225



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   391 bits (1005),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFC TN GAPVWNN   ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFH
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFH  225



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD G+P DYRHM+GFGV+T++++NK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDWGVPQDYRHMDGFGVNTYSLVNKAGKAVYVKFH  225



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F+TP+  TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD G+P DYRHM+GFGV+T++++NK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDWGVPQDYRHMDGFGVNTYSLVNKAGKAVYVKFH  225



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFH  225



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTH+I+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVNTYTLINKAGKARYVKFH  225



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+P+  TN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+ PSS+ NTPF  TN GAPVWNN  ++TVG RGPILLEDYH++EK+ NF RERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTH+I++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHEISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WRI D+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRIFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP DYRHMEGFGVHTF  +NK GKV YVKFH
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHTFCFLNKAGKVTYVKFH  225



>ref|XP_006416379.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
 gb|ESQ34732.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
Length=405

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPS++F++PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVGIP DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDVGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF  TN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>gb|AAC19398.1| root catalase [Mesembryanthemum crystallinum]
Length=493

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+NT F  T  G PVWN+  +LTVG+RGPILLEDYHL+EKI ++ RERIP
Sbjct  1    MDPYKYRPSSSYNTSFMTTKTGQPVWNDDSSLTVGARGPILLEDYHLLEKIASWDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVT+DITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETMRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGNFDLVGNNFPVFF RD  +FPDV+ AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFALKFYTREGNFDLVGNNFPVFFNRDAMKFPDVVRAFKPNPKSHIQEMWRILDFCSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP +YRHMEGFGVHTFTM+N+ GK  YVKFH
Sbjct  181  ESLHTFAWFFDDVGIPINYRHMEGFGVHTFTMLNRAGKETYVKFH  225



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N PF  TN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHLQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP+DYRHM+GFGV+T+++INKDGK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPSDYRHMDGFGVNTYSLINKDGKTHYVKFH  225



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P +YRHM+G GVHTFT++N++GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLLNREGKATYVKFH  225



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF  TN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHMEG GV+T+T++NK GKV+YVKFH
Sbjct  181  ESLHMFSFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKVHYVKFH  225



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PFC TN GAP  NN   LTVG+RG +LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GVHTFT+INK GK  Y KFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYAKFH  225



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFC TN GAPVWNN   +++G RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFH
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFH  225



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++PF  TN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHMEG GV+T+T+I+K GK  YVKFH
Sbjct  181  ESLHMFTFLFDDLGIPQDYRHMEGSGVNTYTLISKTGKAYYVKFH  225



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVNRAGKAHYVKFH  225



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFC TN GAPVWNN   ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKG FEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGLFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFH
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFH  225



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   389 bits (1000),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F++PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GKV YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKVQYVKFH  225



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   389 bits (1000),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFH  225



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   389 bits (1000),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFC TN GAP+WNN   ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFP+VI AFKPNPKSHIQE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPEVIRAFKPNPKSHIQEPWRFLDFCSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFH
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFH  225



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   389 bits (998),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   389 bits (999),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+++INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYSLINKAGKAVYVKFH  225



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+P+  TN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+T+INK GK NYVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGAGVNTYTLINKAGKANYVKFH  225



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = +1

Query  73   LISMDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRE  252
             I+MDP KYRPSS++N+PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRE
Sbjct  49   FITMDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  108

Query  253  RIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIR  432
            RIPERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+R
Sbjct  109  RIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMR  168

Query  433  DPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLS  612
            D RGFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+S
Sbjct  169  DIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMS  228

Query  613  HLPESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            HLPESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  229  HLPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  276



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   389 bits (999),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF  TN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   388 bits (997),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKAVYVKFH  225



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF  TN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAQYVKFH  225



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS +NTPF  TN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPE IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEAWRIMDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ES N F + +DD+GIP DYRHMEGFGVHTF +INK GK  YVKFH
Sbjct  181  ESCNMFTFLFDDIGIPADYRHMEGFGVHTFKLINKAGKETYVKFH  225



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQESWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F +  DD+GIP DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLNMFTFLLDDIGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF   N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYVLINKAGKAHYVKFH  225



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   389 bits (998),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   389 bits (998),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F++PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFH  225



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   389 bits (998),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   389 bits (998),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+H+TCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   389 bits (998),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS +NTPF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   389 bits (998),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   389 bits (998),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F+T +  TN G PVWN+  ALTVGSRGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLIEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+T+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+PTDYRHMEGFGV+T+T INK+GKV+YVKFH
Sbjct  181  ESLHTFFFLFDDVGVPTDYRHMEGFGVNTYTFINKEGKVHYVKFH  225



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   388 bits (997),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   388 bits (997),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS +NTPF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   389 bits (1000),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+++TPF  TN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKF  753
            ESLNT  ++ DDVGIPTDYRHMEG  V+T T++NK+GK++YVKF
Sbjct  181  ESLNTMTFWLDDVGIPTDYRHMEGSSVNTLTLVNKEGKIHYVKF  224



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVNRAGKAHYVKFH  225



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFC TN GAP+WNN   ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVH RGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHRRGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFH
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKSGKARLVKFH  225



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N P+C TN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P +YRHMEG GV+T+T+INK GKV+YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPANYRHMEGSGVNTYTLINKAGKVHYVKFH  225



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSS +TPF  TN G PV NN  ++TVG RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSNDTPFWTTNAGDPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDV+HAFKPNPKSHIQE WRI D+ SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVVHAFKPNPKSHIQEYWRIFDFCSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFAWF+DDVGIP DYRHMEGFGVHT+ +INK GKV YVKFH
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHTYCLINKAGKVTYVKFH  225



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF   N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS+FN+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDIT+LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+ N PF  TN GAPVWNN  +LTVGSRGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP+DYRHM+GFGV+T+++I+KDGK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPSDYRHMDGFGVNTYSLISKDGKAHYVKFH  225



>ref|NP_973873.1| catalase 3 [Arabidopsis thaliana]
 gb|AEE29994.1| catalase 3 [Arabidopsis thaliana]
Length=427

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFH  225



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++H+ KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVGIP DYRHM+GFGV+T+T+INK GK   VKFH
Sbjct  181  ESLHMFTFLFDDVGIPMDYRHMDGFGVNTYTLINKAGKATLVKFH  225



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F TP+  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF  TN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAQYVKFH  225



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F++PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFH  225



>gb|AAG61140.2|AF332973_1 catalase 2 [Zantedeschia aethiopica]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS++  F  TN G PVWN+  ALTVGSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPCKYRPSSSYDASFTTTNAGGPVWNDDVALTVGSRGPILLEDYHLIEKVAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THLT ADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTFADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKS++QE WR+LD+LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSNVQEYWRVLDFLSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + YDDVG+P +YRHMEGFGV+T+T INK GK NYVKFH
Sbjct  181  ESLHTFCFLYDDVGVPLNYRHMEGFGVNTYTFINKAGKTNYVKFH  225



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N P+C TN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P +YRHMEG GV+T+T+INK GKV+YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPANYRHMEGSGVNTYTLINKAGKVHYVKFH  225



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F TP+  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+ +  TN GAPVWNN  +LTVG+RGPILLEDY LVEKI NF RERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INKDGK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYTLINKDGKAHYVKFH  225



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   387 bits (994),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF   N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+ +INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMEGSGVNTYMLINKAGKAVYVKFH  225



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKSVYVKFH  225



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN P+  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHM+G GVHT+T++++ G V YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVSRAGTVTYVKFH  225



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSF+T +  TN G PVWN+  ALTVG+RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTTYTTTNAGGPVWNDDQALTVGARGPILLEDYHLIEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T IN++GKV+YVKFH
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFINREGKVHYVKFH  225



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF   N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSS N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHMEG GV+T+ ++NK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYMLVNKAGKAVYVKFH  225



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LTVG RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTVGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T++ K GKV +VKFH
Sbjct  181  ESLLTWTWMFDDVGIPQDYRHMEGFGVHTYTLVAKSGKVLFVKFH  225



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   387 bits (994),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFC TN GAPVWNN   ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL +FAWFYDDVGIP +Y HMEGFGV  +++INK GK   VKFH
Sbjct  181  ESLLSFAWFYDDVGIPINYCHMEGFGVQAYSLINKSGKARLVKFH  225



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  85   DPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPE  264
            DP KYRPSS+F TP+  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  265  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  444
            RVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  445  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  624
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  625  SLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            SL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  SLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  224



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF  TN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P +YRHM+G GVHTFT++NK G+  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLVNKAGRQTYVKFH  225



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   387 bits (993),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +1

Query  103  PSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  282
            PSS+FN+PFC TN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  283  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  462
            GA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  463  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFA  642
            TREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PESL+ F 
Sbjct  121  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFT  180

Query  643  WFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            + +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  FLFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  218



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+F+TP+  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAYYVKFH  225



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  225



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFH  225



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F++P+  TN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+FYDD+G+P DYRHMEG  VH +T+I+K GKV+YVKFH
Sbjct  181  ESLHTFAFFYDDLGVPQDYRHMEGSSVHAYTLISKAGKVHYVKFH  225



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFH  225



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+ F  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFF+VTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+FN+PF  TN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIPTDYRHM+G GVHT+T+++K+GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPTDYRHMDGSGVHTYTLVSKEGKAHYVKFH  225



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F++P+  TN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+FYDD+G+P DYRHMEG  VH +T+I+K GKV+YVKFH
Sbjct  181  ESLHTFAFFYDDLGVPQDYRHMEGSSVHAYTLISKAGKVHYVKFH  225



>ref|NP_001031073.1| catalase 3 [Arabidopsis thaliana]
 dbj|BAH19685.1| AT1G20620 [Arabidopsis thaliana]
 gb|AEE29997.1| catalase 3 [Arabidopsis thaliana]
Length=485

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFH  225



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+P+  TN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGAGVNTYTLINKAGKAHYVKFH  225



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRA GVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP +YRHM+G GVHTFT++NK G+  YVKFH
Sbjct  181  ESLHMFTFLFDDLGIPLNYRHMDGSGVHTFTLVNKAGRQTYVKFH  225



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F++P+  TN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+FYDD+G+P DYRHMEG  VH +T+I+K GKV+YVKFH
Sbjct  181  ESLHTFAFFYDDLGVPQDYRHMEGSSVHAYTLISKAGKVHYVKFH  225



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENW +LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWGVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGVPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NTPFC TN GAP+WNN   ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++ L+CADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLSCADFLRAPGVQTPVIVRFSTVIHERVSPETVRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE+WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQESWRFLDFCSYHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL +FAWFYDDVGIP +YRHMEGFGV  +++INK GK   VKFH
Sbjct  181  ESLLSFAWFYDDVGIPINYRHMEGFGVQAYSLINKAGKARLVKFH  225



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   387 bits (993),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+LSH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFH  225



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   387 bits (993),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T++NK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLLNKAGKSVYVKFH  225



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   387 bits (993),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFH  225



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   387 bits (993),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPE+IRD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPESIRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T++ K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVAKSGKVLFVKFH  225



>dbj|BAH56915.1| AT1G20620 [Arabidopsis thaliana]
Length=493

 Score =   386 bits (992),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFH  225



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   386 bits (992),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   386 bits (991),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 199/218 (91%), Gaps = 0/218 (0%)
 Frame = +1

Query  103  PSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  282
            PSS+FN PF  TN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F R R PERVVHAR
Sbjct  3    PSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARGRTPERVVHAR  62

Query  283  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  462
            GA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  63   GASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFY  122

Query  463  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFA  642
            TREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSH+QE+WRILD+ SH+PESL+TF 
Sbjct  123  TREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHVQESWRILDFCSHIPESLSTFT  182

Query  643  WFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            WFYDDVGIP DYRHMEGFGV T+T+INK GKV+YVKFH
Sbjct  183  WFYDDVGIPQDYRHMEGFGVQTYTLINKAGKVHYVKFH  220



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   386 bits (992),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ ++PF  TN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   386 bits (992),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFH  225



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   386 bits (991),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWNN  +LTVG RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+P DYRHM+G GV+T+T+INK+GK +YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLINKEGKAHYVKFH  225



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   386 bits (991),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ ++P+  TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+T++NK GKV+YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLVNKVGKVHYVKFH  225



>prf||1906388A catalase
Length=492

 Score =   386 bits (991),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_006435362.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 gb|ESR48602.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=425

 Score =   384 bits (985),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K  PS++ N PF  TN GAPVWN+  +LTVGSRGP+LLEDYHLVEK+ +F RERIP
Sbjct  1    MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THDI+HLTCAD  RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GN+ PVFFIRD  +FPDVIHAFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF+WF+DDVGIP DYRHMEGFGV TFT++NK+GKV+YVKFH
Sbjct  181  ESLSTFSWFFDDVGIPQDYRHMEGFGVQTFTLVNKNGKVHYVKFH  225



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   388 bits (996),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +1

Query  79   SMDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERI  258
            +MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERI
Sbjct  64   TMDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERI  123

Query  259  PERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDP  438
            PERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD 
Sbjct  124  PERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDI  183

Query  439  RGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHL  618
            RGFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHL
Sbjct  184  RGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHL  243

Query  619  PESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            PESL T+ W +DDVGIP DYRHMEGFGVHT+T+++K GKV +VKFH
Sbjct  244  PESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVSKSGKVLFVKFH  289



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   387 bits (994),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN P+  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVGIP DYRHM+G GVHT+T++++ G V YVKFH
Sbjct  181  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVSRAGTVTYVKFH  225



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   386 bits (991),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVNRAGKAHYVKFH  225



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   385 bits (990),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  85   DPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPE  264
            DP KYRPSS+F TP+  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  265  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  444
            RVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  445  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  624
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  625  SLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            SL+ F++ +DD+G+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  SLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLINKAGKAHYVKFH  224



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   386 bits (991),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ ++ F  TN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHMEGFGV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLNESGKAHYVKFH  225



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   386 bits (991),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  94   KYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  273
            ++RPSS+FN+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  274  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  453
            HARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  454  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  633
            K YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  126  KFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFPESLH  185

Query  634  TFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
             F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  186  MFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKALYVKFH  226



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 1/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFF-TNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  179

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  180  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  224



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSS ++P+  TNGGAPV+NNI +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDSPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFDLVGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDLVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+ YDDVG+P +YRHMEGFGVH +  INK GK +YVKFH
Sbjct  181  ESLHTFAFMYDDVGVPLNYRHMEGFGVHAYQFINKAGKAHYVKFH  225



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RPSS++N PF  TN G PV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKF  753
            ESLNT  ++ DDVGIPTDYRHMEG  V+T T++NK+GK++YVKF
Sbjct  181  ESLNTMTFWLDDVGIPTDYRHMEGSSVNTLTLVNKEGKIHYVKF  224



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/221 (81%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  94   KYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  273
            +YRPSSS+N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  274  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  453
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  63   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  122

Query  454  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  633
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  123  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  182

Query  634  TFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
             F++  DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  183  MFSFLLDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFH  223



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWR++D+ S  P
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSPHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHYVKFH  225



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 204/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKF  753
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+INK GK  YVKF
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLINKAGKTMYVKF  224



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFH
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLISKXGKAHYVKFH  225



>ref|XP_008778560.1| PREDICTED: catalase isozyme 2-like [Phoenix dactylifera]
Length=482

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F+  +  TN GAPVWN+  ALTVG RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDPTYTTTNAGAPVWNDDQALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+P+DYRHMEGFGV+T+T +NK+GKV+YVKFH
Sbjct  181  ESLHTFFFLFDDVGVPSDYRHMEGFGVNTYTFVNKEGKVHYVKFH  225



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF  TN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F RERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P +YRHM+G GVHTFT+I+++GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPLNYRHMDGSGVHTFTLISREGKATYVKFH  225



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLT ADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNP+SHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+++INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYSLINKAGKAHYVKFH  225



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+    TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNP++HIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHIQENWRIMDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F +  DD+GIP +YRHMEGFGVHTFT++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLLDDIGIPLNYRHMEGFGVHTFTLVNRAGKCSYVKFH  225



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DL GNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKTHYVKFH  225



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFH  225



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+PF  TN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P +YRHM+G GVHTFT++NK G+  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLVNKAGRQTYVKFH  225



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++++ F  TN G PVWN+  ALT+G+RGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKYRPSSAYDSNFTTTNAGGPVWNDDVALTIGTRGPILLEDYHLIEKVAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNP+S+IQE WR+LD LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSNIQEYWRVLDILSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ES++TF + +DDVG+PTDYRHMEGFGV+T+T I+K GK  YVKFH
Sbjct  181  ESMHTFCFLFDDVGVPTDYRHMEGFGVNTYTFIHKSGKTRYVKFH  225



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 205/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+G+P DYRHM+GFGV+T+T+I+K GK  YVKFH
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLISKAGKAVYVKFH  225



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS ++TPF  TN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEPWRIMDFFSHVP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            E+ N F + +DD+GIP DYRHMEGFGVHTF +I K GK  YVKFH
Sbjct  181  EACNMFTFVFDDIGIPADYRHMEGFGVHTFKLITKAGKETYVKFH  225



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVT+D++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+P DYRHM+G GV+T+T INK+GK +YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTFINKEGKAHYVKFH  225



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K  PS++ N PF  TN GAPVWN+  +LTVGSRGP+LLEDYHLVEK+ +F RERIP
Sbjct  1    MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THDI+HLTCAD  RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GN+ PVFFIRD  +FPDVIHAFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF+WF+DDVGIP DYRHMEGFGV TFT++NK+GKV+YVKFH
Sbjct  181  ESLSTFSWFFDDVGIPQDYRHMEGFGVQTFTLVNKNGKVHYVKFH  225



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFH
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLISKAGKAHYVKFH  225



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   387 bits (995),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = +1

Query  70   PLISMDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTR  249
            P  +MDP KYRPSS+ ++ F  TN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF R
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  250  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  429
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  149  ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  208

Query  430  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYL  609
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ 
Sbjct  209  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFF  268

Query  610  SHLPESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            SH PESL+ F++ +DDVG+P DYRHMEGFGV+T+T++N+ GK +YVKFH
Sbjct  269  SHHPESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLNESGKAHYVKFH  317



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   384 bits (986),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIH RGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESLN F + +DD+GIP DYRHM+G GV+T+ +INK GK +YVKFH
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLINKAGKAHYVKFH  225



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   384 bits (985),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQEFWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+I+K GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLIDKAGKAHYVKFH  225



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   384 bits (985),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N+PF  TN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+P DYRHM+G GV+T+T+IN++GK +YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLINREGKTHYVKFH  225



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   384 bits (985),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+ ++PF  TN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAHYVKFH  225



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   384 bits (985),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+ ++PF  TN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAHYVKFH  225



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   384 bits (985),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K RP+S++N+PF  TN G PV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKF  753
            ESLNT  ++ DD+GIPTDYRHMEG  V+  T++NK+GK++YVKF
Sbjct  181  ESLNTMTFWLDDIGIPTDYRHMEGSSVNALTLVNKEGKMHYVKF  224



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   383 bits (984),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = +1

Query  106  SSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHARG  285
            SS+FN+PFC TN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  286  ATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYT  465
            A+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  466  REGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFAW  645
            REGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR+LD+ SH PESL+ F +
Sbjct  121  REGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVLDFFSHHPESLHMFTF  180

Query  646  FYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
             +DD+GIP DYRHM+G GVHTFT+INK GK  YVKFH
Sbjct  181  LFDDIGIPQDYRHMDGSGVHTFTLINKAGKSTYVKFH  217



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   383 bits (984),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RP+SSFN PF  TN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPRDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   383 bits (984),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
             FA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFH  225



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+FN+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+  + P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFYNFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHM+GFGV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLINKAGKSVYVKFH  225



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP + RPSS+ ++PF  TN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHM+GFGV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLINKAGKAHYVKFH  225



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RP+SSFN PF  TN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DDVG+P DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDVGVPRDYRHMEGSGVNTYMLINKAGKAHYVKFH  225



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+ ++PF  TN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHMEG  V+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGASVNTYMLINKAGKAHYVKFH  225



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+ N P  +TN GAPVW+N  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G GV+T+T++N+ GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFH  225



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/221 (80%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNY  744
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +Y
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKAGKAHY  221



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+ ++PF  TN GAPVWNN  +L+VG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHMEG GV+T+ +INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLINKAGKAHYVKFH  225



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +1

Query  94   KYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  273
            +YRPSSS+N+PF  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  274  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  453
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPRGFAV
Sbjct  84   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPRGFAV  143

Query  454  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  633
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  144  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  203

Query  634  TFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
             F++ +DD+G+P DYRHMEG GV+T+T+INK GK  YVKFH
Sbjct  204  MFSFLFDDIGVPQDYRHMEGSGVNTYTLINKAGKAYYVKFH  244



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++NT F  +NGGAP+ NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNTSFYTSNGGAPISNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPE++RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPESMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T++ K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLVAKSGKVLFVKFH  225



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP ++RPSS+FN+PF  TN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFH
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLISKAGKAHYVKFH  225



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+ F  TN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+G+P DYRHM+G GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLINKAGKAHYVKFH  225



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+P+  TN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F++ +DD+GIP DYRHMEG GV+T+T+INK GK +YVKFH
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGSGVNTYTLINKAGKAHYVKFH  225



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   381 bits (979),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+P+   N GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP +YRHMEG GV+T+T+INK GK  YVKFH
Sbjct  181  ESLHMFTFLFDDIGIPANYRHMEGSGVNTYTLINKAGKTYYVKFH  225



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   381 bits (979),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSSS +TP+  TNGGAPV+NNI +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDTPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFA K YTREGNFD+VGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TFA+ YDDVG+P +YRHMEGFGVH +  INK GK   VKFH
Sbjct  181  ESLHTFAFLYDDVGVPLNYRHMEGFGVHAYQFINKSGKSLLVKFH  225



>gb|ADU56198.1| catalase [Musa acuminata AAA Group]
Length=492

 Score =   381 bits (978),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+F T +  TN G PVWN+  ALTVG RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFGTTYTTTNAGGPVWNDNEALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFE THD+T LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+TF + +DDVG+PTDYRHMEGFGV+T+T IN+ GK +YVKFH
Sbjct  181  ESLHTFCFLFDDVGVPTDYRHMEGFGVNTYTFINRAGKAHYVKFH  225



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   381 bits (978),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS+FN+PF  TN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F +  DD+G+P DYRHMEG GV+T+T+I+K GK +YVKFH
Sbjct  181  ESLHMFTFLSDDLGVPQDYRHMEGSGVNTYTLISKTGKAHYVKFH  225



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   380 bits (977),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRPSS++N PF  TNGGAPV NNI +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+H R SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHGRASPETMRDIR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPN K++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNRKTNIQEYWRILDYMSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL T+ W +DDVGIP DYRHMEGFGVHT+T+I K GKV +VKFH
Sbjct  181  ESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFH  225



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+ F  TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA++KGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQETWRILDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DD+GIP DYRHM+G G++T+T+INK GK  YV FH
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGINTYTLINKAGKAYYVNFH  225



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP KYRP+SS+N+PF  TN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK+YT EGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKLYTGEGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNY  744
            ESLN F + +DD+GIP DYRHMEG GV+T+ +INK GK +Y
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLINKSGKAHY  221



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS++N+P+C TN GAPVWNN  +LT+G+RGP+LLEDYHL+EK+  FTRERIP
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLIEKLSVFTRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFD+VGNN PVFF RD  QFPDVI A KPNPK+HIQE WR LDYLSHLP
Sbjct  121  GFAVKFYTREGNFDIVGNNIPVFFTRDAIQFPDVIRALKPNPKTHIQEPWRYLDYLSHLP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ES  TF +++DD GIP+DYRHMEGFGVHTF ++ ++GK  Y KFH
Sbjct  181  ESCLTFLFWFDDWGIPSDYRHMEGFGVHTFKLLTQNGKDTYCKFH  225



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +1

Query  82   MDPSKYRPSSSFNTPFCATNGGAPVWNNICALTVGSRGPILLEDYHLVEKIQNFTRERIP  261
            MDP K+RPSS+ N+PF  TN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  262  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  441
            ERVVHARGA+AKGFFEVTHD++HLTCADFL APGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  442  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  621
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  622  ESLNTFAWFYDDVGIPTDYRHMEGFGVHTFTMINKDGKVNYVKFH  756
            ESL+ F + +DDVG+P DYRHM+G GV+T+T+INK+GK  YVKFH
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLINKEGKARYVKFH  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260