BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF041A06

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783584.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    233   4e-69   Nicotiana sylvestris
dbj|BAC22609.1|  41 kD chloroplast nucleoid DNA binding protein (...    232   4e-69   Nicotiana sylvestris
ref|XP_011080092.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    229   1e-67   Sesamum indicum [beniseed]
ref|XP_007011663.1|  Eukaryotic aspartyl protease family protein,...    224   7e-67   
ref|XP_004245197.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    226   1e-66   Solanum lycopersicum
ref|XP_007011664.1|  Eukaryotic aspartyl protease family protein ...    222   2e-66   
ref|XP_007011665.1|  Eukaryotic aspartyl protease family protein,...    224   5e-66   
ref|XP_007011662.1|  Eukaryotic aspartyl protease family protein,...    224   5e-66   
emb|CDP18857.1|  unnamed protein product                                222   7e-66   Coffea canephora [robusta coffee]
emb|CBI21177.3|  unnamed protein product                                220   8e-66   Vitis vinifera
ref|XP_008379433.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    224   9e-66   Malus domestica [apple tree]
ref|XP_006364268.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    223   1e-65   Solanum tuberosum [potatoes]
ref|XP_009591885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    221   6e-65   
ref|XP_002285593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    221   8e-65   Vitis vinifera
ref|XP_006483511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    220   2e-64   Citrus sinensis [apfelsine]
ref|XP_006450237.1|  hypothetical protein CICLE_v10008143mg             220   2e-64   Citrus clementina [clementine]
ref|XP_009363292.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    220   3e-64   Pyrus x bretschneideri [bai li]
ref|XP_007225640.1|  hypothetical protein PRUPE_ppa004762mg             219   3e-64   Prunus persica
gb|KJB55135.1|  hypothetical protein B456_009G064900                    218   7e-64   Gossypium raimondii
ref|XP_011082009.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    218   1e-63   
ref|XP_010692959.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    218   2e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG10166.1|  Asparticase nepenthesin-2                               216   3e-63   Gossypium arboreum [tree cotton]
emb|CBI21175.3|  unnamed protein product                                213   6e-63   Vitis vinifera
ref|XP_008220631.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    216   8e-63   Prunus mume [ume]
ref|XP_008220632.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    215   1e-62   Prunus mume [ume]
ref|XP_002283470.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    214   2e-62   Vitis vinifera
ref|XP_004291984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    214   3e-62   Fragaria vesca subsp. vesca
emb|CDP19504.1|  unnamed protein product                                213   8e-62   Coffea canephora [robusta coffee]
gb|EYU22027.1|  hypothetical protein MIMGU_mgv1a005281mg                212   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_011036733.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    211   3e-61   Populus euphratica
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg                211   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_004150866.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    211   5e-61   Cucumis sativus [cucumbers]
ref|XP_002324349.1|  nucleoid DNA-binding family protein                211   5e-61   
emb|CDP11359.1|  unnamed protein product                                211   6e-61   Coffea canephora [robusta coffee]
ref|XP_008452815.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    207   1e-59   Cucumis melo [Oriental melon]
gb|KDO67377.1|  hypothetical protein CISIN_1g011600mg                   205   5e-59   Citrus sinensis [apfelsine]
gb|KHN12538.1|  Aspartic proteinase nepenthesin-2                       204   1e-58   Glycine soja [wild soybean]
ref|XP_003551807.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   2e-58   Glycine max [soybeans]
ref|XP_003532146.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   2e-58   Glycine max [soybeans]
gb|KDO67374.1|  hypothetical protein CISIN_1g011556mg                   204   3e-58   Citrus sinensis [apfelsine]
ref|XP_006483510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    203   3e-58   Citrus sinensis [apfelsine]
gb|KJB55134.1|  hypothetical protein B456_009G064800                    203   4e-58   Gossypium raimondii
gb|KJB65924.1|  hypothetical protein B456_010G120300                    202   1e-57   Gossypium raimondii
emb|CAB96832.1|  nucleoid DNA-binding protein cnd41-like protein        201   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146522.1|  hypothetical protein PHAVU_006G048000g             201   2e-57   Phaseolus vulgaris [French bean]
ref|XP_006287637.1|  hypothetical protein CARUB_v10000848mg             201   2e-57   Capsella rubella
ref|NP_196638.2|  aspartyl protease family protein                      200   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491758.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    201   4e-57   
ref|XP_010422809.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    200   5e-57   Camelina sativa [gold-of-pleasure]
gb|KHG03216.1|  Asparticase nepenthesin-2                               200   6e-57   Gossypium arboreum [tree cotton]
gb|AHA84134.1|  aspartic proteinase nepenthesin-1                       200   8e-57   Phaseolus vulgaris [French bean]
ref|XP_002873476.1|  hypothetical protein ARALYDRAFT_325615             199   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010453111.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002515388.1|  Aspartic proteinase nepenthesin-2 precursor,...    199   2e-56   
ref|XP_006483727.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    198   2e-56   
ref|XP_009359073.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    199   2e-56   
ref|XP_008377499.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    198   5e-56   
ref|XP_010049847.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   6e-56   Eucalyptus grandis [rose gum]
ref|XP_008357233.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   6e-56   
ref|XP_010108296.1|  Aspartic proteinase nepenthesin-2                  197   7e-56   Morus notabilis
ref|XP_008223730.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   7e-56   Prunus mume [ume]
gb|KEH33912.1|  eukaryotic aspartyl protease family protein             197   8e-56   Medicago truncatula
ref|XP_007226774.1|  hypothetical protein PRUPE_ppa018129mg             196   1e-55   
ref|XP_010256102.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_004513892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   5e-54   Cicer arietinum [garbanzo]
gb|KDP33485.1|  hypothetical protein JCGZ_07056                         192   6e-54   Jatropha curcas
ref|XP_010555463.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_004513891.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   5e-53   Cicer arietinum [garbanzo]
ref|XP_010259084.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   7e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010065986.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   2e-51   Eucalyptus grandis [rose gum]
ref|XP_009359074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_008386743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   4e-51   
gb|KJB55136.1|  hypothetical protein B456_009G065000                    184   6e-51   Gossypium raimondii
gb|KHM99525.1|  Aspartic proteinase nepenthesin-1                       184   7e-51   Glycine soja [wild soybean]
ref|XP_008386742.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   8e-51   
ref|XP_007011661.1|  Eukaryotic aspartyl protease family protein,...    184   1e-50   
ref|XP_010108293.1|  Aspartic proteinase nepenthesin-2                  185   1e-50   
ref|XP_003530761.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   5e-50   
emb|CDY56047.1|  BnaCnng29770D                                          178   6e-50   Brassica napus [oilseed rape]
ref|XP_009411894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   1e-49   
ref|XP_002324352.2|  hypothetical protein POPTR_0018s03010g             180   2e-49   
ref|XP_002324351.1|  nucleoid DNA-binding family protein                180   2e-49   
gb|KGN55408.1|  hypothetical protein Csa_4G651750                       178   2e-49   Cucumis sativus [cucumbers]
ref|XP_009359069.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_008220869.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   3e-49   Prunus mume [ume]
emb|CDX85746.1|  BnaA02g00670D                                          179   3e-49   
ref|XP_008220626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   5e-49   Prunus mume [ume]
gb|KDP33482.1|  hypothetical protein JCGZ_07053                         178   7e-49   Jatropha curcas
ref|XP_009125277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   4e-48   Brassica rapa
ref|XP_007011660.1|  Eukaryotic aspartyl protease family protein,...    176   8e-48   
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009359072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009122022.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   3e-47   Brassica rapa
emb|CDX69804.1|  BnaA10g21530D                                          174   3e-47   
ref|XP_002309515.1|  nucleoid DNA-binding family protein                173   7e-47   Populus trichocarpa [western balsam poplar]
emb|CDX97058.1|  BnaC09g45670D                                          173   7e-47   
gb|KFK25359.1|  hypothetical protein AALP_AA8G103100                    173   9e-47   Arabis alpina [alpine rockcress]
ref|XP_010066088.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    172   1e-46   Eucalyptus grandis [rose gum]
ref|XP_007223364.1|  hypothetical protein PRUPE_ppa005616mg             172   1e-46   
gb|KCW44808.1|  hypothetical protein EUGRSUZ_L01627                     170   2e-46   Eucalyptus grandis [rose gum]
gb|KCW44810.1|  hypothetical protein EUGRSUZ_L01629                     170   3e-46   Eucalyptus grandis [rose gum]
ref|XP_009409855.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220627.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    170   1e-45   Prunus mume [ume]
gb|KEH33910.1|  eukaryotic aspartyl protease family protein             169   1e-45   Medicago truncatula
ref|XP_007223563.1|  hypothetical protein PRUPE_ppa014553mg             168   2e-45   
ref|XP_010419657.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   3e-45   Camelina sativa [gold-of-pleasure]
gb|ACN85295.1|  aspartic proteinase nepenthesin-1 precursor             169   4e-45   Oryza coarctata
ref|XP_008379443.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    169   4e-45   Malus domestica [apple tree]
ref|XP_006399574.1|  hypothetical protein EUTSA_v10013429mg             167   1e-44   Eutrema salsugineum [saltwater cress]
gb|KCW80526.1|  hypothetical protein EUGRSUZ_C01880                     166   2e-44   Eucalyptus grandis [rose gum]
ref|XP_011036735.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   2e-44   Populus euphratica
ref|XP_002515387.1|  Aspartic proteinase nepenthesin-2 precursor,...    166   3e-44   Ricinus communis
ref|XP_007212799.1|  hypothetical protein PRUPE_ppa020165mg             164   4e-44   
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   1e-43   Elaeis guineensis
ref|XP_003532147.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   1e-43   Glycine max [soybeans]
ref|XP_010422811.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008220628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   2e-43   Prunus mume [ume]
gb|KCW80527.1|  hypothetical protein EUGRSUZ_C01881                     162   2e-43   Eucalyptus grandis [rose gum]
gb|KCW80528.1|  hypothetical protein EUGRSUZ_C01882                     163   3e-43   Eucalyptus grandis [rose gum]
ref|XP_010050794.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   3e-43   Eucalyptus grandis [rose gum]
gb|ACN85284.1|  aspartic proteinase nepenthesin-1 precursor             164   4e-43   Oryza australiensis
ref|XP_009391894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010050793.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   4e-43   Eucalyptus grandis [rose gum]
ref|XP_010422810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_002873474.1|  hypothetical protein ARALYDRAFT_909035             159   5e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_007226285.1|  hypothetical protein PRUPE_ppa019577mg             162   7e-43   
ref|XP_010068511.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   8e-43   
gb|ACN85339.1|  aspartic proteinase nepenthesin-1 precursor             162   9e-43   Oryza meyeriana var. granulata
ref|NP_196637.1|  aspartyl protease family protein                      162   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KCW63888.1|  hypothetical protein EUGRSUZ_G01561                     161   1e-42   Eucalyptus grandis [rose gum]
gb|AAN60226.1|  unknown                                                 161   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   2e-42   Elaeis guineensis
gb|ACN85177.1|  aspartic proteinase nepenthesin-1 precursor             161   3e-42   Oryza sativa f. spontanea
ref|XP_004295359.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   5e-42   Fragaria vesca subsp. vesca
gb|ACN85278.1|  aspartic proteinase nepenthesin-1 precursor             160   5e-42   Oryza alta
ref|XP_008811141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   6e-42   Phoenix dactylifera
ref|XP_002309514.1|  nucleoid DNA-binding family protein                160   6e-42   Populus trichocarpa [western balsam poplar]
emb|CDY40117.1|  BnaC02g00130D                                          159   7e-42   Brassica napus [oilseed rape]
ref|XP_004965901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   1e-41   Setaria italica
dbj|BAJ94237.1|  predicted protein                                      159   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW64008.1|  hypothetical protein EUGRSUZ_G01690                     157   3e-41   Eucalyptus grandis [rose gum]
ref|XP_007224537.1|  hypothetical protein PRUPE_ppa024411mg             158   3e-41   
gb|ACN85210.1|  aspartic proteinase nepenthesin-1 precursor             158   4e-41   Oryza glaberrima
gb|ACN85264.1|  aspartic proteinase nepenthesin-1 precursor             158   4e-41   Oryza alta
ref|XP_009122026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   5e-41   Brassica rapa
gb|ACN85242.1|  aspartic proteinase nepenthesin-1 precursor             158   5e-41   Oryza minuta
ref|XP_010491756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   6e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001058055.1|  Os06g0610800                                       157   6e-41   
gb|ACN85252.1|  aspartic proteinase nepenthesin-1 precursor             157   8e-41   Oryza officinalis
ref|XP_011019522.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   1e-40   Populus euphratica
gb|ACN85307.1|  aspartic proteinase nepenthesin-1 precursor             157   1e-40   Oryza ridleyi
ref|XP_010453109.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   2e-40   Camelina sativa [gold-of-pleasure]
dbj|BAJ92731.1|  predicted protein                                      155   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010068575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   3e-40   
ref|XP_008379455.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   4e-40   Malus domestica [apple tree]
emb|CDY72573.1|  BnaAnng41520D                                          154   5e-40   Brassica napus [oilseed rape]
gb|ACN85225.1|  aspartic proteinase nepenthesin-1 precursor             155   6e-40   Oryza punctata
ref|XP_010491755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010491757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   7e-40   
gb|KCW63886.1|  hypothetical protein EUGRSUZ_G01558                     153   9e-40   Eucalyptus grandis [rose gum]
gb|KCW63885.1|  hypothetical protein EUGRSUZ_G01557                     153   1e-39   Eucalyptus grandis [rose gum]
ref|XP_010266604.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010066087.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   1e-39   Eucalyptus grandis [rose gum]
ref|XP_010491754.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010913225.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   1e-39   Elaeis guineensis
ref|XP_011019525.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   1e-39   Populus euphratica
ref|XP_010065985.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   2e-39   Eucalyptus grandis [rose gum]
ref|NP_001168472.1|  hypothetical protein                               152   3e-39   Zea mays [maize]
gb|KDO67375.1|  hypothetical protein CISIN_1g017894mg                   150   3e-39   Citrus sinensis [apfelsine]
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_008648080.1|  PREDICTED: uncharacterized protein LOC100382...    152   5e-39   Zea mays [maize]
gb|KCW44809.1|  hypothetical protein EUGRSUZ_L01628                     151   5e-39   Eucalyptus grandis [rose gum]
ref|XP_010040897.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   5e-39   Eucalyptus grandis [rose gum]
ref|XP_008779067.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   6e-39   Phoenix dactylifera
gb|KDP33484.1|  hypothetical protein JCGZ_07055                         151   7e-39   Jatropha curcas
ref|XP_010068543.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   7e-39   
ref|XP_008806169.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   7e-39   
gb|KFK25358.1|  hypothetical protein AALP_AA8G103000                    151   8e-39   Arabis alpina [alpine rockcress]
gb|KCW63938.1|  hypothetical protein EUGRSUZ_G01615                     151   1e-38   Eucalyptus grandis [rose gum]
ref|XP_006287706.1|  hypothetical protein CARUB_v10000913mg             150   1e-38   Capsella rubella
ref|XP_002437273.1|  hypothetical protein SORBIDRAFT_10g023970          151   1e-38   Sorghum bicolor [broomcorn]
ref|XP_006287688.1|  hypothetical protein CARUB_v10000896mg             150   2e-38   Capsella rubella
ref|XP_010913305.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   2e-38   
ref|XP_003563633.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_010913306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   3e-38   Elaeis guineensis
ref|XP_010266605.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007224453.1|  hypothetical protein PRUPE_ppa022256mg             148   4e-38   
ref|XP_010066094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    148   1e-37   Eucalyptus grandis [rose gum]
ref|XP_010108295.1|  Aspartic proteinase nepenthesin-2                  147   1e-37   
gb|KCW63890.1|  hypothetical protein EUGRSUZ_G01565                     147   1e-37   Eucalyptus grandis [rose gum]
ref|XP_008777074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   2e-37   Phoenix dactylifera
gb|KCW63937.1|  hypothetical protein EUGRSUZ_G01615                     146   5e-37   Eucalyptus grandis [rose gum]
ref|XP_002324355.2|  nucleoid DNA-binding family protein                146   5e-37   
ref|XP_010050792.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   6e-37   
ref|XP_010913226.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   7e-37   Elaeis guineensis
ref|XP_009390623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   7e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007021889.1|  Eukaryotic aspartyl protease family protein,...    147   7e-37   
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   9e-37   Oryza brachyantha
gb|KCW63732.1|  hypothetical protein EUGRSUZ_G01378                     143   2e-36   Eucalyptus grandis [rose gum]
ref|XP_008779686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   2e-36   Phoenix dactylifera
ref|XP_010252879.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   3e-36   Nelumbo nucifera [Indian lotus]
gb|KCW63736.1|  hypothetical protein EUGRSUZ_G01384                     144   3e-36   Eucalyptus grandis [rose gum]
ref|XP_008777073.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   4e-36   Phoenix dactylifera
ref|NP_001063501.1|  Os09g0482200                                       143   9e-36   
gb|EAZ09523.1|  hypothetical protein OsI_31798                          143   9e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_010928159.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   1e-35   Elaeis guineensis
ref|XP_006294147.1|  hypothetical protein CARUB_v10023140mg             141   3e-35   Capsella rubella
ref|XP_009122025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   4e-35   
gb|ABP93696.1|  unknown protein isoform 1                               139   4e-35   Lemna minor
ref|XP_002515386.1|  Aspartic proteinase nepenthesin-2 precursor,...    140   4e-35   
ref|XP_010091139.1|  Aspartic proteinase nepenthesin-2                  134   4e-35   
emb|CDY70207.1|  BnaA10g30140D                                          140   5e-35   Brassica napus [oilseed rape]
ref|XP_009122891.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   6e-35   Brassica rapa
ref|XP_009122023.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   7e-35   
ref|XP_008776166.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   2e-34   
ref|NP_001047956.1|  Os02g0720900                                       139   2e-34   
ref|XP_006289171.1|  hypothetical protein CARUB_v10002609mg             139   2e-34   
emb|CDX97054.1|  BnaC09g45710D                                          138   3e-34   
ref|XP_002460431.1|  hypothetical protein SORBIDRAFT_02g028000          138   3e-34   Sorghum bicolor [broomcorn]
ref|XP_007147550.1|  hypothetical protein PHAVU_006G134200g             138   4e-34   Phaseolus vulgaris [French bean]
gb|ABP93697.1|  unknown protein isoform 2                               136   5e-34   Lemna minor
dbj|BAJ99659.1|  predicted protein                                      137   6e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX82233.1|  BnaA03g35880D                                          135   1e-33   
ref|XP_009391801.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI29432.3|  unnamed protein product                                134   4e-33   Vitis vinifera
ref|XP_002324354.1|  nucleoid DNA-binding family protein                135   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004957153.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   1e-32   Setaria italica
ref|XP_002277380.3|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   1e-32   Vitis vinifera
gb|KDP33483.1|  hypothetical protein JCGZ_07054                         134   2e-32   Jatropha curcas
ref|XP_006857554.1|  hypothetical protein AMTR_s00061p00053330          133   2e-32   Amborella trichopoda
ref|XP_011012151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   2e-32   Populus euphratica
ref|XP_010913303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   2e-32   
ref|XP_010058011.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   3e-32   Eucalyptus grandis [rose gum]
ref|XP_008805509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   3e-32   Phoenix dactylifera
ref|XP_008796557.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   5e-32   Phoenix dactylifera
ref|XP_008776818.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   7e-32   
ref|XP_010913256.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   7e-32   Elaeis guineensis
emb|CAJ26370.1|  chloroplast nucleoid binding protein                   131   1e-31   Brachypodium sylvaticum
gb|EMS52672.1|  Aspartic proteinase nepenthesin-2                       130   2e-31   Triticum urartu
ref|XP_009407227.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534754.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-31   Glycine max [soybeans]
ref|XP_008652856.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-31   Zea mays [maize]
gb|AFW86421.1|  hypothetical protein ZEAMMB73_098827                    130   3e-31   
ref|XP_007024419.1|  Eukaryotic aspartyl protease family protein,...    129   4e-31   Theobroma cacao [chocolate]
ref|XP_008659479.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   4e-31   
ref|XP_003570481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   5e-31   Brachypodium distachyon [annual false brome]
ref|XP_003594399.1|  Aspartic proteinase nepenthesin-2                  129   6e-31   Medicago truncatula
gb|ABR16115.1|  unknown                                                 129   6e-31   Picea sitchensis
ref|XP_004965303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   6e-31   Setaria italica
ref|XP_006647807.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   7e-31   Oryza brachyantha
ref|NP_001141341.1|  uncharacterized protein LOC100273432 precursor     129   9e-31   Zea mays [maize]
tpg|DAA61984.1|  TPA: hypothetical protein ZEAMMB73_915310              128   1e-30   
ref|XP_010928184.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-30   
ref|XP_010068417.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   1e-30   
gb|KHN40751.1|  Aspartic proteinase nepenthesin-2                       127   2e-30   Glycine soja [wild soybean]
ref|XP_011040081.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   3e-30   Populus euphratica
ref|XP_003576664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   3e-30   Brachypodium distachyon [annual false brome]
gb|ACG34391.1|  aspartic proteinase nepenthesin-2 precursor             127   4e-30   Zea mays [maize]
emb|CDX97053.1|  BnaC09g45720D                                          123   4e-30   
gb|ACJ85595.1|  unknown                                                 127   4e-30   Medicago truncatula
gb|EMT14793.1|  Aspartic proteinase nepenthesin-2                       126   5e-30   
ref|XP_004486405.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   8e-30   Cicer arietinum [garbanzo]
ref|XP_006597643.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   9e-30   Glycine max [soybeans]
ref|XP_010913304.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   1e-29   
ref|XP_010266606.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   2e-29   
ref|XP_004959561.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   3e-29   Setaria italica
ref|XP_002525244.1|  Aspartic proteinase nepenthesin-2 precursor,...    124   3e-29   
dbj|BAJ91382.1|  predicted protein                                      124   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX97055.1|  BnaC09g45700D                                          123   5e-29   
ref|XP_009401501.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006373545.1|  hypothetical protein POPTR_0016s00260g             122   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_004953720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   2e-28   Setaria italica
ref|XP_002438283.1|  hypothetical protein SORBIDRAFT_10g011110          121   3e-28   Sorghum bicolor [broomcorn]
gb|ACG38835.1|  aspartic proteinase nepenthesin-1 precursor             121   4e-28   Zea mays [maize]
ref|NP_001266842.1|  aspartic proteinase nepenthesin-1 isoform 1 ...    120   4e-28   Zea mays [maize]
emb|CDX85747.1|  BnaA02g00660D                                          120   5e-28   
ref|XP_010096516.1|  Aspartic proteinase nepenthesin-2                  120   5e-28   
ref|NP_001168410.1|  hypothetical protein precursor                     120   6e-28   Zea mays [maize]
ref|XP_006647806.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   6e-28   Oryza brachyantha
ref|XP_001757102.1|  predicted protein                                  120   7e-28   
gb|EAY87322.1|  hypothetical protein OsI_08726                          119   1e-27   
gb|EPS61272.1|  hypothetical protein M569_13524                         119   1e-27   
gb|EMT32056.1|  Aspartic proteinase nepenthesin-2                       119   1e-27   
dbj|BAD12875.1|  putative chloroplast nucleoid DNA-binding protei...    119   1e-27   
ref|XP_004966924.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   1e-27   
gb|EPS70865.1|  hypothetical protein M569_03893                         119   2e-27   
ref|XP_009125278.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   3e-27   
emb|CDY40116.1|  BnaC02g00140D                                          118   3e-27   
gb|KDP41942.1|  hypothetical protein JCGZ_26960                         118   3e-27   
ref|XP_010266610.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   3e-27   
ref|XP_004303222.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   4e-27   
emb|CDO98251.1|  unnamed protein product                                118   4e-27   
gb|EMT07661.1|  Aspartic proteinase nepenthesin-2                       118   4e-27   
ref|XP_010655139.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   4e-27   
ref|XP_010268523.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   5e-27   
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   6e-27   
ref|NP_001288481.1|  uncharacterized protein LOC103627660 precursor     117   6e-27   
ref|XP_003635520.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   6e-27   
ref|XP_007023525.1|  Eukaryotic aspartyl protease family protein        117   7e-27   
emb|CDX92240.1|  BnaA05g21670D                                          117   8e-27   
ref|XP_002454377.1|  hypothetical protein SORBIDRAFT_04g029680          117   8e-27   
ref|XP_002454373.1|  hypothetical protein SORBIDRAFT_04g029630          117   8e-27   
ref|XP_009381660.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   8e-27   
ref|XP_008680242.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   8e-27   
gb|KHN14389.1|  Aspartic proteinase nepenthesin-2                       117   8e-27   
ref|XP_009418540.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   1e-26   
ref|XP_010537860.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   1e-26   
ref|XP_009609916.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   1e-26   
gb|ABK24493.1|  unknown                                                 116   1e-26   
gb|EYU27614.1|  hypothetical protein MIMGU_mgv1a017820mg                116   2e-26   
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   2e-26   
ref|XP_002438291.1|  hypothetical protein SORBIDRAFT_10g011210          116   2e-26   
ref|NP_001047954.1|  Os02g0720600                                       116   2e-26   
ref|XP_004959560.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   2e-26   
ref|XP_004235884.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   2e-26   
gb|KJB52970.1|  hypothetical protein B456_008G285900                    116   2e-26   
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein        116   2e-26   
ref|XP_002454359.1|  hypothetical protein SORBIDRAFT_04g029390          115   3e-26   
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   3e-26   
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26   
ref|NP_001130675.1|  uncharacterized protein LOC100191778 precursor     115   3e-26   
ref|XP_011095850.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26   
ref|XP_009615689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26   
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26   
ref|XP_006341422.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26   
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26   
ref|XP_004964380.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26   
ref|XP_008679060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-26   
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-26   
gb|KDP29019.1|  hypothetical protein JCGZ_16408                         115   4e-26   
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-26   
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...    115   4e-26   
ref|XP_006576102.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-26   
ref|XP_009774796.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-26   
ref|XP_004964375.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   5e-26   
dbj|BAJ89995.1|  predicted protein                                      114   6e-26   
emb|CDY24395.1|  BnaCnng04620D                                          115   6e-26   
ref|XP_011012148.1|  PREDICTED: aspartic proteinase nepenthesin-2...    114   6e-26   
gb|EMT32054.1|  Aspartic proteinase nepenthesin-2                       114   6e-26   
ref|XP_006483509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   8e-26   
ref|XP_010906670.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   8e-26   
ref|XP_002453187.1|  hypothetical protein SORBIDRAFT_04g001340          114   8e-26   
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   8e-26   
ref|XP_009759386.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   9e-26   
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   9e-26   
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             114   9e-26   
ref|XP_004959563.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   1e-25   
gb|AEW08303.1|  hypothetical protein 2_5996_01                          109   1e-25   
gb|EAY87323.1|  hypothetical protein OsI_08727                          114   1e-25   
ref|XP_006427680.1|  hypothetical protein CICLE_v10025395mg             114   1e-25   
ref|XP_002452641.1|  hypothetical protein SORBIDRAFT_04g029670          114   1e-25   
ref|XP_011082601.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   1e-25   
ref|NP_001141706.1|  hypothetical protein precursor                     114   1e-25   
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             114   1e-25   
ref|XP_008791340.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   1e-25   
ref|XP_002454360.1|  hypothetical protein SORBIDRAFT_04g029400          114   1e-25   
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g             114   1e-25   
emb|CDY24483.1|  BnaC05g34710D                                          114   1e-25   
ref|XP_010265509.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   1e-25   
dbj|BAD62387.1|  putative 41 kD chloroplast nucleoid DNA binding ...    114   1e-25   
ref|XP_002438284.1|  hypothetical protein SORBIDRAFT_10g011120          114   1e-25   
ref|XP_002458192.1|  hypothetical protein SORBIDRAFT_03g028480          114   1e-25   
ref|XP_010266613.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   1e-25   
gb|KDO55402.1|  hypothetical protein CISIN_1g011482mg                   114   1e-25   
ref|XP_002445330.1|  hypothetical protein SORBIDRAFT_07g009580          114   2e-25   
gb|EMT13228.1|  Aspartic proteinase nepenthesin-1                       113   2e-25   
gb|EEE57700.1|  hypothetical protein OsJ_08178                          113   2e-25   
gb|KHN38061.1|  Aspartic proteinase nepenthesin-1                       113   2e-25   
gb|EMT28035.1|  Aspartic proteinase nepenthesin-2                       113   2e-25   
ref|XP_003531753.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25   
ref|XP_006302129.1|  hypothetical protein CARUB_v10020134mg             114   2e-25   
ref|XP_009390624.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25   
ref|XP_009390629.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25   
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              113   2e-25   
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    113   3e-25   
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         112   4e-25   
ref|XP_009106694.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   4e-25   
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   4e-25   
ref|XP_002885261.1|  aspartyl protease family protein                   112   4e-25   
gb|KJB37242.1|  hypothetical protein B456_006G195400                    112   5e-25   
ref|XP_002297678.1|  aspartyl protease family protein                   112   5e-25   
ref|XP_011036734.1|  PREDICTED: aspartic proteinase nepenthesin-1...    111   6e-25   
ref|XP_002436936.1|  hypothetical protein SORBIDRAFT_10g011730          112   6e-25   
ref|XP_009375476.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   6e-25   
ref|XP_004966945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   7e-25   
ref|XP_010266609.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   7e-25   
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1             112   7e-25   
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   7e-25   
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein       112   7e-25   
gb|AFW61999.1|  hypothetical protein ZEAMMB73_694403                    110   7e-25   
ref|XP_011034591.1|  PREDICTED: aspartic proteinase nepenthesin-1       112   8e-25   
ref|XP_010266607.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   8e-25   
ref|XP_006845396.1|  hypothetical protein AMTR_s00019p00061190          111   9e-25   
ref|XP_009401063.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   9e-25   
gb|KJB56498.1|  hypothetical protein B456_009G122200                    111   9e-25   
gb|KHN04198.1|  Aspartic proteinase nepenthesin-1                       111   1e-24   
ref|XP_003530207.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   1e-24   
ref|NP_001168399.1|  hypothetical protein precursor                     112   1e-24   
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   1e-24   
emb|CDX88562.1|  BnaC06g40060D                                          111   1e-24   
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   2e-24   
ref|XP_003563922.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
emb|CDX87358.1|  BnaA07g35150D                                          110   2e-24   
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   2e-24   
gb|EPS66029.1|  hypothetical protein M569_08742                         110   2e-24   
ref|XP_002324933.2|  hypothetical protein POPTR_0018s03000g             110   2e-24   
ref|XP_006857555.1|  hypothetical protein AMTR_s00061p00053670          110   2e-24   
gb|EMT28036.1|  Aspartic proteinase nepenthesin-1                       110   2e-24   
ref|XP_006493458.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   3e-24   
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   3e-24   
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                    110   3e-24   
gb|AFG60356.1|  hypothetical protein 2_5996_01                          105   3e-24   
gb|EMS47306.1|  Aspartic proteinase nepenthesin-2                       110   3e-24   
gb|AFB33417.1|  hypothetical protein 2_5996_01                          105   3e-24   
gb|AFG60347.1|  hypothetical protein 2_5996_01                          105   3e-24   
gb|KCW62215.1|  hypothetical protein EUGRSUZ_H04874                     109   4e-24   
ref|XP_002512754.1|  Aspartic proteinase nepenthesin-1 precursor,...    109   4e-24   
ref|XP_004507035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   4e-24   
ref|XP_006659988.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   4e-24   
ref|XP_007215297.1|  hypothetical protein PRUPE_ppa005040mg             110   4e-24   
gb|KCW63730.1|  hypothetical protein EUGRSUZ_G01376                     109   4e-24   
ref|XP_006656916.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   4e-24   
emb|CDX79338.1|  BnaC06g19650D                                          110   4e-24   
gb|AEW08302.1|  hypothetical protein 2_5996_01                          105   5e-24   
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              108   5e-24   
gb|AFK37220.1|  unknown                                                 108   5e-24   
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   5e-24   
gb|AFB33415.1|  hypothetical protein 2_5996_01                          104   5e-24   
ref|XP_010687331.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   5e-24   
ref|XP_003525547.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   6e-24   
ref|XP_010417641.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   6e-24   
gb|EEE54965.1|  hypothetical protein OsJ_02555                          108   6e-24   
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...    109   6e-24   
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   7e-24   
emb|CDX75968.1|  BnaC03g40510D                                          109   7e-24   
gb|EEC71061.1|  hypothetical protein OsI_02803                          108   8e-24   
ref|NP_001172459.1|  Os01g0608366                                       108   9e-24   
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   9e-24   
ref|XP_002890686.1|  aspartyl protease family protein                   108   9e-24   
ref|XP_007142110.1|  hypothetical protein PHAVU_008G253400g             108   9e-24   
gb|KEH28580.1|  eukaryotic aspartyl protease family protein             108   1e-23   
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23   
ref|XP_004953760.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23   
ref|XP_004953759.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23   
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23   
ref|XP_001759252.1|  predicted protein                                  107   1e-23   
emb|CDX82342.1|  BnaA03g34790D                                          108   2e-23   
ref|NP_173922.1|  aspartyl protease family protein                      108   2e-23   
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   2e-23   
gb|EAY72467.1|  hypothetical protein OsI_00323                          108   2e-23   
ref|XP_009104505.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   2e-23   
ref|XP_002460430.1|  hypothetical protein SORBIDRAFT_02g027990          108   2e-23   
ref|XP_004973076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23   
gb|EMT16675.1|  Aspartic proteinase nepenthesin-2                       107   2e-23   
ref|NP_001041979.1|  Os01g0140100                                       108   2e-23   
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   2e-23   
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    108   2e-23   
emb|CDX67980.1|  BnaA07g20200D                                          107   2e-23   
ref|XP_002436940.1|  hypothetical protein SORBIDRAFT_10g011750          107   3e-23   
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   3e-23   
gb|EMS63200.1|  Aspartic proteinase nepenthesin-1                       106   3e-23   
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   3e-23   
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   107   3e-23   
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             107   3e-23   
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   3e-23   
ref|XP_010034049.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   3e-23   
ref|NP_001150335.1|  aspartic proteinase nepenthesin-2 precursor        107   3e-23   
gb|AFW86441.1|  hypothetical protein ZEAMMB73_342504                    107   3e-23   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-23   
ref|XP_002889266.1|  aspartyl protease family protein                   107   4e-23   
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-23   
ref|XP_008659488.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-23   
ref|XP_008228848.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-23   
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-23   
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-23   
gb|EMT28037.1|  Aspartic proteinase nepenthesin-2                       106   5e-23   
gb|EMT07876.1|  Aspartic proteinase nepenthesin-1                       106   5e-23   
gb|AFK40245.1|  unknown                                                 106   6e-23   
ref|XP_006483507.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   6e-23   
ref|XP_006483508.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   6e-23   
gb|KDO67372.1|  hypothetical protein CISIN_1g011649mg                   106   6e-23   
ref|XP_002436939.1|  hypothetical protein SORBIDRAFT_10g011740          106   6e-23   
dbj|BAD12880.1|  putative chloroplast nucleoid DNA-binding protei...    105   7e-23   
ref|XP_004241673.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   7e-23   
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   7e-23   
gb|ACF83631.1|  unknown                                                 105   7e-23   
emb|CDP20730.1|  unnamed protein product                                106   7e-23   
ref|XP_009395291.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   8e-23   
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             106   8e-23   
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   8e-23   
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   9e-23   
gb|AFW73158.1|  aspartic proteinase nepenthesin-2                       106   9e-23   
gb|KHN49090.1|  Aspartic proteinase nepenthesin-2                       101   9e-23   
ref|XP_010472845.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-22   
ref|XP_008461208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-22   
gb|ACG25562.1|  aspartic proteinase nepenthesin-2 precursor             105   1e-22   
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             105   1e-22   
ref|XP_008646173.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-22   



>ref|XP_009783584.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=515

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 151/216 (70%), Gaps = 10/216 (5%)
 Frame = +2

Query  125  TESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDN---TPTL  295
            T  +HFHT+ LTSL P++ C+      A+KG RRGASL+VV++ G C+         PTL
Sbjct  53   TIESHFHTLQLTSLLPSSSCNT-----ATKGKRRGASLEVVNRQGPCTQLNQKGAKAPTL  107

Query  296  TDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSK--AAVPAKSGTTLSTGNY  469
            T+IL  D++RV+SI ARV     D           KK       A +PA+SG  L TGNY
Sbjct  108  TEILAHDQARVDSIQARVTDQSYDLFKKKDKKSSNKKKSVKDSKANLPAQSGLPLGTGNY  167

Query  470  IVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAA  649
            IV VGLG P K L+L+FDTGSDLTWTQC+PCVK+CY QQ+ IF+P  S TYSNISC++ A
Sbjct  168  IVNVGLGTPKKDLSLIFDTGSDLTWTQCQPCVKSCYAQQQPIFDPSASKTYSNISCTSTA  227

Query  650  CSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            CSGL SATGN+PGCSSS CVYGIQYGDSSF+VGFFA
Sbjct  228  CSGLKSATGNSPGCSSSNCVYGIQYGDSSFTVGFFA  263



>dbj|BAC22609.1| 41 kD chloroplast nucleoid DNA binding protein (CND41) [Nicotiana 
sylvestris]
Length=502

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 151/216 (70%), Gaps = 10/216 (5%)
 Frame = +2

Query  125  TESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDN---TPTL  295
            T  +HFHT+ LTSL P++ C+      A+KG RRGASL+VV++ G C+         PTL
Sbjct  40   TIESHFHTLQLTSLLPSSSCNT-----ATKGKRRGASLEVVNRQGPCTQLNQKGAKAPTL  94

Query  296  TDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSK--AAVPAKSGTTLSTGNY  469
            T+IL  D++RV+SI ARV     D           KK       A +PA+SG  L TGNY
Sbjct  95   TEILAHDQARVDSIQARVTDQSYDLFKKKDKKSSNKKKSVKDSKANLPAQSGLPLGTGNY  154

Query  470  IVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAA  649
            IV VGLG P K L+L+FDTGSDLTWTQC+PCVK+CY QQ+ IF+P  S TYSNISC++ A
Sbjct  155  IVNVGLGTPKKDLSLIFDTGSDLTWTQCQPCVKSCYAQQQPIFDPSASKTYSNISCTSTA  214

Query  650  CSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            CSGL SATGN+PGCSSS CVYGIQYGDSSF+VGFFA
Sbjct  215  CSGLKSATGNSPGCSSSNCVYGIQYGDSSFTVGFFA  250



>ref|XP_011080092.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=509

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 155/218 (71%), Gaps = 16/218 (7%)
 Frame = +2

Query  134  THFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST-GKDN-----TPTL  295
            TH+HT+ + SLFP + C    T       +R ++L+V H+HG CS  G+D      TP++
Sbjct  53   THYHTLQINSLFPASVCSTNTTPSTGSS-KRQSTLEVFHRHGPCSQLGQDTDATITTPSV  111

Query  296  TDILNQDESRVNSIHARVNS----ARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTG  463
            +++L+ D+SRV+SI A+V S     +I N N+        K+ D KA +P +SG +L +G
Sbjct  112  SEVLSHDQSRVDSIQAQVKSDSSKVKIKNTNS-----NPNKLKDKKANLPVQSGRSLGSG  166

Query  464  NYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSA  643
            NYIVTVGLG PTK+L+L+FDTGSDLTWTQCEPC ++CY QQ+ IFNP  S +YSNISC++
Sbjct  167  NYIVTVGLGTPTKTLSLIFDTGSDLTWTQCEPCARSCYQQQDPIFNPSASASYSNISCNS  226

Query  644  AACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
              CS L+ ATGN PGCSS+TCVYGIQYGD SFSVGFF+
Sbjct  227  PQCSQLSGATGNKPGCSSTTCVYGIQYGDQSFSVGFFS  264



>ref|XP_007011663.1| Eukaryotic aspartyl protease family protein, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY29282.1| Eukaryotic aspartyl protease family protein, putative isoform 
2, partial [Theobroma cacao]
Length=395

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 26/214 (12%)
 Frame = +2

Query  137  HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTLTDIL  307
            H HTV ++SL P++ C       ++K L + +SL+VVHKHG CS     K N PT  ++L
Sbjct  32   HSHTVHVSSLLPSSVCSP-----SAKALDKKSSLQVVHKHGPCSQLHQDKANIPTHAEVL  86

Query  308  NQDESRVNSIHARVN----SARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
             QDE+RV SIH+R+     S+ +D  +A              A +PAK G+ + +GNYIV
Sbjct  87   LQDEARVKSIHSRLGRKPGSSDVDETDA--------------AQLPAKDGSVVGSGNYIV  132

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            TVGLG P K L+LVFDTGSD+TWTQC+PC K+CY Q++ IF P  S+TYSNISC++ ACS
Sbjct  133  TVGLGTPKKGLSLVFDTGSDITWTQCQPCAKSCYKQRDPIFAPSQSSTYSNISCTSTACS  192

Query  656  GLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             LTSATGN+PGC+SS CVYGIQYGDSSFSVGFFA
Sbjct  193  SLTSATGNSPGCASSACVYGIQYGDSSFSVGFFA  226



>ref|XP_004245197.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=501

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 155/214 (72%), Gaps = 8/214 (4%)
 Frame = +2

Query  125  TESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTL  295
            T  ++FHT+ LTS+ P++ C       +SKG R GASL+V++KHG CS      +  PTL
Sbjct  48   TIESNFHTIQLTSILPSSSCKP-----SSKGKRGGASLEVINKHGPCSQLNKKGEKGPTL  102

Query  296  TDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
            T++L  D++RV+SI  R+ +   +         +K +  DSK  +PA+ G  LSTGNYIV
Sbjct  103  TEMLAHDQARVDSIQTRIAAQNFNLFRKTEKTSKKYRAKDSKTTLPAQPGIALSTGNYIV  162

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            TVG+G P K LTL+FDTGSDLTWTQCEPC KTC+ QQ+ IFNP  S+TYSNISCS+ ACS
Sbjct  163  TVGIGTPKKDLTLIFDTGSDLTWTQCEPCFKTCFPQQQPIFNPSSSSTYSNISCSSTACS  222

Query  656  GLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            GL SATGN+P CSSSTCVYGIQYGDSSFS+GFFA
Sbjct  223  GLKSATGNSPVCSSSTCVYGIQYGDSSFSIGFFA  256



>ref|XP_007011664.1| Eukaryotic aspartyl protease family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY29283.1| Eukaryotic aspartyl protease family protein isoform 3, partial 
[Theobroma cacao]
Length=377

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 152/216 (70%), Gaps = 26/216 (12%)
 Frame = +2

Query  131  STHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTLTD  301
            S++ HTV ++SL P++ C       ++K L + +SL+VVHKHG CS     K N PT  +
Sbjct  12   SSNSHTVHVSSLLPSSVCSP-----SAKALDKKSSLQVVHKHGPCSQLHQDKANIPTHAE  66

Query  302  ILNQDESRVNSIHARVN----SARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNY  469
            +L QDE+RV SIH+R+     S+ +D  +A              A +PAK G+ + +GNY
Sbjct  67   VLLQDEARVKSIHSRLGRKPGSSDVDETDA--------------AQLPAKDGSVVGSGNY  112

Query  470  IVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAA  649
            IVTVGLG P K L+LVFDTGSD+TWTQC+PC K+CY Q++ IF P  S+TYSNISC++ A
Sbjct  113  IVTVGLGTPKKGLSLVFDTGSDITWTQCQPCAKSCYKQRDPIFAPSQSSTYSNISCTSTA  172

Query  650  CSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            CS LTSATGN+PGC+SS CVYGIQYGDSSFSVGFFA
Sbjct  173  CSSLTSATGNSPGCASSACVYGIQYGDSSFSVGFFA  208



>ref|XP_007011665.1| Eukaryotic aspartyl protease family protein, putative isoform 
4, partial [Theobroma cacao]
 gb|EOY29284.1| Eukaryotic aspartyl protease family protein, putative isoform 
4, partial [Theobroma cacao]
Length=477

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 26/214 (12%)
 Frame = +2

Query  137  HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTLTDIL  307
            H HTV ++SL P++ C       ++K L + +SL+VVHKHG CS     K N PT  ++L
Sbjct  36   HSHTVHVSSLLPSSVCSP-----SAKALDKKSSLQVVHKHGPCSQLHQDKANIPTHAEVL  90

Query  308  NQDESRVNSIHARVN----SARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
             QDE+RV SIH+R+     S+ +D  +A              A +PAK G+ + +GNYIV
Sbjct  91   LQDEARVKSIHSRLGRKPGSSDVDETDA--------------AQLPAKDGSVVGSGNYIV  136

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            TVGLG P K L+LVFDTGSD+TWTQC+PC K+CY Q++ IF P  S+TYSNISC++ ACS
Sbjct  137  TVGLGTPKKGLSLVFDTGSDITWTQCQPCAKSCYKQRDPIFAPSQSSTYSNISCTSTACS  196

Query  656  GLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             LTSATGN+PGC+SS CVYGIQYGDSSFSVGFFA
Sbjct  197  SLTSATGNSPGCASSACVYGIQYGDSSFSVGFFA  230



>ref|XP_007011662.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY29281.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
Length=474

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 26/214 (12%)
 Frame = +2

Query  137  HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTLTDIL  307
            H HTV ++SL P++ C       ++K L + +SL+VVHKHG CS     K N PT  ++L
Sbjct  33   HSHTVHVSSLLPSSVCSP-----SAKALDKKSSLQVVHKHGPCSQLHQDKANIPTHAEVL  87

Query  308  NQDESRVNSIHARVN----SARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
             QDE+RV SIH+R+     S+ +D  +A              A +PAK G+ + +GNYIV
Sbjct  88   LQDEARVKSIHSRLGRKPGSSDVDETDA--------------AQLPAKDGSVVGSGNYIV  133

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            TVGLG P K L+LVFDTGSD+TWTQC+PC K+CY Q++ IF P  S+TYSNISC++ ACS
Sbjct  134  TVGLGTPKKGLSLVFDTGSDITWTQCQPCAKSCYKQRDPIFAPSQSSTYSNISCTSTACS  193

Query  656  GLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             LTSATGN+PGC+SS CVYGIQYGDSSFSVGFFA
Sbjct  194  SLTSATGNSPGCASSACVYGIQYGDSSFSVGFFA  227



>emb|CDP18857.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 154/224 (69%), Gaps = 22/224 (10%)
 Frame = +2

Query  101  KGIASE-SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---S  268
            KG A E SL    ++HTV ++S+ P++ C       ++KG  R +SL VVH+HG C   +
Sbjct  2    KGQALERSLAAEINYHTVHVSSILPSSACKP-----SAKGPSRKSSLTVVHRHGPCHQLN  56

Query  269  TGKDNTPTLTDILNQDESRVNSIHAR-VNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSG  445
                N  TLT IL++D++RV SI AR    A  D            KI  SKA +PAK G
Sbjct  57   QESSNRETLTQILSEDQTRVRSIQARHAFGADTD------------KIRGSKADLPAKRG  104

Query  446  TTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYS  625
            + + TGNY+V+VGLG P KS TLVFDTGSDLTWTQCEPCV+ CY QQ+ I++P  S++YS
Sbjct  105  SAIGTGNYVVSVGLGTPAKSYTLVFDTGSDLTWTQCEPCVRVCYKQQDPIYDPAKSSSYS  164

Query  626  NISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            NISC+AA CS L+SATGN+PGCS+S C+YGIQYGD SFSVGFFA
Sbjct  165  NISCNAAQCSALSSATGNSPGCSASNCLYGIQYGDQSFSVGFFA  208



>emb|CBI21177.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 153/228 (67%), Gaps = 22/228 (10%)
 Frame = +2

Query  95   AEKGIASE----SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGG  262
            +++G+A +    +L+  +  H V +TSL P++ C       + KG  + ASL+V+HKHG 
Sbjct  22   SKRGLAFQGRKTALSTPSTLHNVHITSLMPSSVCSP-----SPKGDDKRASLEVIHKHGP  76

Query  263  CS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVP  433
            CS     K  +P+ T +L+QDESRVNSI +R+     D            K+  SK  +P
Sbjct  77   CSKLSQDKGRSPSRTQMLDQDESRVNSIRSRLAKNPADG----------GKLKGSKVTLP  126

Query  434  AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLS  613
            +KSG+T+ TGNY+VTVGLG P + LT +FDTGSDLTWTQCEPC + CY QQE IFNP  S
Sbjct  127  SKSGSTIGTGNYVVTVGLGTPKRDLTFIFDTGSDLTWTQCEPCARYCYHQQEPIFNPSKS  186

Query  614  TTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            T+Y+NISCS+  C  L S TGN+P CS+STCVYGIQYGD S+SVGFFA
Sbjct  187  TSYTNISCSSPTCDELKSGTGNSPSCSASTCVYGIQYGDQSYSVGFFA  234



>ref|XP_008379433.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=504

 Score =   224 bits (570),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 149/226 (66%), Gaps = 12/226 (5%)
 Frame = +2

Query  98   EKGIA-SESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGAS---LKVVHKHGGC  265
            EKG A  E+     H HTV L SL P T C    +          +S   LKVVHKHG C
Sbjct  36   EKGFAVEENQLLHQHAHTVELNSLLPATSCSPSSSAKGHDNKEPTSSSTVLKVVHKHGPC  95

Query  266  STGKDN---TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPA  436
            S  K N    PT   ILNQD++RV+SIH+RVN+ +  +   V      K  P +   +PA
Sbjct  96   SGIKKNKSKIPTHAQILNQDQARVDSIHSRVNTKKSPSAATVD-----KLRPSADTKIPA  150

Query  437  KSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLST  616
            +SG+ + +GNYIV+VGLG+P K L+L+FDTGSDLTWTQC PC K+CY Q+E IF+P  S+
Sbjct  151  QSGSVVGSGNYIVSVGLGSPKKMLSLIFDTGSDLTWTQCRPCAKSCYKQKEPIFDPATSS  210

Query  617  TYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            +Y NISCS+A CS L S TGN PGC+SSTCVYGIQYGD SFSVGFF
Sbjct  211  SYVNISCSSATCSELVSGTGNTPGCASSTCVYGIQYGDQSFSVGFF  256



>ref|XP_006364268.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=485

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 153/214 (71%), Gaps = 8/214 (4%)
 Frame = +2

Query  125  TESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTL  295
            T  ++FHT+ LTS+ P++ C       +SKG R G SL+V++KHG CS      +   TL
Sbjct  32   TIESNFHTIQLTSILPSSSCKP-----SSKGKRGGTSLEVINKHGPCSQLNKKGEKGQTL  86

Query  296  TDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
            T+IL  D++RV+SI  R+ +   +         +K +  DSK  +PA+ GT LSTGNYIV
Sbjct  87   TEILAHDQARVDSIQTRIAAQNFNLFRKTEKTSKKYRAKDSKTTLPAQPGTALSTGNYIV  146

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            T+G+G P K LTL+FDTGSDLTWTQCEPC KTC+ QQ+ IFNP  S+TYSNISCS+ ACS
Sbjct  147  TIGIGTPKKDLTLIFDTGSDLTWTQCEPCFKTCFPQQQPIFNPSSSSTYSNISCSSTACS  206

Query  656  GLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            GL SATGN P CSSSTCVYGIQYGDSSFS+GFFA
Sbjct  207  GLKSATGNTPLCSSSTCVYGIQYGDSSFSIGFFA  240



>ref|XP_009591885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
 dbj|BAA22813.1| CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum]
Length=502

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 135/189 (71%), Gaps = 5/189 (3%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCSTGKDN---TPTLTDILNQDESRVNSIHARVNSARIDNLN  376
            A+KG RRGASL+VV++ G C+         PTLT+IL  D++RV+SI AR+     D   
Sbjct  62   ATKGKRRGASLEVVNRQGPCTLLNQKGAKAPTLTEILAHDQARVDSIQARITDQSYDLFK  121

Query  377  AVSGVGRKKKIPDSK--AAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQ  550
                    KK       A +PA+SG  L TGNYIV VGLG P K L+L+FDTGSDLTWTQ
Sbjct  122  KKDKKSSNKKKSVKDSKANLPAQSGLPLGTGNYIVNVGLGTPKKDLSLIFDTGSDLTWTQ  181

Query  551  CEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD  730
            C+PCVK+CY QQ+ IF+P  S TYSNISC++AACS L SATGN+PGCSSS CVYGIQYGD
Sbjct  182  CQPCVKSCYAQQQPIFDPSTSKTYSNISCTSAACSSLKSATGNSPGCSSSNCVYGIQYGD  241

Query  731  SSFSVGFFA  757
            SSF++GFFA
Sbjct  242  SSFTIGFFA  250



>ref|XP_002285593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=481

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 153/228 (67%), Gaps = 22/228 (10%)
 Frame = +2

Query  95   AEKGIASE----SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGG  262
            +++G+A +    +L+  +  H V +TSL P++ C       + KG  + ASL+V+HKHG 
Sbjct  22   SKRGLAFQGRKTALSTPSTLHNVHITSLMPSSVCSP-----SPKGDDKRASLEVIHKHGP  76

Query  263  CS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVP  433
            CS     K  +P+ T +L+QDESRVNSI +R+     D            K+  SK  +P
Sbjct  77   CSKLSQDKGRSPSRTQMLDQDESRVNSIRSRLAKNPADG----------GKLKGSKVTLP  126

Query  434  AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLS  613
            +KSG+T+ TGNY+VTVGLG P + LT +FDTGSDLTWTQCEPC + CY QQE IFNP  S
Sbjct  127  SKSGSTIGTGNYVVTVGLGTPKRDLTFIFDTGSDLTWTQCEPCARYCYHQQEPIFNPSKS  186

Query  614  TTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            T+Y+NISCS+  C  L S TGN+P CS+STCVYGIQYGD S+SVGFFA
Sbjct  187  TSYTNISCSSPTCDELKSGTGNSPSCSASTCVYGIQYGDQSYSVGFFA  234



>ref|XP_006483511.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO67376.1| hypothetical protein CISIN_1g011600mg [Citrus sinensis]
Length=481

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 27/230 (12%)
 Frame = +2

Query  98   EKGIASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGK  277
            E+ +A+ES  E  H HT+ L+SL P++ C+      ++KG  + +SLKVVHKHG C    
Sbjct  22   EERVAAESQHELQHMHTIQLSSLLPSSVCNP-----STKGNAKKSSLKVVHKHGPCFKPY  76

Query  278  DN-------TPTLT--DILNQDESRVNSIHARV--NSARIDNLNAVSGVGRKKKIPDSKA  424
             N       +P+++  +IL QD+SRV SIH+R+  NS  +D +                A
Sbjct  77   SNGEKAASPSPSVSHAEILRQDQSRVKSIHSRLSKNSGSLDEIRQ-----------SDDA  125

Query  425  AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNP  604
             +PAK G+ +  GNYIVTVG+G P K L+L+FDTGSDLTWTQCEPCVK CY Q+E  F+P
Sbjct  126  TLPAKDGSVVGAGNYIVTVGIGTPKKDLSLIFDTGSDLTWTQCEPCVKYCYEQKEPKFDP  185

Query  605  KLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
             +S +YSN+SCS+  C+ L SATGN+P C+SSTC+YGIQYGDSSFS+GFF
Sbjct  186  TVSQSYSNVSCSSTICTSLQSATGNSPACASSTCLYGIQYGDSSFSIGFF  235



>ref|XP_006450237.1| hypothetical protein CICLE_v10008143mg [Citrus clementina]
 gb|ESR63477.1| hypothetical protein CICLE_v10008143mg [Citrus clementina]
Length=481

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 27/230 (12%)
 Frame = +2

Query  98   EKGIASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGK  277
            E+ +A+ES  E  H HT+ L+SL P++ C+      ++KG  + +SLKVVHKHG C    
Sbjct  22   EERVAAESQHELQHMHTIQLSSLLPSSVCNP-----STKGNAKKSSLKVVHKHGPCFKPY  76

Query  278  DN-------TPTLT--DILNQDESRVNSIHARV--NSARIDNLNAVSGVGRKKKIPDSKA  424
             N       +P+++  +IL QD+SRV SIH+R+  NS  +D +                A
Sbjct  77   SNGEKAASPSPSVSHAEILRQDQSRVKSIHSRLSKNSGSLDEIRQ-----------SDDA  125

Query  425  AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNP  604
             +PAK G+ +  GNYIVTVG+G P K L+L+FDTGSDLTWTQCEPCVK CY Q+E  F+P
Sbjct  126  TLPAKDGSVVGAGNYIVTVGIGTPKKDLSLIFDTGSDLTWTQCEPCVKYCYEQKEPKFDP  185

Query  605  KLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
             +S +YSN+SCS+  C+ L SATGN+P C+SSTC+YGIQYGDSSFS+GFF
Sbjct  186  TVSQSYSNVSCSSTICTSLQSATGNSPACASSTCLYGIQYGDSSFSIGFF  235



>ref|XP_009363292.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=507

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 148/226 (65%), Gaps = 12/226 (5%)
 Frame = +2

Query  98   EKGIA-SESLTESTHFHTVPLTSLFptthchqphtthA--SKGLRRGAS-LKVVHKHGGC  265
            EKG A  E+     H HTV L SL P T C    +     +KG    ++ LKVVHKHG C
Sbjct  39   EKGFAMEENQLLHQHAHTVELNSLLPATSCSPSSSAKGHDNKGPTSSSTVLKVVHKHGPC  98

Query  266  STGKDN---TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPA  436
            S  K      PT   IL QD++RV+SIH+RVN     N  + S     K  P +   +PA
Sbjct  99   SGIKKKNSKIPTHAQILKQDQARVDSIHSRVN-----NKKSPSAATVDKLRPSADTKIPA  153

Query  437  KSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLST  616
            +SG+ + +GNYIV+VGLG+P K L+L+FDTGSDLTWTQC PC K+CY Q+E IF+P  S 
Sbjct  154  QSGSVVGSGNYIVSVGLGSPKKMLSLIFDTGSDLTWTQCRPCAKSCYKQKEPIFDPAASA  213

Query  617  TYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            +Y NISCS+A CS L S TGN PGCSSSTC+YGIQYGD SFSVGFF
Sbjct  214  SYVNISCSSATCSELVSGTGNTPGCSSSTCIYGIQYGDQSFSVGFF  259



>ref|XP_007225640.1| hypothetical protein PRUPE_ppa004762mg [Prunus persica]
 gb|EMJ26839.1| hypothetical protein PRUPE_ppa004762mg [Prunus persica]
Length=492

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 150/225 (67%), Gaps = 16/225 (7%)
 Frame = +2

Query  98   EKGIASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGAS-LKVVHKHGGCS--  268
            EKG A   L E  H HTV + SL P T C    +T         +S LKVVHKHG CS  
Sbjct  30   EKGFA---LEEREHAHTVEVNSLLPATTCSSSSSTKGHMSKHASSSVLKVVHKHGPCSRL  86

Query  269  -TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSG  445
               K  TPT   IL QD++RVNSIH+RVNS +   L +V  +        +   +PA+SG
Sbjct  87   KKHKSKTPTHAQILQQDQARVNSIHSRVNSKK--QLKSVDDLRE-----SAATTIPAQSG  139

Query  446  TTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYS  625
            + +  GNYIV VGLG+P K L+L+FDTGSDLTWTQC PCVK+CY Q+E IF+P LS +Y+
Sbjct  140  SVVGAGNYIVNVGLGSPKKQLSLIFDTGSDLTWTQCRPCVKSCYKQKEPIFDPSLSASYA  199

Query  626  NISCSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGFF  754
            N+SC++A C+ L SATGN PGC  S+STC+YGIQYGD SFSVG+F
Sbjct  200  NVSCTSATCTQLGSATGNTPGCTASTSTCIYGIQYGDQSFSVGYF  244



>gb|KJB55135.1| hypothetical protein B456_009G064900 [Gossypium raimondii]
Length=485

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 146/215 (68%), Gaps = 27/215 (13%)
 Frame = +2

Query  137  HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST----GKDNTPTLTDI  304
            H HT+ ++SL P++ C       A+K L + +SL+VVHKHG CS      K N PT  +I
Sbjct  44   HSHTIQVSSLLPSSICSP-----ATKVLDKKSSLQVVHKHGPCSQLYHHDKANIPTHAEI  98

Query  305  LNQDESRVNSIHARV----NSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYI  472
            L QD +RV SIH+++     S ++D  +A              A +PAK G+ + +GNY+
Sbjct  99   LLQDVARVKSIHSKLAKSLGSTKVDQTDA--------------ANIPAKDGSVVGSGNYV  144

Query  473  VTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAAC  652
            VTVGLG P K LTL+FDTGSD+TWTQC+PCV TCY QQ+ +F P LS+TYSNISCS+  C
Sbjct  145  VTVGLGTPKKDLTLIFDTGSDITWTQCQPCVGTCYKQQDPVFAPSLSSTYSNISCSSTTC  204

Query  653  SGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            + L SATGN PGCSSS CVYGIQYGDSSFSVG FA
Sbjct  205  NSLASATGNTPGCSSSACVYGIQYGDSSFSVGIFA  239



>ref|XP_011082009.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Sesamum 
indicum]
Length=490

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 156/219 (71%), Gaps = 8/219 (4%)
 Frame = +2

Query  104  GIASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDN  283
            G+ +       HFHT+  TSL P + C        +  ++R ++L+VVH+HG CS  K  
Sbjct  34   GVQARKANTQPHFHTLYFTSLLPASVCTPSPL---ADSIKRQSTLQVVHRHGPCSQDKPT  90

Query  284  T-PTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLST  460
              P L+ IL  D+SRV SI AR+N     N N +     K K+ D KA +PA+SG++LS+
Sbjct  91   AAPPLSRILAGDQSRVESIQARLNPT--SNTNQLKP--NKNKLIDRKANLPAQSGSSLSS  146

Query  461  GNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCS  640
            GNY+V+VGLG P K+L+L+FDTGSDLTWTQC+PCV++CY Q++ IFNP  ST+YSN+SCS
Sbjct  147  GNYVVSVGLGTPKKTLSLIFDTGSDLTWTQCQPCVRSCYQQRDPIFNPSSSTSYSNVSCS  206

Query  641  AAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            A+ C+ L+SATGN+PGCSS+TCVYGIQYGD SFSVGF +
Sbjct  207  ASQCAQLSSATGNDPGCSSTTCVYGIQYGDQSFSVGFLS  245



>ref|XP_010692959.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=521

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 148/222 (67%), Gaps = 9/222 (4%)
 Frame = +2

Query  116  ESLTESTH-FHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDN  283
            +SL    H  H V +TSL P+T     + +   +  RRG SL+V H+HG CST    K +
Sbjct  54   QSLELKYHSHHIVQVTSLLPSTDEESCNASPKER-RRRGNSLEVSHRHGPCSTLQLDKSS  112

Query  284  TPTLTDILNQDESRVNSIHARVNSARID----NLNAVSGVGRKKKIPDSKAAVPAKSGTT  451
             P+  DIL  DE RV+SI  RVN   ++    +L+    V +K  +      +P KSG+T
Sbjct  113  RPSHADILEHDEERVDSIRGRVNPKLVEIDSFSLHKKPKVPKKDTVKQKTVGLPVKSGST  172

Query  452  LSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNI  631
            + +GNYIVT+GLG P K LTL+FDTGSD TWTQC PC K+CY Q+E +F+P  S+TYSNI
Sbjct  173  IGSGNYIVTIGLGTPRKDLTLIFDTGSDFTWTQCAPCKKSCYKQREPVFDPSKSSTYSNI  232

Query  632  SCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            +CS+  CS + SAT  +PGCSSSTC+YGIQYGDSSFSVGFFA
Sbjct  233  TCSSTLCSEVRSATSASPGCSSSTCIYGIQYGDSSFSVGFFA  274



>gb|KHG10166.1| Asparticase nepenthesin-2 [Gossypium arboreum]
Length=478

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 146/215 (68%), Gaps = 27/215 (13%)
 Frame = +2

Query  137  HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST----GKDNTPTLTDI  304
            H HT+ ++SL P++ C       A+K L + +SL+VVHKHG CS      K N PT  +I
Sbjct  37   HSHTIQVSSLLPSSICSL-----ATKVLDKKSSLQVVHKHGPCSQLYHHDKANIPTHAEI  91

Query  305  LNQDESRVNSIHARV----NSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYI  472
            L QD +RV SIH+++     S ++D  +A              A +PAK G+ + +GNY+
Sbjct  92   LLQDVARVKSIHSKLAKSLGSTKVDQTDA--------------ANIPAKDGSVVGSGNYV  137

Query  473  VTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAAC  652
            VTVGLG P K LTL+FDTGSD+TWTQC+PCV TCY QQ+ +F P LS+TYSNISC++  C
Sbjct  138  VTVGLGTPKKDLTLIFDTGSDITWTQCQPCVGTCYKQQDPVFAPSLSSTYSNISCNSTTC  197

Query  653  SGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            + L SATGN PGCSSS CVYGIQYGDSSFSVG FA
Sbjct  198  NSLASATGNTPGCSSSACVYGIQYGDSSFSVGIFA  232



>emb|CBI21175.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 134/187 (72%), Gaps = 17/187 (9%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARV--NSARIDNLN  376
            KG  + ASL+VVHKHG CS     K N+P+ T IL QDESRV SI +R+  N A   NL 
Sbjct  11   KGHDQRASLEVVHKHGPCSKLRPHKANSPSHTQILAQDESRVASIQSRLAKNLAGGSNLK  70

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
            A            SKA +P+KS +TL +GNY+VTVGLG+P + LT +FDTGSDLTWTQCE
Sbjct  71   A------------SKATLPSKSASTLGSGNYVVTVGLGSPKRDLTFIFDTGSDLTWTQCE  118

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PCV  CY Q+E IF+P  S +YSN+SC + +C  L SATGN+PGCSSSTC+YGI+YGD S
Sbjct  119  PCVGYCYQQREHIFDPSTSLSYSNVSCDSPSCEKLESATGNSPGCSSSTCLYGIRYGDGS  178

Query  737  FSVGFFA  757
            +S+GFFA
Sbjct  179  YSIGFFA  185



>ref|XP_008220631.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Prunus mume]
Length=501

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 152/238 (64%), Gaps = 33/238 (14%)
 Frame = +2

Query  98   EKGIASESLTESTHFHTVPLTSLFptth----------chqphtthASKGLRRGASLKVV  247
            EKG A   L E  H HTV + SL P T                + HAS      + LKVV
Sbjct  30   EKGFA---LEEREHAHTVEVNSLLPATTCSSSSSSSSSTKGHMSKHASSSSSSSSVLKVV  86

Query  248  HKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSAR----IDNLNAVSGVGRKKK  406
            HKHG CS     K  TPT   IL QD++RVNSIH+RVNS +    +D+L+          
Sbjct  87   HKHGPCSRLKKQKSKTPTHAQILQQDQARVNSIHSRVNSKKQFKSVDDLSE---------  137

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
               +   +PA+SG+ + +GNYIV VGLG+P K L+L+FDTGSDLTWTQC PCVK+CY Q+
Sbjct  138  --SAATTIPAQSGSVVGSGNYIVNVGLGSPKKQLSLIFDTGSDLTWTQCRPCVKSCYKQK  195

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGFF  754
            E IF+P LS +Y+N+SC++  C+ L+SATGN PGC  S+STC+YGIQYGD SFSVG+F
Sbjct  196  EPIFDPSLSASYANVSCTSPKCTQLSSATGNTPGCAASTSTCIYGIQYGDQSFSVGYF  253



>ref|XP_008220632.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Prunus mume]
Length=497

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 152/238 (64%), Gaps = 33/238 (14%)
 Frame = +2

Query  98   EKGIASESLTESTHFHTVPLTSLFptth----------chqphtthASKGLRRGASLKVV  247
            EKG A   L E  H HTV + SL P T                + HAS      + LKVV
Sbjct  30   EKGFA---LEEREHAHTVEVNSLLPATTCSSSSSSSSSTKGHMSKHASSSSSSSSVLKVV  86

Query  248  HKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSAR----IDNLNAVSGVGRKKK  406
            HKHG CS     K  TPT   IL QD++RVNSIH+RVNS +    +D+L+          
Sbjct  87   HKHGPCSRLKKQKSKTPTHAQILQQDQARVNSIHSRVNSKKQFKSVDDLSE---------  137

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
               +   +PA+SG+ + +GNYIV VGLG+P K L+L+FDTGSDLTWTQC PCVK+CY Q+
Sbjct  138  --SAATTIPAQSGSVVGSGNYIVNVGLGSPKKQLSLIFDTGSDLTWTQCRPCVKSCYKQK  195

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGFF  754
            E IF+P LS +Y+N+SC++  C+ L+SATGN PGC  S+STC+YGIQYGD SFSVG+F
Sbjct  196  EPIFDPSLSASYANVSCTSPKCTQLSSATGNTPGCAASTSTCIYGIQYGDQSFSVGYF  253



>ref|XP_002283470.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Vitis 
vinifera]
Length=490

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 134/187 (72%), Gaps = 17/187 (9%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARV--NSARIDNLN  376
            KG  + ASL+VVHKHG CS     K N+P+ T IL QDESRV SI +R+  N A   NL 
Sbjct  69   KGHDQRASLEVVHKHGPCSKLRPHKANSPSHTQILAQDESRVASIQSRLAKNLAGGSNLK  128

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
            A            SKA +P+KS +TL +GNY+VTVGLG+P + LT +FDTGSDLTWTQCE
Sbjct  129  A------------SKATLPSKSASTLGSGNYVVTVGLGSPKRDLTFIFDTGSDLTWTQCE  176

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PCV  CY Q+E IF+P  S +YSN+SC + +C  L SATGN+PGCSSSTC+YGI+YGD S
Sbjct  177  PCVGYCYQQREHIFDPSTSLSYSNVSCDSPSCEKLESATGNSPGCSSSTCLYGIRYGDGS  236

Query  737  FSVGFFA  757
            +S+GFFA
Sbjct  237  YSIGFFA  243



>ref|XP_004291984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 159/232 (69%), Gaps = 29/232 (13%)
 Frame = +2

Query  98   EKGIA---SESLTESTHFHTVPLTSLFptthchqphtthASKGL-RRGASLKVVHKHGGC  265
            +KG A   +E+  ++T  H + L SL P + C       +++G  R+ ASL+VVH+HG C
Sbjct  28   DKGFALRLTETPADTTKTHLLQLNSLLPASTCSP-----STRGHDRKKASLEVVHRHGPC  82

Query  266  STGKDN-------TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKA  424
            S    +       TPT T+IL QD++RVNSIHARV+  + D+            +  S  
Sbjct  83   SKRNQHKTQTPTPTPTHTEILQQDQARVNSIHARVSPKKGDD-----------DLQQSDT  131

Query  425  AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNP  604
            ++PAKSG+ + +GNYIVTVGLG+P K L+L+FDTGSDLTWTQC+PCVK+CY Q+E IF+P
Sbjct  132  SIPAKSGSVVGSGNYIVTVGLGSPAKQLSLIFDTGSDLTWTQCQPCVKSCYKQKEPIFDP  191

Query  605  KLSTTYSNISCSAAACSGLTSATGNNPGCSS--STCVYGIQYGDSSFSVGFF  754
             LS +Y+NISC++  CS L SATGN PGCSS  STC+YGIQYGD SFSVG+F
Sbjct  192  SLSKSYANISCNSPVCSQLISATGNTPGCSSGTSTCIYGIQYGDQSFSVGYF  243



>emb|CDP19504.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 153/223 (69%), Gaps = 20/223 (9%)
 Frame = +2

Query  101  KGIASE-SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---S  268
            KG A E SL   +++HTV ++S+ P++ C       ++KG  R +SLKVVH+HG C   +
Sbjct  29   KGHALERSLAAESNYHTVHVSSILPSSACKP-----SAKGPSRKSSLKVVHRHGPCHQLN  83

Query  269  TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGT  448
                N  TLT IL++D++RV SI AR ++ R D            KI  SKA +PAKSG 
Sbjct  84   QESSNRETLTQILSEDQTRVKSIQAR-HAFRADT----------DKIRGSKADLPAKSGI  132

Query  449  TLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSN  628
             + TGNY+V+VGLG P KS TL FDTGSDLTWTQCEPCV  C+ Q++ I++P  S++YSN
Sbjct  133  AIGTGNYVVSVGLGTPAKSYTLAFDTGSDLTWTQCEPCVGFCHKQEDPIYDPVKSSSYSN  192

Query  629  ISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            ISC+AA CS L+SATG  PGCS+S C+Y IQYGD SFSVGFFA
Sbjct  193  ISCNAAQCSALSSATGKPPGCSASNCLYLIQYGDLSFSVGFFA  235



>gb|EYU22027.1| hypothetical protein MIMGU_mgv1a005281mg [Erythranthe guttata]
Length=490

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 150/227 (66%), Gaps = 28/227 (12%)
 Frame = +2

Query  116  ESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDN----  283
            E    +T FHT+ ++SL           + AS   ++ ++L+V+HKHG CS    +    
Sbjct  29   EGTKANTQFHTLQISSL---QPASLCTPSTASGSSKKQSTLEVIHKHGPCSILTQDKSST  85

Query  284  ------TPTLTDILNQDESRVNSIHARV--NSARIDNLNAVSGVGRKKKIPDSKAAVPAK  439
                  +P L++IL  D+SRV SI +++  NS + + LN            + K  +PA+
Sbjct  86   TTTAAASPPLSEILTHDQSRVESIQSKLKPNSKKPNKLN------------EKKTNIPAQ  133

Query  440  SGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTT  619
            SG +L +GNY++ +GLG P K+L L+FDTGSDL WTQC+PC ++CYTQ++ IFNP LS +
Sbjct  134  SGKSLGSGNYLIAIGLGTPKKTLNLIFDTGSDLMWTQCQPCARSCYTQKDPIFNPSLSGS  193

Query  620  YSNISCSAAACSGLTSATGNNPGC-SSSTCVYGIQYGDSSFSVGFFA  757
            YSNISCS+A CS LTSATGNNPGC ++STCVYGIQYGD SFSVGFFA
Sbjct  194  YSNISCSSAQCSLLTSATGNNPGCTAASTCVYGIQYGDKSFSVGFFA  240



>ref|XP_011036733.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=490

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 157/225 (70%), Gaps = 16/225 (7%)
 Frame = +2

Query  98   EKGIASE--SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST  271
            EKG A E   + ES H H + ++SL P   C       ++   +  ASLKVVHKHG CS 
Sbjct  30   EKGYALEGRKIAESHHSHFIEVSSLLPPASCKPSTKVLSNNDNK--ASLKVVHKHGPCSK  87

Query  272  GKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAK  439
               N     PT T+IL QD+SRV SIH+R+++++          G+  K+ DS   +PAK
Sbjct  88   LSLNEASAAPTHTEILLQDQSRVKSIHSRLSNSKTSG-------GKDVKVTDS-TTIPAK  139

Query  440  SGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTT  619
             G+T+ +GNYIVTVGLG P K L+L+FDTGSD+TWTQC+PC ++CY Q+E IF+P  ST+
Sbjct  140  DGSTVGSGNYIVTVGLGTPKKDLSLIFDTGSDITWTQCQPCARSCYKQKEQIFDPSQSTS  199

Query  620  YSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y+NISCS++ C+ LTSATGN PGC+SSTCVYGIQYGDSSFSVGFF
Sbjct  200  YTNISCSSSICNSLTSATGNTPGCASSTCVYGIQYGDSSFSVGFF  244



>gb|EYU29201.1| hypothetical protein MIMGU_mgv1a005225mg [Erythranthe guttata]
Length=492

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 148/215 (69%), Gaps = 20/215 (9%)
 Frame = +2

Query  137  HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDNT-------PTL  295
            H+HT+ ++SL P + C        S   +R ++L+V+H+HG CS G +N        P L
Sbjct  44   HYHTLEISSLLPASVCTPSTNFKGSN--KRQSTLEVLHQHGPCSRGPNNPSAATSPPPLL  101

Query  296  TDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
            ++IL+ D+ RV+ I+AR+                K +I   K  +P +SG +L +GNYIV
Sbjct  102  SEILSHDQIRVDKINARIKQTSY----------TKNQIKGKKVNLPVQSGRSLGSGNYIV  151

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            T+GLG P K+L+L+FDTGSDLTWTQC+PCVK+CY QQ+ IFNP  ST+YSN+SC++  CS
Sbjct  152  TLGLGTPQKTLSLIFDTGSDLTWTQCQPCVKSCYQQQDPIFNPSDSTSYSNVSCNSPQCS  211

Query  656  GLTSATGNNPGCS-SSTCVYGIQYGDSSFSVGFFA  757
             L++ATGN+PGC+ ++TCVYGIQYGD SFSVGFF+
Sbjct  212  QLSAATGNSPGCTNAATCVYGIQYGDQSFSVGFFS  246



>ref|XP_004150866.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004157102.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=473

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 146/214 (68%), Gaps = 12/214 (6%)
 Frame = +2

Query  122  LTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDNTPTLTD  301
            L+  +HF TV L  LFP+  C +      +  L   +SL+V+H+HG C     N PT  +
Sbjct  25   LSPDSHFLTVDLAGLFPSASCTRRSPQVHTSSLGEQSSLEVIHRHGPCGDEVSNAPTAAE  84

Query  302  ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKA-AVPAKSGTTLSTGNYIVT  478
            +L +D+SRV+ IH+++ +  +++++ + G         SKA  +PAKSG T+ +GNYIV+
Sbjct  85   MLVKDQSRVDFIHSKI-AGELESVDRLRG---------SKATKIPAKSGATIGSGNYIVS  134

Query  479  VGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSG  658
            VGLG P K L+L+FDTGSDLTWTQC+PC + CY Q++ +F P  STTYSNISCS+  CS 
Sbjct  135  VGLGTPKKYLSLIFDTGSDLTWTQCQPCARYCYNQKDPVFVPSQSTTYSNISCSSPDCSQ  194

Query  659  LTSATGNNPGCSSS-TCVYGIQYGDSSFSVGFFA  757
            L S TGN PGCS++  C+YGIQYGD SFSVG+FA
Sbjct  195  LESGTGNQPGCSAARACIYGIQYGDQSFSVGYFA  228



>ref|XP_002324349.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02914.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=490

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 158/225 (70%), Gaps = 16/225 (7%)
 Frame = +2

Query  98   EKGIASE--SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST  271
            EKG A E   + ES H H++ ++SL P+  C       ++   +  ASLKVVHKHG CS 
Sbjct  30   EKGYALEGRKVAESHHSHSIEVSSLLPSASCKPSTKVLSNNDNK--ASLKVVHKHGPCSK  87

Query  272  GKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAK  439
               +     PT T+IL QD+SRV SIH+R+++++          G+  K+ DS   +PAK
Sbjct  88   LSQDEASAAPTHTEILLQDQSRVKSIHSRLSNSKTSG-------GKDVKVTDS-TTIPAK  139

Query  440  SGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTT  619
             G+T+ +GNYIVTVGLG P K L+L+FDTGSD+TWTQC+PC ++CY Q+E IF+P  ST+
Sbjct  140  DGSTVGSGNYIVTVGLGTPKKDLSLIFDTGSDITWTQCQPCARSCYKQKEQIFDPSQSTS  199

Query  620  YSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y+NISCS++ C+ LTSATGN PGC+SS CVYGIQYGDSSFSVGFF
Sbjct  200  YTNISCSSSICNSLTSATGNTPGCASSACVYGIQYGDSSFSVGFF  244



>emb|CDP11359.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 152/223 (68%), Gaps = 20/223 (9%)
 Frame = +2

Query  101  KGIASE-SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---S  268
            KG A E SL   +++HTV ++S+ P++ C       ++KG  R +SLKVVH+HG C   +
Sbjct  29   KGHALERSLAAESNYHTVHVSSILPSSACKP-----SAKGPSRKSSLKVVHRHGPCHQLN  83

Query  269  TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGT  448
                N  TLT+IL++D++RV SI AR ++ R D            KI  SKA +PAKSG 
Sbjct  84   QESSNRETLTEILSEDQTRVKSIQAR-HAFRADT----------DKIRGSKADLPAKSGI  132

Query  449  TLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSN  628
             + T NY+V+VGLG P KS TLVFDTGSDLTWTQCEPCV  C+ QQ+ I++P  S++YSN
Sbjct  133  AIGTSNYVVSVGLGTPAKSYTLVFDTGSDLTWTQCEPCVIFCHKQQDPIYDPVKSSSYSN  192

Query  629  ISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            ISC+AA CS L+S  G   GCS+S C+YGIQYGD SFS+GFFA
Sbjct  193  ISCNAAQCSALSSTPGTRTGCSASNCLYGIQYGDQSFSIGFFA  235



>ref|XP_008452815.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=475

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 141/213 (66%), Gaps = 10/213 (5%)
 Frame = +2

Query  122  LTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDNTPTLTD  301
            L+  +H+ TV L  LFP+  C +      +  +   +SL+V+H+HG C     N PT  +
Sbjct  27   LSPDSHYLTVELADLFPSASCTRRSPQAHTSSVGEQSSLEVIHRHGPCGDDVSNAPTAAE  86

Query  302  ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTV  481
            +  QD++RV+ IH++  +  +++++ +         P     +PAKSG T+ +GNYIV V
Sbjct  87   MFVQDQARVDFIHSKF-AGELESVDRLR--------PSKATKIPAKSGATIGSGNYIVNV  137

Query  482  GLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGL  661
            GLG P K L+L+FDTGSDLTWTQC+PC + CY Q++ +F P  STTYSNISCS++ CS L
Sbjct  138  GLGTPKKYLSLIFDTGSDLTWTQCQPCARYCYNQKDPVFAPSQSTTYSNISCSSSDCSQL  197

Query  662  TSATGNNPGCSSS-TCVYGIQYGDSSFSVGFFA  757
             S TGN PGCS++  C+YGIQYGD SFSVG+FA
Sbjct  198  ESGTGNQPGCSAARACIYGIQYGDQSFSVGYFA  230



>gb|KDO67377.1| hypothetical protein CISIN_1g011600mg [Citrus sinensis]
Length=454

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 132/194 (68%), Gaps = 22/194 (11%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCSTGKDN-------TPTLT--DILNQDESRVNSIHARV--N  352
            A  G  + +SLKVVHKHG C     N       +P+++  +IL QD+SRV SIH+R+  N
Sbjct  26   ACAGNAKKSSLKVVHKHGPCFKPYSNGEKAASPSPSVSHAEILRQDQSRVKSIHSRLSKN  85

Query  353  SARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGS  532
            S  +D +                A +PAK G+ +  GNYIVTVG+G P K L+L+FDTGS
Sbjct  86   SGSLDEIRQ-----------SDDATLPAKDGSVVGAGNYIVTVGIGTPKKDLSLIFDTGS  134

Query  533  DLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVY  712
            DLTWTQCEPCVK CY Q+E  F+P +S +YSN+SCS+  C+ L SATGN+P C+SSTC+Y
Sbjct  135  DLTWTQCEPCVKYCYEQKEPKFDPTVSQSYSNVSCSSTICTSLQSATGNSPACASSTCLY  194

Query  713  GIQYGDSSFSVGFF  754
            GIQYGDSSFS+GFF
Sbjct  195  GIQYGDSSFSIGFF  208



>gb|KHN12538.1| Aspartic proteinase nepenthesin-2 [Glycine soja]
Length=483

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 136/191 (71%), Gaps = 17/191 (9%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCSTGKDN------TPTLTDILNQDESRVNSIHARVNSARIDN  370
            +KG +  ASL+VVHKHG CS   D+      T   +DILNQD+ RV  I++R++     N
Sbjct  63   TKGPKTKASLEVVHKHGPCSQLNDHDGKAKSTTPHSDILNQDKERVKYINSRLSK----N  118

Query  371  LNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQ  550
            L   S V          A +PAKSG+ + +GNY V VGLG P + L+L+FDTGSDLTWTQ
Sbjct  119  LGQDSSVEELDS-----ATLPAKSGSLIGSGNYFVVVGLGTPKRDLSLIFDTGSDLTWTQ  173

Query  551  CEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQY  724
            CEPC ++CY QQ+ IF+P  ST+YSNI+C++A C+ L++ATGN+PGCS+ST  C+YGIQY
Sbjct  174  CEPCARSCYKQQDVIFDPSKSTSYSNITCTSALCTQLSTATGNDPGCSASTKACIYGIQY  233

Query  725  GDSSFSVGFFA  757
            GDSSFSVG+F+
Sbjct  234  GDSSFSVGYFS  244



>ref|XP_003551807.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=490

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 136/191 (71%), Gaps = 17/191 (9%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCSTGKDN------TPTLTDILNQDESRVNSIHARVNSARIDN  370
            +KG +  ASL+VVHKHG CS   D+      T   +DILNQD+ RV  I++R++     N
Sbjct  63   TKGPKTKASLEVVHKHGPCSQLNDHDGKAKSTTPHSDILNQDKERVKYINSRLSK----N  118

Query  371  LNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQ  550
            L   S V          A +PAKSG+ + +GNY V VGLG P + L+L+FDTGSDLTWTQ
Sbjct  119  LGQDSSVEELDS-----ATLPAKSGSLIGSGNYFVVVGLGTPKRDLSLIFDTGSDLTWTQ  173

Query  551  CEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQY  724
            CEPC ++CY QQ+ IF+P  ST+YSNI+C++A C+ L++ATGN+PGCS+ST  C+YGIQY
Sbjct  174  CEPCARSCYKQQDVIFDPSKSTSYSNITCTSALCTQLSTATGNDPGCSASTKACIYGIQY  233

Query  725  GDSSFSVGFFA  757
            GDSSFSVG+F+
Sbjct  234  GDSSFSVGYFS  244



>ref|XP_003532146.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Glycine max]
Length=488

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 19/192 (10%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCST-------GKDNTPTLTDILNQDESRVNSIHARVNSARID  367
            +KG +R ASL+VVHKHG CS         K  TP  ++ILNQD+ RV  I++R++     
Sbjct  62   AKGPKRKASLEVVHKHGPCSQLNNHDGKAKSKTPH-SEILNQDKERVKYINSRISK----  116

Query  368  NLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWT  547
            NL   S V     +      +PAKSG+ + +GNY V VGLG P + L+L+FDTGSDLTWT
Sbjct  117  NLGQDSSVSELDSV-----TLPAKSGSLIGSGNYFVVVGLGTPKRDLSLIFDTGSDLTWT  171

Query  548  QCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQ  721
            QCEPC ++CY QQ+ IF+P  ST+YSNI+C++  C+ L++ATGN PGCS+ST  C+YGIQ
Sbjct  172  QCEPCARSCYKQQDAIFDPSKSTSYSNITCTSTLCTQLSTATGNEPGCSASTKACIYGIQ  231

Query  722  YGDSSFSVGFFA  757
            YGDSSFSVG+F+
Sbjct  232  YGDSSFSVGYFS  243



>gb|KDO67374.1| hypothetical protein CISIN_1g011556mg [Citrus sinensis]
Length=483

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 131/187 (70%), Gaps = 11/187 (6%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLN  376
            ++K   R A+LKVVHKHG C+    G    P+  +IL QD+SRVNSIH++   ++     
Sbjct  56   STKANERKATLKVVHKHGPCNKLDGGNAKFPSQAEILQQDQSRVNSIHSKSRLSK-----  110

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
              + VG   K  D+   +PAK G+ ++TG+Y+VTVG+G P K L+LVFDTGSDLTWTQCE
Sbjct  111  --NSVGADVKETDA-TTIPAKDGSVVATGDYVVTVGIGTPKKDLSLVFDTGSDLTWTQCE  167

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PC++ CY Q+E I++P  S TY+N+SCS+A C  L S TG  P C+ STCVYGI+YGD+S
Sbjct  168  PCLRFCYQQKEPIYDPSASRTYANVSCSSAICDSLESGTGMTPQCAGSTCVYGIEYGDNS  227

Query  737  FSVGFFA  757
            FS GFFA
Sbjct  228  FSAGFFA  234



>ref|XP_006483510.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=483

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 131/187 (70%), Gaps = 11/187 (6%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLN  376
            ++K   R A+LKVVHKHG C+    G    P+  +IL QD+SRVNSIH++   ++     
Sbjct  56   STKANERKATLKVVHKHGPCNKLDGGNAKFPSQAEILQQDQSRVNSIHSKSRLSK-----  110

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
              + VG   K  D+   +PAK G+ ++TG+Y+VTVG+G P K L+LVFDTGSDLTWTQCE
Sbjct  111  --NSVGADVKETDA-TTIPAKDGSVVATGDYVVTVGIGTPKKDLSLVFDTGSDLTWTQCE  167

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PC++ CY Q+E I++P  S TY+N+SCS+A C  L S TG  P C+ STCVYGI+YGD+S
Sbjct  168  PCLRFCYQQKEPIYDPSASRTYANVSCSSAICDSLESGTGMAPQCAGSTCVYGIEYGDNS  227

Query  737  FSVGFFA  757
            FS GFFA
Sbjct  228  FSAGFFA  234



>gb|KJB55134.1| hypothetical protein B456_009G064800 [Gossypium raimondii]
Length=483

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 147/229 (64%), Gaps = 31/229 (14%)
 Frame = +2

Query  104  GIASESLTESTHF---HTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST-  271
            G+   +  ES H    HT+ +TSL P++ C       A+K L + +SL+VVHKHG CS  
Sbjct  29   GLERRATAESHHLEHSHTIQVTSLLPSSICSP-----ATKELNKKSSLRVVHKHGPCSQL  83

Query  272  ---GKDNTPTLTDILNQDESRVNSIHARV----NSARIDNLNAVSGVGRKKKIPDSKAAV  430
                K N PT  +IL QDE+RV SIH ++     S+ +D ++A +              +
Sbjct  84   HRQDKANIPTDAEILRQDEARVKSIHLKLARSSGSSNVDQIDATN--------------L  129

Query  431  PAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKL  610
            PAK G+ + +GNY+VTVGLG P K LTL+FDTGSD+TWTQC+PC  +CY Q + +F P  
Sbjct  130  PAKDGSVVGSGNYVVTVGLGTPKKDLTLIFDTGSDITWTQCQPCAGSCYQQLDPVFAPSQ  189

Query  611  STTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            S+TYSNISC++  C+ L SATG  P CSS+ CVYGIQYGD SFS+GFFA
Sbjct  190  SSTYSNISCNSTTCNSLASATGIKPRCSSA-CVYGIQYGDMSFSIGFFA  237



>gb|KJB65924.1| hypothetical protein B456_010G120300 [Gossypium raimondii]
Length=480

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 140/186 (75%), Gaps = 12/186 (6%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNA  379
            +KGL + +SL+V+HKHG CS     K N PT   IL  DE RV SIH+++      NL +
Sbjct  58   AKGLDKKSSLQVIHKHGPCSQPHEEKANIPTHAQILLLDEVRVKSIHSKLA----KNLGS  113

Query  380  VSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
            V+ + +     D+ A +PAK G+ + +GNYI+T+GLG P K+L L+FDTGSD+TWTQC+P
Sbjct  114  VNVMKK-----DAAANLPAKDGSVVGSGNYIITMGLGTPKKNLRLIFDTGSDITWTQCQP  168

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            C+++CY QQ+ IF+P  S+TYSN+SCS+AAC+ L SATGN+PGCSSSTCVYGIQYGDSSF
Sbjct  169  CLRSCYKQQDPIFSPSSSSTYSNVSCSSAACTSLNSATGNSPGCSSSTCVYGIQYGDSSF  228

Query  740  SVGFFA  757
            S+G FA
Sbjct  229  SIGLFA  234



>emb|CAB96832.1| nucleoid DNA-binding protein cnd41-like protein [Arabidopsis 
thaliana]
Length=446

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (71%), Gaps = 15/180 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS    GK  +P   +IL  D++RVNSIH++++     +          
Sbjct  32   SSLHVTHRHGTCSRLNNGKATSPDHVEILRLDQARVNSIHSKLSKKLATD----------  81

Query  401  KKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
              + +SK+  +PAK G+TL +GNYIVTVGLG P   L+L+FDTGSDLTWTQC+PCV+TCY
Sbjct  82   -HVSESKSTDLPAKDGSTLGSGNYIVTVGLGTPKNDLSLIFDTGSDLTWTQCQPCVRTCY  140

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             Q+E IFNP  ST+Y N+SCS+AAC  L+SATGN   CS+S C+YGIQYGD SFSVGF A
Sbjct  141  DQKEPIFNPSKSTSYYNVSCSSAACGSLSSATGNAGSCSASNCIYGIQYGDQSFSVGFLA  200



>ref|XP_007146522.1| hypothetical protein PHAVU_006G048000g [Phaseolus vulgaris]
 gb|ESW18516.1| hypothetical protein PHAVU_006G048000g [Phaseolus vulgaris]
Length=481

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 129/187 (69%), Gaps = 13/187 (7%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCSTGKDNTPTLT--DILNQDESRVNSIHARVNSARIDNLNAV  382
            +K  RR  SL+VVHK+G CS   D    +T  DILN D+ RV  IH+R++          
Sbjct  59   TKDSRRKGSLEVVHKYGPCSQQNDGDRKVTHSDILNVDKERVKYIHSRISKEL-------  111

Query  383  SGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPC  562
             G G   K  DS A +PAKSG+ + +GNY V VGLG P K L+L+FDTGSDLTWTQC PC
Sbjct  112  -GGGDSLKELDS-ATLPAKSGSLIGSGNYFVVVGLGTPKKDLSLIFDTGSDLTWTQCRPC  169

Query  563  VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS--SSTCVYGIQYGDSS  736
             ++CY QQ+ IF+P  S++YSNI+C++  C+ L+SATGNNPGCS  S  C+YGIQYGD S
Sbjct  170  ARSCYDQQDPIFDPSKSSSYSNITCTSTLCTQLSSATGNNPGCSAVSKACIYGIQYGDQS  229

Query  737  FSVGFFA  757
            FSVG+F+
Sbjct  230  FSVGYFS  236



>ref|XP_006287637.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
 gb|EOA20535.1| hypothetical protein CARUB_v10000848mg [Capsella rubella]
Length=481

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 127/179 (71%), Gaps = 13/179 (7%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS    GK   P   +IL  D++RVNSIH++++     N      VG+ 
Sbjct  67   SSLHVTHRHGTCSPLNNGKATRPDHVEILKLDQARVNSIHSKLSKKLTTN-----HVGQS  121

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
            +        +PAK G+TL +GNYIVTVGLG P   L+L+FDTGSDLTWTQCEPCV+TCY+
Sbjct  122  QS-----TDLPAKDGSTLGSGNYIVTVGLGTPKHDLSLIFDTGSDLTWTQCEPCVRTCYS  176

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IFNP  S++Y N+SCS+ AC+ L+SATGN   CS+STC+YGIQYGD SFSVGF A
Sbjct  177  QKEPIFNPSKSSSYYNVSCSSPACTSLSSATGNAGSCSASTCIYGIQYGDQSFSVGFLA  235



>ref|NP_196638.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAL77663.1| AT5g10770/T30N20_40 [Arabidopsis thaliana]
 gb|AAN46758.1| At5g10770/T30N20_40 [Arabidopsis thaliana]
 gb|AED91594.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=474

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (71%), Gaps = 15/180 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS    GK  +P   +IL  D++RVNSIH++++     +          
Sbjct  60   SSLHVTHRHGTCSRLNNGKATSPDHVEILRLDQARVNSIHSKLSKKLATD----------  109

Query  401  KKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
              + +SK+  +PAK G+TL +GNYIVTVGLG P   L+L+FDTGSDLTWTQC+PCV+TCY
Sbjct  110  -HVSESKSTDLPAKDGSTLGSGNYIVTVGLGTPKNDLSLIFDTGSDLTWTQCQPCVRTCY  168

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             Q+E IFNP  ST+Y N+SCS+AAC  L+SATGN   CS+S C+YGIQYGD SFSVGF A
Sbjct  169  DQKEPIFNPSKSTSYYNVSCSSAACGSLSSATGNAGSCSASNCIYGIQYGDQSFSVGFLA  228



>ref|XP_010491758.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010491759.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
Length=494

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 127/187 (68%), Gaps = 16/187 (9%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCST----GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNA  379
            +  R  +SL V H+HG CS     GK   P   +IL  D+SRVNSIH++++     N   
Sbjct  73   RATRTKSSLHVTHRHGTCSPLNNGGKATRPDHVEILKLDQSRVNSIHSKLSKKLTTN---  129

Query  380  VSGVGRKKKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
                     +  S++  +PAK G+TL +GNYIVTVG+G P   L+L+FDTGSDLTWTQCE
Sbjct  130  --------HVSQSQSTDLPAKDGSTLGSGNYIVTVGVGTPKHDLSLIFDTGSDLTWTQCE  181

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PCV+TCY Q+E IFNP  ST+Y N+SCS+AAC  L+SATGN   CS+S C+YGIQYGD S
Sbjct  182  PCVRTCYDQKEPIFNPSKSTSYYNVSCSSAACGSLSSATGNAGSCSASNCIYGIQYGDQS  241

Query  737  FSVGFFA  757
            FSVGF A
Sbjct  242  FSVGFLA  248



>ref|XP_010422809.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=494

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 140/221 (63%), Gaps = 20/221 (9%)
 Frame = +2

Query  110  ASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS----TGK  277
            A ES  + T+ HT+ ++S              + +  +  +SL V H+HG CS     GK
Sbjct  43   AQESEKKETYSHTIEVSS----LFPSSSSCVLSPRATKTKSSLHVTHRHGTCSPLNHNGK  98

Query  278  DNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAA-VPAKSGTTL  454
               P   +IL  D+SRVNSIH++++     N            +  S++  +PAK G+TL
Sbjct  99   ATRPDHVEILKLDQSRVNSIHSKLSKKLTTN-----------HVSQSQSTDLPAKDGSTL  147

Query  455  STGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNIS  634
             +GNYIVTVG+G P   L+L+FDTGSDLTWTQCEPCV+TCY Q+E IFNP  ST+Y N+S
Sbjct  148  GSGNYIVTVGVGTPKHDLSLIFDTGSDLTWTQCEPCVRTCYDQKEPIFNPSKSTSYYNVS  207

Query  635  CSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            CS+AAC  L+SATGN   CS+S C+YGIQYGD SFSVGF A
Sbjct  208  CSSAACGSLSSATGNGGSCSASNCIYGIQYGDQSFSVGFLA  248



>gb|KHG03216.1| Asparticase nepenthesin-2 [Gossypium arboreum]
Length=480

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 139/186 (75%), Gaps = 12/186 (6%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNA  379
            +KGL + +SL+V+HKHG CS     K N PT   IL  DE RV SIH+++      NL +
Sbjct  58   AKGLDKKSSLQVIHKHGPCSQLHEEKANIPTHAQILLLDEVRVKSIHSKLA----KNLGS  113

Query  380  VSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
            V+ + +     D+ A +PAK G+ + +GNYIVT GLG P  +L L+FDTGSD+TWTQC+P
Sbjct  114  VNVMKK-----DAAANLPAKDGSMVGSGNYIVTTGLGTPKNNLRLIFDTGSDITWTQCQP  168

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            C+++CY QQ+ IF+P  S+TYSN+SCS+AAC+ L SATGN+PGCSSSTCVYGI+YGDSSF
Sbjct  169  CLRSCYKQQDPIFSPSSSSTYSNVSCSSAACTSLNSATGNSPGCSSSTCVYGIEYGDSSF  228

Query  740  SVGFFA  757
            S+GFFA
Sbjct  229  SIGFFA  234



>gb|AHA84134.1| aspartic proteinase nepenthesin-1 [Phaseolus vulgaris]
Length=481

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 128/186 (69%), Gaps = 13/186 (7%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCSTGKDNTPTLT--DILNQDESRVNSIHARVNSARIDNLNAV  382
            +K  RR  SL+VVHK+G CS   D    +T  DILN D+ RV  IH+R++          
Sbjct  59   TKDSRRKGSLEVVHKYGPCSQQNDGDRKVTHSDILNVDKERVKYIHSRISKEL-------  111

Query  383  SGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPC  562
             G G   K  DS A +PAKSG+ + +GNY V VGLG P K L+L+FDTGSDLTWTQC+PC
Sbjct  112  -GGGDSLKELDS-ATLPAKSGSLIGSGNYFVVVGLGTPKKDLSLIFDTGSDLTWTQCQPC  169

Query  563  VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS--SSTCVYGIQYGDSS  736
             ++CY QQ+ IF+P  S++YSNI+C++  C+ L+SATGNNPGCS  S  C+YGIQYGD S
Sbjct  170  ARSCYDQQDPIFDPSKSSSYSNITCTSTLCTQLSSATGNNPGCSAVSKACIYGIQYGDQS  229

Query  737  FSVGFF  754
             SVG+F
Sbjct  230  LSVGYF  235



>ref|XP_002873476.1| hypothetical protein ARALYDRAFT_325615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49735.1| hypothetical protein ARALYDRAFT_325615 [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 15/180 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS    GK  +P   +IL  D++RVNSIH++++     N          
Sbjct  61   SSLHVTHRHGTCSRLNNGKATSPDHVEILRLDQARVNSIHSKLSKKLTTN----------  110

Query  401  KKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
              +  S++  +PAK G+TL +GNYIVTVGLG P   L+L+FDTGSDLTWTQC+PCV+TCY
Sbjct  111  -HVSQSQSTDLPAKDGSTLGSGNYIVTVGLGTPKNDLSLIFDTGSDLTWTQCQPCVRTCY  169

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             Q+E IFNP  ST+Y N+SCS+AAC  L+SATGN   CS+S C+YGIQYGD SFSVGF A
Sbjct  170  DQKEPIFNPSKSTSYYNVSCSSAACGSLSSATGNAGSCSASNCIYGIQYGDQSFSVGFLA  229



>ref|XP_010453111.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=477

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 16/181 (9%)
 Frame = +2

Query  230  ASLKVVHKHGGCST----GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL V H+HG CS     GK   P   +IL  D+SRVNSIH++++     N         
Sbjct  62   SSLHVTHRHGTCSPLNNGGKATRPDHVEILKLDQSRVNSIHSKLSKKLTTN---------  112

Query  398  KKKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
               +  S++  +PAK G+TL +GNYIVTVG+G P   L+L+FDTGSDLTWTQCEPCV+TC
Sbjct  113  --HVSQSQSTDLPAKDGSTLGSGNYIVTVGVGTPKHDLSLIFDTGSDLTWTQCEPCVRTC  170

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y Q+E IFNP  ST+Y N+SCS+AAC  L+SATGN   CS+S C+YGIQYGD SFSVGF 
Sbjct  171  YDQKEPIFNPSKSTSYYNVSCSSAACGSLSSATGNAGSCSASNCIYGIQYGDQSFSVGFL  230

Query  755  A  757
            A
Sbjct  231  A  231



>ref|XP_002515388.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46837.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=494

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 136/213 (64%), Gaps = 15/213 (7%)
 Frame = +2

Query  122  LTESTHFHT-VPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKD-NTPTL  295
              ES H HT + LTSL P   C       +   +   A LKVVHKHG CS  +  +    
Sbjct  49   FAESQHTHTTIHLTSLLPAASCKPSTQVPS---IENKAFLKVVHKHGPCSDLRQGHKAEA  105

Query  296  TDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
              IL QD+SRV+SIH++        L+  SG+   K    +   +PAK G+ + +GNY V
Sbjct  106  QYILLQDQSRVDSIHSK--------LSKDSGLSDVKAT--AATTLPAKDGSIIGSGNYFV  155

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            TVGLG P K  +L+FDTGSDLTWTQCEPCVK+CY Q+E IFNP  ST+Y+NISC +  C 
Sbjct  156  TVGLGTPKKDFSLIFDTGSDLTWTQCEPCVKSCYNQKEAIFNPSQSTSYANISCGSTLCD  215

Query  656  GLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
             L SATGN   C+SSTCVYGIQYGDSSFS+GFF
Sbjct  216  SLASATGNIFNCASSTCVYGIQYGDSSFSIGFF  248



>ref|XP_006483727.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=458

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 153/224 (68%), Gaps = 23/224 (10%)
 Frame = +2

Query  107  IASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---STGK  277
            + +ES  E  H HT+ L+SL P++ C       ++K     +SLKVVH+HG C   +  K
Sbjct  6    VTTESQHELQHLHTIQLSSLLPSSVCKP-----STKANESDSSLKVVHRHGPCFKPNGEK  60

Query  278  DNTPTLTDILNQDESRVNSIHARVN---SARIDNLNAVSGVGRKKKIPDSKAAVPAKSGT  448
               P+ T+IL QD+SRVNSIH++++   SAR+D +        K+K     A +PA  G+
Sbjct  61   GKWPSHTEILLQDQSRVNSIHSKLSAKTSARLDKM--------KEK---GAATLPAIHGS  109

Query  449  TLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSN  628
             + +GNYIVTVG+G P +  +L+FDTGSDLTWTQC+PCV  CY Q+E IF+PK S +Y N
Sbjct  110  VVGSGNYIVTVGIGTPKRKFSLIFDTGSDLTWTQCKPCVGFCYQQKEKIFDPKRSKSYRN  169

Query  629  ISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFSVGFFA  757
            +SCS+  CS L SATGN PGC+S+ TCVYGIQYGDSSFSVGFFA
Sbjct  170  VSCSSTVCSSLESATGNIPGCASNKTCVYGIQYGDSSFSVGFFA  213



>ref|XP_009359073.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2-like [Pyrus x bretschneideri]
Length=497

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 129/177 (73%), Gaps = 8/177 (5%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLT--DILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            LKVVHKHG CS   K+ + TLT   ILNQD++RV+SIH+R N   I+   + + VG+ + 
Sbjct  79   LKVVHKHGPCSRINKNKSKTLTHAQILNQDQARVDSIHSRFN---INKSPSTTTVGKPR-  134

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
             P +   +PA+SG+ + +GNYIV VGLG+P K L+L+FDTGSDLTWTQC PC  +CY Q+
Sbjct  135  -PSAATTIPAQSGSVVGSGNYIVNVGLGSPKKQLSLIFDTGSDLTWTQCRPCAGSCYDQK  193

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IF+P  S +Y N+SC++A CS L SATG +P CS+STC+Y IQYGD SFSVG+  
Sbjct  194  EPIFDPATSASYVNVSCNSATCSQLASATGYSPRCSTSTCIYTIQYGDRSFSVGYLG  250



>ref|XP_008377499.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=497

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 126/188 (67%), Gaps = 26/188 (14%)
 Frame = +2

Query  236  LKVVHKHGGC---------STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG C         S   D    LT ILNQDE+RVNSIH+  N            
Sbjct  71   LKVVHKHGPCNQVHQSKSNSNPADQDEYLTQILNQDEARVNSIHSHFNYPN---------  121

Query  389  VGRKKKIPDSKA-----AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
              +K +IPD  A      +PA+SG+ L +GNYIV+VGLG+P K L+LVFDTGS LTWTQC
Sbjct  122  --KKYRIPDLLAHSDATVIPAQSGSVLGSGNYIVSVGLGSPQKQLSLVFDTGSSLTWTQC  179

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDS  733
             PC  +CY Q++ IF+P LST+YSNISC++ ACS L +A+G   GCS+STCVYG QYGD 
Sbjct  180  RPCSVSCYQQKDPIFDPSLSTSYSNISCNSPACSQL-AASGVXSGCSASTCVYGZQYGDR  238

Query  734  SFSVGFFA  757
            SF++GFFA
Sbjct  239  SFTIGFFA  246



>ref|XP_010049847.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW82644.1| hypothetical protein EUGRSUZ_C04028 [Eucalyptus grandis]
Length=483

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 139/207 (67%), Gaps = 11/207 (5%)
 Frame = +2

Query  143  HTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQ  313
            HT+ ++SL P + C    T       R  + L+VVHKHG C+       N PT   IL +
Sbjct  37   HTIQVSSLLPESSCKSSLTPQQDDDKR--SKLRVVHKHGPCNQLVQDTANAPTHEQILLR  94

Query  314  DESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGN  493
            D+SRV SI +R +          +      ++ DSKA +PA SG+T+  GNYIVTVGLG 
Sbjct  95   DQSRVKSIQSRFSK------TTSTITSETNRVRDSKANLPALSGSTVGAGNYIVTVGLGT  148

Query  494  PTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSAT  673
            P K L+L+FDTGSDLTWTQCEPCVK CY Q+E  FNP LS +Y+NISCS++ CS L SAT
Sbjct  149  PKKDLSLIFDTGSDLTWTQCEPCVKYCYKQKEPTFNPSLSASYTNISCSSSLCSALISAT  208

Query  674  GNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            GN PGC+SSTCVYGIQYGDSSFSVGFF
Sbjct  209  GNTPGCTSSTCVYGIQYGDSSFSVGFF  235



>ref|XP_008357233.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=600

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 124/176 (70%), Gaps = 8/176 (5%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLT--DILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            LKVVHKHG CS   K+ + TLT   ILNQD++RV+SIH+  N+ +  +   V      K 
Sbjct  182  LKVVHKHGPCSRINKNKSKTLTHAQILNQDQARVDSIHSLFNTNKSPSTTTVG-----KP  236

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
             P + A +PAKSG+ L +GNYIV VGLG+P K L+L+FDTGSDLTWTQC PC  +CY Q+
Sbjct  237  XPSAAATIPAKSGSVLGSGNYIVNVGLGSPKKQLSLIFDTGSDLTWTQCRPCAGSCYDQK  296

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            E IF+P  S +Y N+SC +A CS L SATG NP C +STC+Y I YGD SFSVG+F
Sbjct  297  EPIFDPATSASYVNVSCXSATCSQLASATGYNPRCYTSTCIYTIGYGDRSFSVGYF  352



>ref|XP_010108296.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18776.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=491

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 131/181 (72%), Gaps = 10/181 (6%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPTLTD---ILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            ASLKVVHKHG CS    ++ T  D   IL QD+SRV SIHAR+      +    +  GR 
Sbjct  68   ASLKVVHKHGPCSQVHQDSITTHDHTQILQQDQSRVKSIHARLAK---KSATTAAATGRI  124

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             +       +PAKSG  + +GNYIVTVGLG P + L+L+FDTGSDLTWTQC+PC K+CY+
Sbjct  125  HQ--QDATTIPAKSGAVVGSGNYIVTVGLGTPKRDLSLIFDTGSDLTWTQCQPCAKSCYS  182

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS--STCVYGIQYGDSSFSVGFF  754
            Q+ETIF+P  S++YSN+SC++A CS L SATGN P CSS  STCVYGIQYGDSSFSVG+F
Sbjct  183  QKETIFDPSKSSSYSNVSCTSADCSQLKSATGNTPSCSSVTSTCVYGIQYGDSSFSVGYF  242

Query  755  A  757
            A
Sbjct  243  A  243



>ref|XP_008223730.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=497

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 124/183 (68%), Gaps = 12/183 (7%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCS----TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            ++ + LKVVHKHG CS    + K+N PT T+IL QD++RVNSIH+R N  +         
Sbjct  72   KKASVLKVVHKHGPCSHFYQSHKENAPTHTEILEQDQARVNSIHSRRNPKK--------A  123

Query  389  VGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK  568
            + R+ +       VPA SG+T+  GNYIVTVGLG P K L+L FDTGSDLTWTQC PCV+
Sbjct  124  IDRRGQRQWDGVTVPALSGSTVGGGNYIVTVGLGTPKKQLSLTFDTGSDLTWTQCRPCVR  183

Query  569  TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVG  748
             CY Q + IF+P +S++Y+N+SC++  CS L S TG  P C++STCVY   YGD S S G
Sbjct  184  PCYKQVDPIFDPSVSSSYANVSCNSMECSKLKSGTGYAPSCATSTCVYAAAYGDGSISAG  243

Query  749  FFA  757
            FFA
Sbjct  244  FFA  246



>gb|KEH33912.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=486

 Score =   197 bits (501),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 153/227 (67%), Gaps = 14/227 (6%)
 Frame = +2

Query  98   EKGIASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST--  271
            EK  A E   E  H H V ++SL P+T C       ++KG +  ASL+V+HKHG CS   
Sbjct  22   EKSFAIERTLEERH-HLVQISSLLPSTSCSS-----STKGTKTKASLEVLHKHGPCSQVN  75

Query  272  -GKDNT-PTLTDILNQDESRVNSIHARV-NSARIDNLNAVSGVGRKKKIPDSKAAVPAKS  442
             GK    P  +DIL+ D+ RVN IH+++ +S + +NL  +    +  K     A +PAKS
Sbjct  76   NGKAKIIPAHSDILDHDKERVNYIHSKLLSSIKNNNLEGLDSKSKSIKS-RKSANLPAKS  134

Query  443  GTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTY  622
            G+ + +GNY V +GLG P K L+L+FDTGSDLTWTQC+PCV +CY QQ+ I++P  ST+Y
Sbjct  135  GSLIGSGNYFVVLGLGTPKKDLSLIFDTGSDLTWTQCQPCVGSCYKQQDEIYDPTKSTSY  194

Query  623  SNISCSAAACSGLTSATGNNPGCS--SSTCVYGIQYGDSSFSVGFFA  757
             NI+C+++ C+ L+SATGN+P C+  S+ CVYGIQYGD SFSVG+F+
Sbjct  195  YNITCTSSDCTQLSSATGNDPRCAKVSNACVYGIQYGDQSFSVGYFS  241



>ref|XP_007226774.1| hypothetical protein PRUPE_ppa018129mg [Prunus persica]
 gb|EMJ27973.1| hypothetical protein PRUPE_ppa018129mg [Prunus persica]
Length=461

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 128/183 (70%), Gaps = 12/183 (7%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCS----TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            ++ + LKVVHKHG CS    + K+N PT T IL QD++RVNSIH+R N  +     A+  
Sbjct  36   KKASVLKVVHKHGPCSHFNQSHKENAPTHTQILEQDQARVNSIHSRRNPKK-----AIDR  90

Query  389  VGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK  568
             G++++  DS   VPA SG+T+   +YIVTVGLG P K L+L FDTGSDLTWTQC PC++
Sbjct  91   RGQRQR--DS-TTVPALSGSTVGAADYIVTVGLGTPKKQLSLTFDTGSDLTWTQCRPCIR  147

Query  569  TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVG  748
             CY Q + IF+P +S++Y+N+SC++  CS L S TG  P C++STCVY   YGD S SVG
Sbjct  148  PCYKQVDPIFDPSVSSSYANVSCNSVVCSQLKSGTGYAPACATSTCVYTTTYGDGSISVG  207

Query  749  FFA  757
            FFA
Sbjct  208  FFA  210



>ref|XP_010256102.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 124/185 (67%), Gaps = 19/185 (10%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCS----TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNA  379
            KG  R  +L+VVHK+G CS      K  +  L+ IL QDE RV SI              
Sbjct  65   KGSSRSRTLQVVHKNGPCSPLDLQKKTRSYNLSQILGQDEQRVRSIQ-------------  111

Query  380  VSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
             S + +++ + DSKA +PAKSG +  TGNY+VTVG G P + L++VFDTGSDLTW QC+P
Sbjct  112  -STISQQQLVEDSKAKIPAKSGRSFGTGNYVVTVGFGTPKRDLSVVFDTGSDLTWIQCQP  170

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            CV +CY Q E IFNP  S+TYSNISC +A C+ L SATGN+P C  STC+Y IQYGDSS+
Sbjct  171  CVVSCYQQTEPIFNPPTSSTYSNISCGSAECAQLKSATGNSPSC-RSTCIYAIQYGDSSY  229

Query  740  SVGFF  754
            S+G+F
Sbjct  230  SIGYF  234



>ref|XP_004513892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=494

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 130/189 (69%), Gaps = 21/189 (11%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCS---TGKDNT-PTLTDILNQDESRVNSIHARVNSARIDNLN  376
            +KG +  ASL VVHKHG CS    GK    PT  DILN D+ RVN IH +++        
Sbjct  75   NKGPKNKASLNVVHKHGPCSQLNNGKTKILPTHNDILNIDKERVNYIHNKIS--------  126

Query  377  AVSGVGRKKKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
                  +KK + +  ++ +PAKSG+ + +GNY V VGLG+P + L+L+FDTGSDLTWTQC
Sbjct  127  ------KKKNMEELDSSNLPAKSGSLIGSGNYFVVVGLGSPKRDLSLIFDTGSDLTWTQC  180

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYG  727
            +PC ++CY QQ+ I++P  ST+Y NI+C+ + C+ L++ATGN PGC+  T  C+YGIQYG
Sbjct  181  QPCARSCYKQQDEIYDPSKSTSYQNITCTTSECTQLSTATGNEPGCAKLTNACIYGIQYG  240

Query  728  DSSFSVGFF  754
            D SFSVG+F
Sbjct  241  DQSFSVGYF  249



>gb|KDP33485.1| hypothetical protein JCGZ_07056 [Jatropha curcas]
Length=493

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 143/214 (67%), Gaps = 20/214 (9%)
 Frame = +2

Query  122  LTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---STGKDNTPT  292
            L    H HT+ L+SL P+  C        SKG    ASLKVVHKHG C   +  K   PT
Sbjct  51   LFHQQHTHTIQLSSLLPSASCKPST----SKGAENKASLKVVHKHGPCFELNQEKSRIPT  106

Query  293  LTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYI  472
               IL +D+SRVNSIH+++++   D            K+ DS   +PAK G+T+ +GNYI
Sbjct  107  HEQILQKDQSRVNSIHSKLSNYNND-----------PKVTDS-TTLPAKDGSTVGSGNYI  154

Query  473  VTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAAC  652
            V+VGLG P K L+L+FDTGSDLTWTQC+PC+++CY Q+E IF+P  ST+YSNISC +  C
Sbjct  155  VSVGLGTPAKYLSLIFDTGSDLTWTQCQPCLRSCYQQKEPIFDPSSSTSYSNISCGSTLC  214

Query  653  SGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            + L SATGN   CSS+ C+YGIQYGDSSFSVG+F
Sbjct  215  NSLASATGNTVSCSSA-CIYGIQYGDSSFSVGYF  247



>ref|XP_010555463.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=478

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 8/179 (4%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V+H HG CS   +GK+  P   +IL +D++RV+S HA+++            V ++
Sbjct  59   SSLHVMHAHGTCSHLSSGKNAIPDRVEILKRDQARVDSFHAKLSKTTKTATRNADRVRQR  118

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
            K      A +PAK G+T+ +GNYIVTVG+G P K L+L+FDTGSDLTWTQCEPCV+TCY+
Sbjct  119  KS-----ADLPAKDGSTIGSGNYIVTVGIGTPKKDLSLIFDTGSDLTWTQCEPCVRTCYS  173

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IFNP  S++Y N+SCS+A C  L+SATGN+  CSSSTCVYGIQYGD SFSVGF A
Sbjct  174  QKEPIFNPSSSSSYYNVSCSSAVCGALSSATGNSGSCSSSTCVYGIQYGDQSFSVGFLA  232



>ref|XP_004513891.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=478

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 130/189 (69%), Gaps = 21/189 (11%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCS---TGKDNT-PTLTDILNQDESRVNSIHARVNSARIDNLN  376
            +KG +  ++L V+HKHG CS    GK    PT  DILN D+ RVN IH +++        
Sbjct  59   TKGPKTKSTLDVIHKHGPCSQLNNGKTKILPTHNDILNIDKERVNYIHNKIS--------  110

Query  377  AVSGVGRKKKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
                  + KK+ +  ++ +PAKSG+ + +GNY V VGLG+P + L+L+FDTGSDLTWTQC
Sbjct  111  ------KNKKMEELDSSNLPAKSGSLIGSGNYFVVVGLGSPKRDLSLIFDTGSDLTWTQC  164

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYG  727
            +PC ++CY QQ+ I++P  ST+Y NI+C+ + C+ L++ATGN PGC+  T  C+YGIQYG
Sbjct  165  QPCARSCYKQQDEIYDPSKSTSYQNITCTTSECTQLSTATGNEPGCAKLTNACIYGIQYG  224

Query  728  DSSFSVGFF  754
            D SFSVG+F
Sbjct  225  DQSFSVGYF  233



>ref|XP_010259084.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=470

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 133/210 (63%), Gaps = 19/210 (9%)
 Frame = +2

Query  134  THFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS---TGKDNTPTLTDI  304
            +H H +   SL P   C Q      S  LR+   L+VVH +G CS    GK     L  I
Sbjct  28   SHHHVIVTNSLIPAKTCTQSPKVSGSNQLRK---LQVVHINGPCSPLGQGKKTNLNLGQI  84

Query  305  LNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVG  484
            L QDE RV SIH+R+++++            +  + DSKA +PAKSG +L TGN++V VG
Sbjct  85   LLQDELRVRSIHSRISNSK------------QSPLADSKAKIPAKSGRSLGTGNFVVNVG  132

Query  485  LGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLT  664
            LG P + LTL+FDTGSDLTW QC+PC   CY Q E  F+P  S+TYSNISC +A C+ + 
Sbjct  133  LGTPKRDLTLIFDTGSDLTWIQCKPCAVNCYQQNEPTFDPSQSSTYSNISCGSAECTQVG  192

Query  665  SATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
             ATGN+P C SSTC+YG+ YGD+S+SVGF+
Sbjct  193  LATGNSPRC-SSTCIYGVLYGDNSYSVGFY  221



>ref|XP_010065986.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63735.1| hypothetical protein EUGRSUZ_G01382 [Eucalyptus grandis]
Length=473

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 125/184 (68%), Gaps = 19/184 (10%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCS-TGKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNAVS  385
            K   R ++L+VVHKHG CS   +D  P   T +L QDESRV  I ++ ++   D L A  
Sbjct  60   KASSRKSTLEVVHKHGPCSPLVQDPNPLNHTKVLLQDESRVKWIQSQSSNGS-DGLKA--  116

Query  386  GVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCV  565
                      + A++PAKSG T+ TGNY+VT+GLG P K LTL FDTGSD+TWTQCEPC 
Sbjct  117  ---------SATASLPAKSGITIGTGNYVVTIGLGTPKKDLTLEFDTGSDITWTQCEPCA  167

Query  566  KTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSV  745
            K+CYTQ E IFNP  S++Y+NISC+A +CS L S+     GCS STC+YGIQYGD S+SV
Sbjct  168  KSCYTQSEPIFNPSQSSSYANISCTATSCSQLGSS-----GCSGSTCLYGIQYGDQSYSV  222

Query  746  GFFA  757
            G FA
Sbjct  223  GIFA  226



>ref|XP_009359074.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=497

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 124/186 (67%), Gaps = 22/186 (12%)
 Frame = +2

Query  236  LKVVHKHGGC---------STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG C         S   D     T IL QDE+RVNSIH+  N   I N      
Sbjct  71   LKVVHKHGPCNQFHQLKSNSNPADQDEYHTQILKQDEARVNSIHSHFNDP-IHNY-----  124

Query  389  VGRKKKIPDSKA---AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
               +  +P +++    +PA+SG+ L +GNY V+VGLG+P K L+LVFDTGS LTWTQC P
Sbjct  125  ---RIPVPLAQSDATVIPAQSGSVLGSGNYFVSVGLGSPQKKLSLVFDTGSSLTWTQCRP  181

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            C  +CY Q++ IF+P LST+YSNISC++AACS L +A+G    CS+STCVYG QYGD SF
Sbjct  182  CSVSCYQQKDPIFDPSLSTSYSNISCNSAACSQL-AASGVASNCSASTCVYGQQYGDRSF  240

Query  740  SVGFFA  757
            +VGFFA
Sbjct  241  TVGFFA  246



>ref|XP_008386743.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Malus domestica]
Length=435

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 124/188 (66%), Gaps = 26/188 (14%)
 Frame = +2

Query  236  LKVVHKHGGCS----TGKDNTPTLTD-----ILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHK+G C+       +  P+  D     IL QDE+RVNSIH+    +          
Sbjct  10   LKVVHKYGPCNQVHQVKSNXNPSDQDEYHIQILKQDEARVNSIHSHFXDSX---------  60

Query  389  VGRKKKIPDSKA-----AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
              R  +IPD  A      +PA+S + L +GNYIV+VGLG+P K L+LVFDTGS LTWTQC
Sbjct  61   --RNYRIPDPLAQSXATVIPAQSASVLGSGNYIVSVGLGSPQKQLSLVFDTGSSLTWTQC  118

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDS  733
             PC  +CY Q++ IF+P LST+YSNISC++ ACS L +A+G   GCS+STCVYG QYGD 
Sbjct  119  RPCSVSCYKQKDPIFDPSLSTSYSNISCNSPACSQL-AASGVXSGCSASTCVYGQQYGDR  177

Query  734  SFSVGFFA  757
            SF++GFFA
Sbjct  178  SFTIGFFA  185



>gb|KJB55136.1| hypothetical protein B456_009G065000 [Gossypium raimondii]
Length=490

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 125/189 (66%), Gaps = 14/189 (7%)
 Frame = +2

Query  206  ASKGLR-RGASLKVVHKHGGCS----TGKDNTPTLTDILNQDESRVNSIHARVNSARIDN  370
            +++GL  + +SL+VVHKHG CS          PT  +   QDE RV  I +R+ +     
Sbjct  63   STQGLHHQKSSLQVVHKHGPCSPLHLDRAKTPPTHAETFFQDEGRVRYIQSRLANK----  118

Query  371  LNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQ  550
                SG     K+ D  A +PAK G  + +GNYIVTVG+G P K L+L+FDTGSD+TWTQ
Sbjct  119  ----SGSKADVKVTDV-ANLPAKDGRVVGSGNYIVTVGVGTPKKQLSLIFDTGSDITWTQ  173

Query  551  CEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD  730
            CEPC+  CY Q++  F+P +S+TYSN+SC++  CS L SATG+ P CS STCVY IQYGD
Sbjct  174  CEPCLGYCYHQRDAKFDPSVSSTYSNVSCNSVQCSSLVSATGHLPLCSLSTCVYRIQYGD  233

Query  731  SSFSVGFFA  757
            SSFS GFFA
Sbjct  234  SSFSTGFFA  242



>gb|KHM99525.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=484

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 145/231 (63%), Gaps = 27/231 (12%)
 Frame = +2

Query  98   EKGIASESLTEST---HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS  268
            EK  A ++  ES     +H V L SLFP++ C       ++KG +R ASL+VVHKHG CS
Sbjct  23   EKSFAFQATKESNNLRQYHFVHLNSLFPSSSCSS-----SAKGPKRKASLEVVHKHGPCS  77

Query  269  TGKDN-----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPD-SKAAV  430
                N     T + TDI+N D  RV  IH+R++            +GR+  + +     +
Sbjct  78   QLNHNGKAKTTISPTDIMNLDNERVKYIHSRLSK----------NLGRENSVKELDSTTL  127

Query  431  PAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKL  610
            PAKSG+ + + NY V VGLG P + L+L+FDTGSDLTWTQCEPC  +CY QQ+ IF+P  
Sbjct  128  PAKSGSLIGSANYFVVVGLGTPKRDLSLIFDTGSDLTWTQCEPCAGSCYKQQDAIFDPSK  187

Query  611  STTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYGDSSFSVGFFA  757
            S++Y NI+C+++ C+ LTSA G    CSSST  C+YGIQYGD+S SVGF +
Sbjct  188  SSSYINITCTSSLCTQLTSA-GIKSVCSSSTNACIYGIQYGDNSTSVGFLS  237



>ref|XP_008386742.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=496

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 127/193 (66%), Gaps = 26/193 (13%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCST---GKDNT-PTLTD-----ILNQDESRVNSIHARVNSARIDNL  373
            +  + LKVVHK+G C+     K N  P+  D     IL QDE+RVNSIH+    +     
Sbjct  66   KAASXLKVVHKYGPCNQVHQXKSNXNPSDQDEYHXQILKQDEARVNSIHSHFXDSX----  121

Query  374  NAVSGVGRKKKIPDSKA-----AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDL  538
                   R  +IPD  A      +PA+S + L +GNYIV+VGLG+P K L+LVFDTGS L
Sbjct  122  -------RNYRIPDPLAQSXATVIPAQSASVLGSGNYIVSVGLGSPQKQLSLVFDTGSSL  174

Query  539  TWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGI  718
            TWTQC PC  +CY Q++ IF+P LST+YSNISC++ ACS L +A+G   GCS+STCVYG 
Sbjct  175  TWTQCRPCSVSCYKQKDPIFDPSLSTSYSNISCNSPACSQL-AASGVXSGCSASTCVYGQ  233

Query  719  QYGDSSFSVGFFA  757
            QYGD SF++GFFA
Sbjct  234  QYGDRSFTIGFFA  246



>ref|XP_007011661.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY29280.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=503

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 121/183 (66%), Gaps = 13/183 (7%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCSTGKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            ++ +SL+VVH+HG CS    +    TP   + L QD++RV  I +R+         A + 
Sbjct  79   QKKSSLQVVHRHGPCSQLHQDKATKTPRNAETLFQDQARVRYIRSRL---------AKNS  129

Query  389  VGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK  568
             G         A +PAK G+ + +G+Y+VTVGLG+P K L+L+FDTGSD+TWTQC+PC  
Sbjct  130  AGSSDVKETDAANLPAKDGSVVGSGDYVVTVGLGSPKKQLSLIFDTGSDITWTQCQPCDV  189

Query  569  TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVG  748
             CY Q ETIF+P  S+TYSNISC +A C+ L SATGN+  CS S CVYGIQYGDSS SVG
Sbjct  190  YCYDQMETIFDPSKSSTYSNISCDSAVCNSLLSATGNSLDCSLSACVYGIQYGDSSSSVG  249

Query  749  FFA  757
             FA
Sbjct  250  LFA  252



>ref|XP_010108293.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18773.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=579

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 126/184 (68%), Gaps = 14/184 (8%)
 Frame = +2

Query  224  RGASLKVVHKHGGCSTGK---DNTPTLTD---ILNQDESRVNSIHARVNSARIDNLNAVS  385
            + A+LKVVHKHG CS      D   + +D   +L QD+ RVNSIH++        L+  S
Sbjct  159  KKATLKVVHKHGPCSHLNQLGDQKMSASDEIKLLEQDQLRVNSIHSQ--------LSKRS  210

Query  386  GVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCV  565
            G    +    +K+A+P +SG T+ +GNYIVTVGLG P K L+LV DTGS L+WTQCEPCV
Sbjct  211  GDPGFRGPKSTKSAIPVRSGQTIGSGNYIVTVGLGTPKKQLSLVLDTGSALSWTQCEPCV  270

Query  566  KTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSV  745
            + CY Q+E IF P  ST+Y+N+SC++  C+ L S TG +PGC +STC YG+QYGD+S+SV
Sbjct  271  RYCYAQKEPIFKPLESTSYANVSCASELCNALESTTGVSPGCITSTCEYGVQYGDNSYSV  330

Query  746  GFFA  757
            G+ +
Sbjct  331  GYLS  334



>ref|XP_003530761.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=485

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 143/231 (62%), Gaps = 27/231 (12%)
 Frame = +2

Query  98   EKGIASESLTEST---HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS  268
            EK  A ++  ES     +H V L SLFP++ C       ++KG +R ASL+VVHKHG CS
Sbjct  23   EKSFAFQATKESNNLRQYHFVHLNSLFPSSSCSS-----SAKGPKRKASLEVVHKHGPCS  77

Query  269  TGKDN-----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPD-SKAAV  430
                N     T + TDI+N D  RV  I +R++            +GR+  + +     +
Sbjct  78   QLNHNGKAKTTISHTDIMNLDNERVKYIQSRLSK----------NLGRENSVKELDSTTL  127

Query  431  PAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKL  610
            PAKSG+ + + NY V VGLG P + L+LVFDTGSDLTWTQCEPC  +CY QQ+ IF+P  
Sbjct  128  PAKSGSLIGSANYFVVVGLGTPKRDLSLVFDTGSDLTWTQCEPCAGSCYKQQDAIFDPSK  187

Query  611  STTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYGDSSFSVGFFA  757
            S++Y NI+C+++ C+ LTSA G    CSSST  C+YGIQYGD S SVGF +
Sbjct  188  SSSYINITCTSSLCTQLTSA-GIKSRCSSSTTACIYGIQYGDKSTSVGFLS  237



>emb|CDY56047.1| BnaCnng29770D [Brassica napus]
Length=339

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 128/208 (62%), Gaps = 16/208 (8%)
 Frame = +2

Query  143  HTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST---GKDNTPTLTDILNQ  313
            HT+ L SLFP+       +  AS      +SL V H+HG CS    GK  +P   +IL  
Sbjct  37   HTIQLNSLFPSPSSPCVLSARASNT---KSSLHVTHRHGTCSRLTRGKSTSPDHAEILRL  93

Query  314  DESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGN  493
            D++RVNSIH++++   + +     GV + +        +PAK G+   + NY+VTVG+G 
Sbjct  94   DQARVNSIHSKLSKKLLTD-----GVRQSQT-----TNLPAKHGSIYGSANYVVTVGIGT  143

Query  494  PTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSAT  673
            P +  +L+FDTGSDLTW QC+PC+ TCY+Q+E IFNP  S++Y N+ C +A C  L SAT
Sbjct  144  PKQDQSLIFDTGSDLTWIQCKPCIPTCYSQKEPIFNPYKSSSYKNVLCLSAECRCLYSAT  203

Query  674  GNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            G    CS  +CVYGIQYGD SFSVG  A
Sbjct  204  GKPGACSGLSCVYGIQYGDQSFSVGLLA  231



>ref|XP_009411894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=452

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 120/179 (67%), Gaps = 20/179 (11%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDN-TPTLTDILNQDESRVNSIHARV----NSARIDNLNAVSGVGRK  400
            LKV H+HG CS  + + TP    IL++D SRV+S+  R+     SA++D     S VG K
Sbjct  44   LKVTHRHGPCSPLRSHPTPLPEQILDEDRSRVDSLRRRIAAAATSAKLDRQRG-SQVGSK  102

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
                     +P + G+++STGNY+VTVG G P +  T++FDTGSD+TW QC+PCV  CY 
Sbjct  103  ---------IPVRPGSSVSTGNYVVTVGFGTPKRDQTVIFDTGSDITWIQCQPCVTYCYE  153

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            QQ+ IFNP  S+TY+NISCS+  CS L     +  GCSSS C+YG+QYGD+SFS+GFFA
Sbjct  154  QQDPIFNPSASSTYANISCSSTYCSDL-----DISGCSSSACLYGVQYGDNSFSIGFFA  207



>ref|XP_002324352.2| hypothetical protein POPTR_0018s03010g [Populus trichocarpa]
 gb|EEF02917.2| hypothetical protein POPTR_0018s03010g [Populus trichocarpa]
Length=472

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 139/228 (61%), Gaps = 29/228 (13%)
 Frame = +2

Query  98   EKGIA-SESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---  265
            EKG A  E+    ++ H + + SL PTT C+       S  +    SL+VVH+HG C   
Sbjct  21   EKGYAVEENEATKSYLHIIKVNSLLPTTACNH------SSKVSNSLSLEVVHRHGPCIGI  74

Query  266  ---STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAA-VP  433
                 G D  P+  +I  +D++RV+SIHAR++S              +   P+ +A  +P
Sbjct  75   VNQEKGAD-APSNMEIFLRDQNRVDSIHARLSS--------------RGMFPEKQATTLP  119

Query  434  AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLS  613
             +SG ++  G+Y+VTVGLG P K  TL+FDTGSD+TWTQCEPCVKTCY Q+E   NP  S
Sbjct  120  VQSGASIGAGDYVVTVGLGTPKKEFTLIFDTGSDITWTQCEPCVKTCYKQKEPRLNPSTS  179

Query  614  TTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            T+Y NISCS+A C  + S    +  CSSSTC+Y +QYGD S+S+GFFA
Sbjct  180  TSYKNISCSSALCKLVASGKKFSQSCSSSTCLYQVQYGDGSYSIGFFA  227



>ref|XP_002324351.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02916.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=472

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 139/228 (61%), Gaps = 29/228 (13%)
 Frame = +2

Query  98   EKGIA-SESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---  265
            EKG A  E+    ++ H + + SL PTT C+       S  +    SL+VVH+HG C   
Sbjct  21   EKGYAVEENEATKSYLHIIKVNSLLPTTACNH------SSKVSNSLSLEVVHRHGPCIGI  74

Query  266  ---STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAA-VP  433
                 G D  P+  +I  +D++RV+SIHAR++S              +   P+ +A  +P
Sbjct  75   VNQEKGAD-APSNMEIFLRDQNRVDSIHARLSS--------------RGMFPEKQATTLP  119

Query  434  AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLS  613
             +SG ++  G+Y+VTVGLG P K  TL+FDTGSD+TWTQCEPCVKTCY Q+E   NP  S
Sbjct  120  VQSGASIGAGDYVVTVGLGTPKKEFTLIFDTGSDITWTQCEPCVKTCYKQKEPRLNPSTS  179

Query  614  TTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            T+Y NISCS+A C  + S    +  CSSSTC+Y +QYGD S+S+GFFA
Sbjct  180  TSYKNISCSSALCKLVASGKKFSQSCSSSTCLYQVQYGDGSYSIGFFA  227



>gb|KGN55408.1| hypothetical protein Csa_4G651750 [Cucumis sativus]
Length=389

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 115/154 (75%), Gaps = 12/154 (8%)
 Frame = +2

Query  302  ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKA-AVPAKSGTTLSTGNYIVT  478
            +L +D+SRV+ IH+++ +  +++++ + G         SKA  +PAKSG T+ +GNYIV+
Sbjct  1    MLVKDQSRVDFIHSKI-AGELESVDRLRG---------SKATKIPAKSGATIGSGNYIVS  50

Query  479  VGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSG  658
            VGLG P K L+L+FDTGSDLTWTQC+PC + CY Q++ +F P  STTYSNISCS+  CS 
Sbjct  51   VGLGTPKKYLSLIFDTGSDLTWTQCQPCARYCYNQKDPVFVPSQSTTYSNISCSSPDCSQ  110

Query  659  LTSATGNNPGCSSS-TCVYGIQYGDSSFSVGFFA  757
            L S TGN PGCS++  C+YGIQYGD SFSVG+FA
Sbjct  111  LESGTGNQPGCSAARACIYGIQYGDQSFSVGYFA  144



>ref|XP_009359069.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=496

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 118/188 (63%), Gaps = 26/188 (14%)
 Frame = +2

Query  236  LKVVHKHGGC---------STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKV+HKHG C         S   D       IL QDE+RV+SIH+  N            
Sbjct  71   LKVIHKHGPCNQVHQLKSNSNPSDQDEYHIQILKQDEARVHSIHSHFNDPN---------  121

Query  389  VGRKKKIPDSKA-----AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
                 KIPD  A      +PA+SG+ L +GNYIV+VGLG+P K L+LVFDTGS LTWTQC
Sbjct  122  --NNYKIPDPLAQSDATVIPAQSGSVLGSGNYIVSVGLGSPQKQLSLVFDTGSGLTWTQC  179

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDS  733
             PC  +CY Q++ IF+P LST+YSNISC++AACS L +A+G    CS STC+YG  YGD 
Sbjct  180  RPCAGSCYQQKDPIFDPSLSTSYSNISCNSAACSQL-AASGVASNCSGSTCIYGQGYGDR  238

Query  734  SFSVGFFA  757
            SF++GF A
Sbjct  239  SFTIGFLA  246



>ref|XP_008220869.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=376

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 124/189 (66%), Gaps = 22/189 (12%)
 Frame = +2

Query  224  RGASLKVVHKHGGCSTGKDNTPTL---------TDILNQDESRVNSIHARVNSARIDNLN  376
            + + L+VVHKHG CS    ++ T            IL QDE+RVNSIH+R+N  RI +  
Sbjct  60   KASILEVVHKHGPCSIFHKSSKTSTTKSDDKYHAQILKQDEARVNSIHSRLN-YRIQDPF  118

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
              S          +   +PAKSG  L TGNY+VTVGLG P K L+LVFDTGSDLTWTQC 
Sbjct  119  TQSA---------ASTTLPAKSGLLLGTGNYLVTVGLGTPAKQLSLVFDTGSDLTWTQCR  169

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS--SSTCVYGIQYGD  730
            PC+++CY Q E IF+P LS +Y N+SC++A C+ L+SA G    CS  SS+C+YGI+YGD
Sbjct  170  PCLRSCYRQSEPIFDPSLSASYKNLSCTSATCTQLSSA-GIQHDCSSASSSCLYGIRYGD  228

Query  731  SSFSVGFFA  757
             SFS+G FA
Sbjct  229  GSFSIGDFA  237



>emb|CDX85746.1| BnaA02g00670D [Brassica napus]
Length=477

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 128/180 (71%), Gaps = 15/180 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL V H+HG CS+   +    +P   +IL  D++RVNSIH++++    D +       R
Sbjct  63   SSLHVTHRHGTCSSLTSDKATTSPDHAEILRLDQARVNSIHSKLSKKLTDRV-------R  115

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
            + K      A+PAK G+   +GNY+V+VG+G P +  +L+FDTGSDLTW QCEPCV+TCY
Sbjct  116  QSK----STALPAKDGSIFGSGNYVVSVGIGTPKRDQSLIFDTGSDLTWIQCEPCVQTCY  171

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            +Q+E IFNP  S++Y N+SCS+AAC+ L+SATGN+  CS+STCVYGIQYGD SFSVGF A
Sbjct  172  SQKEPIFNPSSSSSYYNVSCSSAACTSLSSATGNSGSCSASTCVYGIQYGDQSFSVGFLA  231



>ref|XP_008220626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Prunus 
mume]
Length=485

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 127/193 (66%), Gaps = 30/193 (16%)
 Frame = +2

Query  224  RGASLKVVHKHGGCSTGKDNTPTL---------TDILNQDESRVNSIHARVNSARIDNLN  376
            + + L+VVHKHG CS    ++ T            IL QDE+RVNSIH+R+N  RI +  
Sbjct  60   KASILEVVHKHGPCSIFHKSSKTSTTKSDDKYHAQILKQDEARVNSIHSRLN-YRIQD--  116

Query  377  AVSGVGRKKKIPDSKAA----VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTW  544
                       P +++A    +PAKSG  L +GNY VTVGLG P K L+LVFDTGSDLTW
Sbjct  117  -----------PFTQSAASTTLPAKSGLLLGSGNYFVTVGLGTPAKQLSLVFDTGSDLTW  165

Query  545  TQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS--SSTCVYGI  718
            TQC PCV++CYTQ E IF+P LS +Y N+SC++A C+ L+SA G    CS  SS+C+YGI
Sbjct  166  TQCRPCVRSCYTQSEPIFDPSLSASYKNLSCTSATCTQLSSA-GIQHDCSSASSSCLYGI  224

Query  719  QYGDSSFSVGFFA  757
            +YGD SFS+G FA
Sbjct  225  RYGDGSFSIGDFA  237



>gb|KDP33482.1| hypothetical protein JCGZ_07053 [Jatropha curcas]
Length=475

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 140/224 (63%), Gaps = 32/224 (14%)
 Frame = +2

Query  119  SLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTG-KDNTPT-  292
            SL +S H H   LTSL  +  C++     +SK  ++G+SL++VHK G C+   KD+  T 
Sbjct  27   SLQKSLHTHNFKLTSLLASNVCNR-----SSKVHKQGSSLEIVHKDGPCNEKMKDDFKTE  81

Query  293  -----LTDILNQDESRVNSIHARV----NSARIDNLNAVSGVGRKKKIPDSKAAVPAKSG  445
                   ++L QD+ RV++IHAR     NS   D +               +A +P +SG
Sbjct  82   ISASHYQEMLLQDQLRVDTIHARFTRRNNSGPFDEM---------------QAKLPLQSG  126

Query  446  TTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYS  625
              + TGNY VTV LG P K L+L+FDTGSD+TWTQCEPCV +CY Q + IF P+ S++Y+
Sbjct  127  VAIGTGNYFVTVSLGTPQKDLSLIFDTGSDITWTQCEPCVVSCYQQGQPIFEPRKSSSYA  186

Query  626  NISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            N+SCS++ C+ L + +G   GCSSSTC+Y + YGD ++SVGFFA
Sbjct  187  NVSCSSSYCN-LITESGGKKGCSSSTCLYKVVYGDGTYSVGFFA  229



>ref|XP_009125277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=477

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 127/180 (71%), Gaps = 15/180 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL V H+HG CS+   +    +P   +IL  D++RVNSIH++++    D +       R
Sbjct  63   SSLHVTHRHGTCSSLTSDKATTSPDHAEILRLDQARVNSIHSKLSKKLTDRV-------R  115

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
            + K      A+PAK G+   +GNY+V+VG+G P +  +L+FDTGSD TW QCEPCV+TCY
Sbjct  116  QSK----STALPAKDGSIFGSGNYVVSVGIGTPKRDQSLIFDTGSDPTWIQCEPCVQTCY  171

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            +Q+E IFNP  S++Y N+SCS+AAC+ L+SATGN+  CS+STCVYGIQYGD SFSVGF A
Sbjct  172  SQKEPIFNPSSSSSYYNVSCSSAACTSLSSATGNSGSCSASTCVYGIQYGDQSFSVGFLA  231



>ref|XP_007011660.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY29279.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=469

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 119/187 (64%), Gaps = 18/187 (10%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGC---STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLN  376
            ++K + R +SL+VVHKHG C   S  +   P+  +IL+QD+SRV+SIH+R++   ++ ++
Sbjct  51   STKVMNRKSSLEVVHKHGPCFQSSQDRAKVPSHAEILSQDQSRVDSIHSRLSMNSMEEMD  110

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
             V+              +P K G ++ TGNY+VTV  G P K   L+FDTGS  TWTQCE
Sbjct  111  VVT--------------LPTKKGISVGTGNYLVTVSFGTPGKKYALIFDTGSHFTWTQCE  156

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PC   C+ Q E IF+P  S +Y+NISC AA C+ + SA G    CSSSTCVYGI YGDSS
Sbjct  157  PCAGFCHDQVEPIFDPSKSRSYANISCRAATCNQI-SAEGMQQDCSSSTCVYGISYGDSS  215

Query  737  FSVGFFA  757
             S GF A
Sbjct  216  SSAGFLA  222



>ref|XP_010258628.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=493

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 122/178 (69%), Gaps = 16/178 (9%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTL----TDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            LK++H++G CS  G   T  L     +IL++D+SRV+ + +R+           S   R 
Sbjct  75   LKILHRNGPCSHLGGGKTKPLPLAAIEILSEDQSRVDFLQSRL-----------SNNSRG  123

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
              + +S+A VPA+SG  L +GNY+V VGLG+P   L+L+FDTGSDLTW QC+PC + C+ 
Sbjct  124  SAVRNSEARVPARSGRYLGSGNYVVRVGLGSPRTDLSLIFDTGSDLTWIQCKPCTRYCHK  183

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            QQ+ IF+P  S++YSN++CSA  CS L+SAT +  GCS+STC+Y IQYGD S+SVG+F
Sbjct  184  QQDPIFDPTKSSSYSNVTCSADECSQLSSATSSPTGCSASTCIYSIQYGDGSYSVGYF  241



>ref|XP_009359072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Pyrus 
x bretschneideri]
Length=496

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 117/188 (62%), Gaps = 26/188 (14%)
 Frame = +2

Query  236  LKVVHKHGGC---------STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG C         S   D       IL QDE+RV+SIH+  N            
Sbjct  71   LKVVHKHGPCNQVHQLKSNSNPSDQDEYHIQILKQDEARVHSIHSHFNDPN---------  121

Query  389  VGRKKKIPDSKA-----AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
                  IPD  A      +PA+SG+ L +G+YIV+VGLG+P K L+LVFDTGS LTWTQC
Sbjct  122  --NNYGIPDPVAQSDATVIPAQSGSVLGSGDYIVSVGLGSPQKQLSLVFDTGSGLTWTQC  179

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDS  733
            +PC  +CY Q++ IF+P +ST+YSNISC++AACS L  A+G    CS STC+YG +YGD 
Sbjct  180  QPCAGSCYQQKDPIFDPSISTSYSNISCNSAACSQL-PASGIASKCSGSTCIYGEEYGDG  238

Query  734  SFSVGFFA  757
            SF+ GF A
Sbjct  239  SFTAGFLA  246



>ref|XP_009122022.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=493

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 127/179 (71%), Gaps = 14/179 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS   + K  +P   +IL  D++RVNSIH++++    D +       R+
Sbjct  80   SSLHVTHRHGTCSRITSAKAKSPDHAEILRLDQARVNSIHSKLSKKLTDRV-------RQ  132

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             K  D    +PAK G+T  +GN++VT+G+G P   L+L+FDTGSDLTW QCEPCV+TCY+
Sbjct  133  SKSTD----LPAKDGSTYGSGNFVVTLGIGTPKHDLSLIFDTGSDLTWIQCEPCVRTCYS  188

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IFNP  S++Y N+SCS+A CS L+SATGN+  CS+S CVYGIQYGD SFSVGF A
Sbjct  189  QKEPIFNPSSSSSYHNVSCSSAECSSLSSATGNSGTCSASNCVYGIQYGDQSFSVGFLA  247



>emb|CDX69804.1| BnaA10g21530D [Brassica napus]
Length=476

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 127/179 (71%), Gaps = 14/179 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS   + K  +P   +IL  D++RVNSIH++++    D +       R+
Sbjct  63   SSLHVTHRHGTCSRITSAKAKSPDHAEILRLDQARVNSIHSKLSKKLTDRV-------RQ  115

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             K  D    +PAK G+T  +GN++VT+G+G P   L+L+FDTGSDLTW QCEPCV+TCY+
Sbjct  116  SKSTD----LPAKDGSTYGSGNFVVTLGIGTPKHDLSLIFDTGSDLTWIQCEPCVRTCYS  171

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IFNP  S++Y N+SCS+A CS L+SATGN+  CS+S CVYGIQYGD SFSVGF A
Sbjct  172  QKEPIFNPSSSSSYHNVSCSSAECSSLSSATGNSGTCSASNCVYGIQYGDQSFSVGFLA  230



>ref|XP_002309515.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE93038.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=473

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 117/180 (65%), Gaps = 21/180 (12%)
 Frame = +2

Query  233  SLKVVHKHGGC-----STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            SL+VVH+ G C          N P+  +IL QD  RV+SIHAR++S          GV +
Sbjct  64   SLEVVHRSGPCIQVLNQEKAANAPSNMEILLQDRHRVDSIHARLSS---------HGVFQ  114

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
            +K+     A +P +SG ++ +G+Y VTVGLG P K  TL+FDTGSDLTWTQCEPC KTCY
Sbjct  115  EKQ-----ATLPVQSGASIGSGDYAVTVGLGTPKKEFTLIFDTGSDLTWTQCEPCAKTCY  169

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             Q+E   +P  ST+Y NISCS+A C  L +  G +  CSS TC+Y +QYGD S+S+GFFA
Sbjct  170  KQKEPRLDPTKSTSYKNISCSSAFCKLLDTEGGES--CSSPTCLYQVQYGDGSYSIGFFA  227



>emb|CDX97058.1| BnaC09g45670D [Brassica napus]
Length=491

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 125/179 (70%), Gaps = 14/179 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS     K   P   +IL  D++RVNSIH++++    D +       R+
Sbjct  78   SSLHVTHRHGTCSRITNAKAKNPDHAEILRLDQARVNSIHSKLSKKLTDRV-------RQ  130

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             K  D    +PAK G+T  +GN++VT+G+G P   L+L+FDTGSDLTW QCEPCV+TCY+
Sbjct  131  SKSTD----LPAKDGSTYGSGNFVVTLGIGTPKHDLSLIFDTGSDLTWIQCEPCVRTCYS  186

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IFNP  S++Y N+SCS+A CS L+SATGN+  CS+S CVYGIQYGD SFSVGF A
Sbjct  187  QKEPIFNPSSSSSYHNVSCSSAECSSLSSATGNSGTCSASNCVYGIQYGDQSFSVGFLA  245



>gb|KFK25359.1| hypothetical protein AALP_AA8G103100 [Arabis alpina]
Length=475

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 132/180 (73%), Gaps = 16/180 (9%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS    GK  TP   +IL  D++RVNSIH+++ S ++++          
Sbjct  62   SSLHVTHRHGTCSRLTNGKATTPDHVEILRLDQARVNSIHSKL-SKKVND----------  110

Query  401  KKIPDSKAA-VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
             ++  S++  VPAKSG+TL +GNYIVTVG+G P   L+L+FDTGSDLTWTQCEPCV+TCY
Sbjct  111  -RVRQSQSTNVPAKSGSTLGSGNYIVTVGIGTPKHDLSLIFDTGSDLTWTQCEPCVQTCY  169

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            +Q+E IFNP  S++Y N+SCS+A CS L+SATGN   CS+S CVYGIQYGD SFSVG+ A
Sbjct  170  SQKEPIFNPSSSSSYYNVSCSSAPCSSLSSATGNAGSCSASNCVYGIQYGDQSFSVGYLA  229



>ref|XP_010066088.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63887.1| hypothetical protein EUGRSUZ_G01559 [Eucalyptus grandis]
Length=473

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 118/184 (64%), Gaps = 19/184 (10%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCSTGKDNTPTL--TDILNQDESRVNSIHARVNSARIDNLNAVS  385
            K   R ++L+VVHKHG CS    +   L  T +L QD SRV  I ++ ++   D L A  
Sbjct  60   KASSRKSTLEVVHKHGPCSPLSQDLNPLNHTKVLLQDVSRVKWIQSQSSNGS-DGLKA--  116

Query  386  GVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCV  565
                      + A++PAKSG T+ TGNY+VT+GLG P K LTL FDTGS LTWTQCEPC 
Sbjct  117  ---------SATASLPAKSGITIGTGNYVVTIGLGTPKKDLTLEFDTGSRLTWTQCEPCA  167

Query  566  KTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSV  745
             +CYTQ E IFNP  S++Y+N+SC+  +CS L        GCS STC+Y IQYGD S+++
Sbjct  168  GSCYTQSEPIFNPSQSSSYANVSCNTTSCSQL-----GRSGCSGSTCLYAIQYGDQSYTI  222

Query  746  GFFA  757
            GFFA
Sbjct  223  GFFA  226



>ref|XP_007223364.1| hypothetical protein PRUPE_ppa005616mg [Prunus persica]
 gb|EMJ24563.1| hypothetical protein PRUPE_ppa005616mg [Prunus persica]
Length=451

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 121/189 (64%), Gaps = 22/189 (12%)
 Frame = +2

Query  224  RGASLKVVHKHGGCSTGKDNTPTL---------TDILNQDESRVNSIHARVNSARIDNLN  376
            + + L+VVHKHG CS    ++ T            IL QDE+RVNSIH+R+N    D   
Sbjct  26   KASILEVVHKHGPCSIFHKSSKTSTTKSDDKYHAQILKQDEARVNSIHSRLNYRIHDPFT  85

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
              S          + A +PAKSG  L + NY+VTVGLG P K L+L FDTGSDLTWTQC 
Sbjct  86   QSS----------ASATLPAKSGLLLGSPNYLVTVGLGTPAKQLSLEFDTGSDLTWTQCR  135

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS--SSTCVYGIQYGD  730
            PC++ CYTQ E IF+P LS +Y N+SC++A C+ L+SA G    CS  SS+C+YGI+YGD
Sbjct  136  PCLRYCYTQSEPIFDPSLSASYKNLSCTSATCTQLSSA-GIPHRCSSASSSCLYGIRYGD  194

Query  731  SSFSVGFFA  757
             SFS+G FA
Sbjct  195  GSFSIGDFA  203



>gb|KCW44808.1| hypothetical protein EUGRSUZ_L01627, partial [Eucalyptus grandis]
Length=394

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 118/181 (65%), Gaps = 16/181 (9%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCSTGKDNTPTL--TDILNQDESRVNSIHARVNSARIDNLNAVSGVG  394
            +R ++L+V HKHG CS        L  T  L QDESRV  I ++ ++   D L       
Sbjct  2    KRKSTLEVYHKHGPCSQLVQGHSPLNHTKSLLQDESRVKWIQSQSSNGS-DGLKV-----  55

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
                   +  ++PAKSG TL TGNYIV++GLG P + LTL+FDTGS LTWTQC+PCV +C
Sbjct  56   ------SAATSLPAKSGITLGTGNYIVSIGLGTPKQDLTLIFDTGSPLTWTQCQPCVGSC  109

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            YTQ + IF+P  S++Y+NISC++  CS L S   +  GCS STC+YGIQYGD S SVGFF
Sbjct  110  YTQSDPIFDPSQSSSYANISCTSTLCSQLGSIVAS--GCSRSTCLYGIQYGDQSSSVGFF  167

Query  755  A  757
            A
Sbjct  168  A  168



>gb|KCW44810.1| hypothetical protein EUGRSUZ_L01629 [Eucalyptus grandis]
 gb|KCW44811.1| hypothetical protein EUGRSUZ_L01629 [Eucalyptus grandis]
Length=416

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 118/178 (66%), Gaps = 19/178 (11%)
 Frame = +2

Query  230  ASLKVVHKHGGCS-TGKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK  403
            ++L+VVHKHG CS   +D  P   T +L QD SRV  I ++ ++   D L A        
Sbjct  66   STLEVVHKHGPCSPLFQDLNPLNHTKVLLQDVSRVKWIQSQSSNGS-DGLKA--------  116

Query  404  KIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
                + A++PAKSG T+ TGNYIVT+GLG P K LTL FDTGS LTWTQCEPC ++CYTQ
Sbjct  117  ---SATASLPAKSGITMGTGNYIVTIGLGTPKKDLTLEFDTGSHLTWTQCEPCARSCYTQ  173

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             E IFNP  S++Y+N+SC+  +CS L  +      CS STC+Y IQYGD S+++GFFA
Sbjct  174  SEPIFNPSQSSSYANVSCNTTSCSQLGRSR-----CSGSTCLYAIQYGDQSYTIGFFA  226



>ref|XP_009409855.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=466

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 121/178 (68%), Gaps = 19/178 (11%)
 Frame = +2

Query  233  SLKVVHKHGGCSTGK-DNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKI  409
            SL V+ +HG CS     +  +   IL+ D+SRV+S+H RV++A            ++ + 
Sbjct  60   SLTVLDRHGPCSPFDLHHQLSHKQILDHDQSRVDSLHGRVSTAP-----------KQDQQ  108

Query  410  PDSKAA--VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
             D+ AA  +PA SG +L TGNY+V VG G P +  T++FDTGSD+TW QC+PCV TCY Q
Sbjct  109  LDALAASSIPAHSGISLGTGNYVVIVGFGTPKRDQTVIFDTGSDVTWIQCQPCVVTCYQQ  168

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+ IF+P  S+TY NISCS+A C+ L ++     GCSSSTCVYG+QYGD+S++VGF+A
Sbjct  169  QDPIFDPSHSSTYLNISCSSAYCTDLGAS-----GCSSSTCVYGVQYGDNSYTVGFYA  221



>ref|XP_008220627.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=502

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 118/187 (63%), Gaps = 28/187 (15%)
 Frame = +2

Query  236  LKVVHKHGGCS---------TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG CS         T   +      IL QD++RVNSIH+R+N            
Sbjct  80   LKVVHKHGPCSKFHKSSKTSTTTSDERYHAQILKQDQARVNSIHSRLNH-----------  128

Query  389  VGRKKKIPDSKAA---VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
                 K P +++A   +PAKSG  + +GNYIVTVGLG P   L+L+FDTGSDLTWTQC+P
Sbjct  129  --NSNKDPLTQSAATTLPAKSGLVIGSGNYIVTVGLGTPANQLSLIFDTGSDLTWTQCQP  186

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYGDS  733
            C  +CY Q E IF+P LS +Y NISC+ AAC+ L+S +G   GCS+ST  C+Y  +YGD 
Sbjct  187  CTGSCYNQTEPIFDPSLSASYENISCATAACTQLSS-SGIEHGCSTSTSACLYAAEYGDK  245

Query  734  SFSVGFF  754
            SF++G F
Sbjct  246  SFTIGVF  252



>gb|KEH33910.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=467

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 121/191 (63%), Gaps = 30/191 (16%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCSTGKDN-----TPTLTDILNQDESRVNSIHARVNSARIDNL  373
            +KG +R ASL VV KHG CS   +N      PT +DIL+ D+ RVN IH++++S   DNL
Sbjct  49   TKGPKRKASLDVVPKHGPCSQLNNNGKASILPTHSDILSLDKERVNYIHSKLSS---DNL  105

Query  374  NAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
                               PA  G  + TGNY V VGLG P ++L+LVFDTGSDLTWTQC
Sbjct  106  -------------------PAIYGNLIGTGNYFVVVGLGTPKRNLSLVFDTGSDLTWTQC  146

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPG-CSSST--CVYGIQY  724
            +PC + CYTQQ+ IF+P  ST+Y NISC+++ C+ L S+TG +P  C   T  C YG+ Y
Sbjct  147  QPCARPCYTQQDEIFDPSKSTSYCNISCTSSDCTQLISSTGMDPPTCYPLTKACKYGMVY  206

Query  725  GDSSFSVGFFA  757
            GD SFS G+F+
Sbjct  207  GDGSFSEGYFS  217



>ref|XP_007223563.1| hypothetical protein PRUPE_ppa014553mg, partial [Prunus persica]
 gb|EMJ24762.1| hypothetical protein PRUPE_ppa014553mg, partial [Prunus persica]
Length=432

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 120/189 (63%), Gaps = 30/189 (16%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTPTLT---------DILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG CS    ++ T T          IL QD++RVNSIH+R+N            
Sbjct  10   LKVVHKHGPCSNFHKSSKTSTTTCDEKYHAQILKQDQARVNSIHSRLNH-----------  58

Query  389  VGRKKKIPDSKAA---VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
                 K P +++A   +PAKSG  + TGNYIVTV LG P K L+L FDTGSDLTWTQC+ 
Sbjct  59   --NNNKDPLTQSAATTLPAKSGLVIGTGNYIVTVSLGTPAKQLSLAFDTGSDLTWTQCKA  116

Query  560  C--VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYG  727
            C   ++CY Q+E IFNP LS +Y  ISC+ AAC+ L+S  G   GCS+ST  C+YG +YG
Sbjct  117  CSATQSCYKQREPIFNPFLSASYKKISCTTAACTQLSS-IGVQHGCSASTSACLYGTRYG  175

Query  728  DSSFSVGFF  754
            D+SFSVG F
Sbjct  176  DNSFSVGVF  184



>ref|XP_010419657.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=469

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 119/188 (63%), Gaps = 24/188 (13%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCSTGKDNTPTL-----TDILNQDESRVNSIHARVNSARIDNLN  376
            KG    +SL+VVH H  CS  + N          +IL +D++RV SIH++++       N
Sbjct  56   KGSNTKSSLRVVHMHDACSHLRSNKDARRRIDHEEILRRDQARVESIHSKLSK------N  109

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
               GV   K        +PAK GTT+ +G+YI+T+G+G P   ++L+FDTGSDLTWTQC+
Sbjct  110  NADGVSMTKS-----TELPAKDGTTIGSGDYIITIGIGTPKHDVSLIFDTGSDLTWTQCQ  164

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST-CVYGIQYGDS  733
            PC+++CY+QQE IFNP  S++Y N+SCS+  C       GNNP C+S T C YGI+YGD 
Sbjct  165  PCLESCYSQQEPIFNPSTSSSYQNVSCSSPMC-------GNNPSCNSDTNCRYGIRYGDG  217

Query  734  SFSVGFFA  757
            SF+VG  A
Sbjct  218  SFTVGVLA  225



>gb|ACN85295.1| aspartic proteinase nepenthesin-1 precursor [Oryza coarctata]
Length=500

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 112/178 (63%), Gaps = 18/178 (10%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKD----NTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK  403
            + +VH+HG CS   D      P+  +IL  D++R  SI  RV++            G+ K
Sbjct  89   MPIVHRHGPCSPLADAHDGKLPSHEEILAADQNRAKSIQRRVST------TTTVSRGKPK  142

Query  404  KIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
            +   ++ ++PA SG+ L TGNY+VT+GLG P    T+VFDTGSD TW QCEPCV  CY Q
Sbjct  143  R---NRPSLPASSGSALGTGNYVVTIGLGTPAGRYTVVFDTGSDTTWVQCEPCVVVCYKQ  199

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            QE +F+P  S+TY+NISC+A ACS L        GCS   C+YG+QYGD S+S+GFFA
Sbjct  200  QEKLFDPARSSTYANISCAAPACSDLYIK-----GCSGGHCLYGVQYGDGSYSIGFFA  252



>ref|XP_008379443.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=488

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 136/230 (59%), Gaps = 32/230 (14%)
 Frame = +2

Query  98   EKGIASESLTEST----HFHTVPLTSLFptthchqphtthASKGL--RRGASLKVVHKHG  259
            EKG AS      T    H HTV + SL             +++G    + + L+VVHKHG
Sbjct  31   EKGFASAEGDTKTDLLPHTHTVEVNSL-----QPATTCILSTQGPYNNKESVLEVVHKHG  85

Query  260  GCSTGKDNT-PTLTD---ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKA-  424
             C+  K  + PT  D   IL QDE+RV+SIH R+NS                 +PD+   
Sbjct  86   LCNQHKSQSNPTDQDRTQILKQDEARVSSIHYRLNSL---------------TLPDAATN  130

Query  425  AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNP  604
             +P + G  L + NYIVTVGLG P K+L+L+ DTGSDLTWTQC PCV++CY Q+E +F+P
Sbjct  131  TIPVQYGLELGSSNYIVTVGLGTPAKNLSLLIDTGSDLTWTQCRPCVRSCYKQKEPMFDP  190

Query  605  KLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
              ST+YSNISC +AACS LT A G    CS++TC Y  +Y D+S S+GFF
Sbjct  191  SHSTSYSNISCESAACSQLTVA-GIGRDCSAATCTYSAKYLDNSSSLGFF  239



>ref|XP_006399574.1| hypothetical protein EUTSA_v10013429mg [Eutrema salsugineum]
 gb|ESQ41027.1| hypothetical protein EUTSA_v10013429mg [Eutrema salsugineum]
Length=475

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 127/179 (71%), Gaps = 14/179 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL V H+HG CS   +GK  +P   ++L  D++RV SIH++++    D +       R+
Sbjct  62   SSLHVTHRHGTCSRLTSGKAKSPDHVEVLRLDQARVKSIHSKLSKKLTDRV-------RQ  114

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             +  D    +PAK G+T  +GNY+VTVG+G P   L+L+FDTGSDLTWTQCEPCV++CY+
Sbjct  115  SQSTD----LPAKDGSTFGSGNYVVTVGIGTPKHDLSLIFDTGSDLTWTQCEPCVRSCYS  170

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IFNP  S++Y N+SCS++AC  L+SATGN   CS+S C+YGIQYGD SFSVGF A
Sbjct  171  QKEPIFNPSSSSSYYNVSCSSSACGSLSSATGNAGSCSASNCLYGIQYGDQSFSVGFLA  229



>gb|KCW80526.1| hypothetical protein EUGRSUZ_C01880, partial [Eucalyptus grandis]
Length=463

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 115/177 (65%), Gaps = 13/177 (7%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPT-LTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++LK+VHK+G CS   D  P   T +L +D +RV  I ++++       N++SG    K 
Sbjct  58   STLKLVHKYGPCSQLFDGGPINHTQVLLEDMARVKWIQSKIS-------NSISGTSDLK-  109

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
              +S  ++PA  G   S+  Y+VT+GLG P K LTL FDTGS LTWTQCEPC+ +CY Q 
Sbjct  110  --ESAVSLPASYGPYRSS--YVVTIGLGTPEKDLTLAFDTGSALTWTQCEPCIGSCYNQT  165

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IFNP  S++Y+NISCSA +C  L S T    GCS STCVYG  YGD+SF+ GFFA
Sbjct  166  EPIFNPSQSSSYANISCSAPSCIQLPSGTDQLTGCSGSTCVYGASYGDASFTAGFFA  222



>ref|XP_011036735.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=469

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 139/228 (61%), Gaps = 32/228 (14%)
 Frame = +2

Query  98   EKGIASESLTEST--HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC--  265
            EKG A E   E+T  + H V + SL PTT C        S  +    SL+VVH+HG C  
Sbjct  21   EKGYAVEE-NEATKRNLHIVKVNSLLPTTACSH------SSKVSDSLSLEVVHRHGPCIG  73

Query  266  ----STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVP  433
                  G D  P+  +I  +D++RV+SIHAR++S              +   P+ +A +P
Sbjct  74   IVNQEKGAD-APSNMEIFLRDQNRVDSIHARLSS--------------RGMFPEKQATLP  118

Query  434  AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLS  613
             +SG ++  G+Y+VTVGLG P K  TL+FDTGSD+TWTQCEPC +TCY Q+E   NP  S
Sbjct  119  VQSGASIGAGDYVVTVGLGTPKKEFTLIFDTGSDITWTQCEPCDRTCYKQKEPRLNPSKS  178

Query  614  TTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            T+Y NISCS+A C+ +  A+  +  CSSSTC Y +QYGD S+S+GFFA
Sbjct  179  TSYKNISCSSALCNLV--ASEGSQSCSSSTCRYQVQYGDGSYSIGFFA  224



>ref|XP_002515387.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46836.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=463

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 115/178 (65%), Gaps = 25/178 (14%)
 Frame = +2

Query  230  ASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            ASLKVVHKHG CS       N P L +IL +D+SRV+SIHA+        L+  SGV   
Sbjct  65   ASLKVVHKHGPCSQLNQQNGNAPNLVEILLEDQSRVDSIHAK--------LSDHSGVKET  116

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
                   A +P KSG +L TGNYIV++GLG+P K L L+FDTGSDLTW +C        +
Sbjct  117  DA-----AKLPTKSGMSLGTGNYIVSIGLGSPKKDLMLIFDTGSDLTWARC--------S  163

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
              ET F+P  ST+Y+N+SCS   CS + SATGN   C++STCVYGIQYGD S+S+GF 
Sbjct  164  AAET-FDPTKSTSYANVSCSTPLCSSVISATGNPSRCAASTCVYGIQYGDGSYSIGFL  220



>ref|XP_007212799.1| hypothetical protein PRUPE_ppa020165mg [Prunus persica]
 gb|EMJ13998.1| hypothetical protein PRUPE_ppa020165mg [Prunus persica]
Length=386

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 108/163 (66%), Gaps = 16/163 (10%)
 Frame = +2

Query  275  KDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTL  454
            K   P +  IL++D++ V SIH+R+ S ++++              D    +P  SG  +
Sbjct  12   KKILPIILKILDRDQAGVISIHSRLGSKKMNS--------------DDATTMPVNSGDLV  57

Query  455  STGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNIS  634
            S+G+YIVTVGLG P K L+L+FDTGSDL+WT+C PC+++CY Q E +F+P +ST+Y NIS
Sbjct  58   SSGDYIVTVGLGTPQKQLSLIFDTGSDLSWTRCRPCIRSCYKQMEPLFDPSISTSYVNIS  117

Query  635  CSAAACSGLTSATGNNPGCS--SSTCVYGIQYGDSSFSVGFFA  757
            C +  CS LT  T   P CS  +STC+Y +QYGD SFSVGFF+
Sbjct  118  CKSNVCSQLTPVTHKIPRCSIDNSTCIYDMQYGDKSFSVGFFS  160



>ref|XP_010928894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=459

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 119/177 (67%), Gaps = 21/177 (12%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGK-DNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ASLKVVH+HG CS      +P    IL++D+SRVN+IH R  ++ +   NA +       
Sbjct  58   ASLKVVHRHGPCSPLHLKQSPDHKQILDRDQSRVNAIHTRTTASTL-QANAAN-------  109

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                  ++PA +G +L TGNY+VTVG G P +  +++FDTGSD+TW QC PC  +CY Q+
Sbjct  110  ------SIPAHTGDSLGTGNYVVTVGFGTPRRDQSVIFDTGSDVTWIQCRPC-PSCYQQR  162

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E +F+P  S+TY+NISCS++ CS L  ++     C+SSTCVYG+QYGD+S++ GF+A
Sbjct  163  EPLFDPSHSSTYANISCSSSYCSDLDLSS-----CTSSTCVYGVQYGDNSYTTGFWA  214



>ref|XP_003532147.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=482

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 141/231 (61%), Gaps = 30/231 (13%)
 Frame = +2

Query  98   EKGIASESLTEST---HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS  268
            EK  A ++  ES     +H V L SLFP++ C       ++KG +R ASL+VVHKHG CS
Sbjct  23   EKSFAFQATKESNNLRQYHFVHLNSLFPSSSCSS-----SAKGPKRKASLEVVHKHGPCS  77

Query  269  ----TGK-DNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVP  433
                +GK + T +  DI+N D  RV  I +R++         + G  R K++  +   +P
Sbjct  78   QLNHSGKAEATISHNDIMNLDNERVKYIQSRLS-------KNLGGENRVKELDST--TLP  128

Query  434  AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLS  613
            AKSG  + + +Y V VGLG P + L+L+FDTGS LTWTQCEPC  +CY QQ+ IF+P  S
Sbjct  129  AKSGRLIGSADYYVVVGLGTPKRDLSLIFDTGSYLTWTQCEPCAGSCYKQQDPIFDPSKS  188

Query  614  TTYSNISCSAAACSGLTSATGNNPGCSSST---CVYGIQYGDSSFSVGFFA  757
            ++Y+NI C+++ C+   SA     GCSSST   C+Y ++YGD+S S GF +
Sbjct  189  SSYTNIKCTSSLCTQFRSA-----GCSSSTDASCIYDVKYGDNSISRGFLS  234



>ref|XP_010422811.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=467

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 114/178 (64%), Gaps = 22/178 (12%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            L+VVH HG CS   + KD      +IL +D++RV SIH+++        N   GV + K 
Sbjct  65   LRVVHMHGACSHLSSNKDARLDHDEILRRDQARVKSIHSKLLK------NNADGVSKAKS  118

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                   +PAK G+TL + NYIVTVG+G P   ++LVFDTGSDLTWTQC+PC+ +CY+QQ
Sbjct  119  -----TELPAKDGSTLDSANYIVTVGIGTPEHDISLVFDTGSDLTWTQCQPCLGSCYSQQ  173

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST-CVYGIQYGDSSFSVGFFA  757
            E IFNP LS++Y N+SCS+  C       GN+P C+S T C Y I+YGD S ++G  A
Sbjct  174  EPIFNPSLSSSYHNVSCSSPMC-------GNHPSCNSVTSCRYRIRYGDGSATIGVLA  224



>ref|XP_008220628.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Prunus 
mume]
Length=503

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 121/187 (65%), Gaps = 24/187 (13%)
 Frame = +2

Query  236  LKVVHKHGGCS---------TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG CS         T   +      IL QD++RVNSIH+R+N    +N      
Sbjct  80   LKVVHKHGPCSKFHKSSKTSTTTSDERYHAQILKQDQARVNSIHSRLNHNNNNN------  133

Query  389  VGRKKKIPDSKAA---VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
               + K P +++A   +PAKSG  + + NYIVTVGLG P K L+L+FDTGSDLTWTQC+P
Sbjct  134  ---RMKDPLTQSAATTLPAKSGIVIGSPNYIVTVGLGTPAKQLSLIFDTGSDLTWTQCQP  190

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYGDS  733
            C  +CY Q+  IF+P LS +Y NISC+ A+C+ L+S +G   GCSSST  C+Y   YGD+
Sbjct  191  CAGSCYKQRGPIFDPSLSASYKNISCTTASCTQLSS-SGIEHGCSSSTSACLYAAGYGDN  249

Query  734  SFSVGFF  754
            SF++G F
Sbjct  250  SFTIGVF  256



>gb|KCW80527.1| hypothetical protein EUGRSUZ_C01881, partial [Eucalyptus grandis]
Length=413

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 117/177 (66%), Gaps = 13/177 (7%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPT-LTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++L +VHKHG  S   D  P   T +L +D +RV  I ++++       N++SG    K 
Sbjct  2    SALNLVHKHGPGSQLFDGGPINHTKVLLEDMARVKWIQSKIS-------NSISGTSDLK-  53

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
              +S  ++PA  G+  S+  Y+VTVGLG PTK+LTL+FDTGS LTWTQCEPC+ +CY Q 
Sbjct  54   --ESNVSLPASYGSGGSS--YVVTVGLGTPTKNLTLLFDTGSALTWTQCEPCIGSCYNQT  109

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IFNP  S++Y+NISCSA +C  L S T    GCS STCVYG  YGD+SF+ GFFA
Sbjct  110  EPIFNPSRSSSYANISCSAPSCIQLPSGTDQLTGCSGSTCVYGASYGDASFTDGFFA  166



>gb|KCW80528.1| hypothetical protein EUGRSUZ_C01882, partial [Eucalyptus grandis]
Length=463

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 14/177 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPT-LTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++LK+VHK+G CS   D  P   T +L +D +RV  I ++++       N++SG    K 
Sbjct  58   STLKLVHKYGPCSQLFDGGPINHTQVLLEDMARVKWIQSKIS-------NSISGTSDLK-  109

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
              +S  ++PA + T  + G Y+VT+GLG PTK LTL+FDTGS LTWTQCEPC+ +CY+Q 
Sbjct  110  --ESNVSLPASNST--NGGGYVVTIGLGTPTKDLTLLFDTGSALTWTQCEPCI-SCYSQA  164

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IF+P  S++Y+NISC A +C GL S TG  PGCS S C+YG  YGD S +VG FA
Sbjct  165  EPIFDPSNSSSYANISCFAPSCIGLASGTGELPGCSGSRCIYGTGYGDGSSTVGLFA  221



>ref|XP_010050794.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=466

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 14/177 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPT-LTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++LK+VHK+G CS   D  P   T +L +D +RV  I ++++       N++SG    K 
Sbjct  58   STLKLVHKYGPCSQLFDGGPINHTQVLLEDMARVKWIQSKIS-------NSISGTSDLK-  109

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
              +S  ++PA + T  + G Y+VT+GLG PTK LTL+FDTGS LTWTQCEPC+ +CY+Q 
Sbjct  110  --ESNVSLPASNST--NGGGYVVTIGLGTPTKDLTLLFDTGSALTWTQCEPCI-SCYSQA  164

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IF+P  S++Y+NISC A +C GL S TG  PGCS S C+YG  YGD S +VG FA
Sbjct  165  EPIFDPSNSSSYANISCFAPSCIGLASGTGELPGCSGSRCIYGTGYGDGSSTVGLFA  221



>gb|ACN85284.1| aspartic proteinase nepenthesin-1 precursor [Oryza australiensis]
Length=519

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 114/197 (58%), Gaps = 29/197 (15%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKD---NTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            G  + +VH+HG CS   D     P+  DIL  D++R  SI  RV++      N      R
Sbjct  84   GTRMTIVHRHGPCSPLADAHGKPPSHEDILAADQNRAESIQHRVSTTATGRGNPK----R  139

Query  398  KKKIPDSK-----------------AAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDT  526
             ++ P  +                 A++PA SG  L TGNY+VTVGLG P    T+VFDT
Sbjct  140  SRRAPSRRQQPSSAPAPAASLSSSTASLPASSGRALGTGNYVVTVGLGTPASRYTVVFDT  199

Query  527  GSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTC  706
            GSD TW QC+PCV  CY Q+E +F+P  S+TY+NISC+A ACS L     +  GCS   C
Sbjct  200  GSDTTWVQCQPCVVVCYEQREKLFDPARSSTYANISCAAPACSDL-----DTRGCSGGNC  254

Query  707  VYGIQYGDSSFSVGFFA  757
            +YG+QYGD S+S+GFFA
Sbjct  255  LYGVQYGDGSYSIGFFA  271



>ref|XP_009391894.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=476

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 114/178 (64%), Gaps = 15/178 (8%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            L V H+HG CS        +   IL +D  RV+ +H +++S+        S    K +  
Sbjct  63   LTVAHRHGPCSPLHHRQVLSHQQILERDRFRVDWLHRQISSS------PTSATKVKVQPQ  116

Query  413  DSK---AAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
            DS    +A+PA+SG++L  GNY+VTVG G P +  T+VFDTGSD+TW QC+PC   CY Q
Sbjct  117  DSAVEASAIPARSGSSLGVGNYVVTVGFGTPKRDQTVVFDTGSDVTWIQCQPCASYCYLQ  176

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+ IF+P  S+TY+NISC +A CS L     +  GCSSSTC+YG++YGD S+++GFFA
Sbjct  177  QDPIFDPSHSSTYANISCGSAYCSDL-----DVSGCSSSTCLYGVKYGDKSYTIGFFA  229



>ref|XP_010050793.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=469

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 117/177 (66%), Gaps = 13/177 (7%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPT-LTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++L +VHKHG  S   D  P   T +L +D +RV  I ++++       N++SG    K 
Sbjct  58   SALNLVHKHGPGSQLFDGGPINHTKVLLEDMARVKWIQSKIS-------NSISGTSDLK-  109

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
              +S  ++PA  G+  S+  Y+VTVGLG PTK+LTL+FDTGS LTWTQCEPC+ +CY Q 
Sbjct  110  --ESNVSLPASYGSGGSS--YVVTVGLGTPTKNLTLLFDTGSALTWTQCEPCIGSCYNQT  165

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IFNP  S++Y+NISCSA +C  L S T    GCS STCVYG  YGD+SF+ GFFA
Sbjct  166  EPIFNPSRSSSYANISCSAPSCIQLPSGTDQLTGCSGSTCVYGASYGDASFTDGFFA  222



>ref|XP_010422810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=469

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 21/179 (12%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL+VVH HG CS   + KD +    +IL  D++RV SI ++++       N   GV   
Sbjct  63   SSLRVVHMHGACSHLSSNKDASLDHEEILRHDQARVESIRSKLSK------NNADGVSMT  116

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
            K        +PAKSG TL +GNYIVT+G+G P   ++L FDTGSDLTWTQC+PC+ +CY+
Sbjct  117  KS-----TKLPAKSGITLGSGNYIVTIGIGTPKHDISLAFDTGSDLTWTQCKPCLGSCYS  171

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IFNP  S++Y N+SCS+  C        N   C  S CVYGI YGD+SF+ GFFA
Sbjct  172  QKEPIFNPSSSSSYHNVSCSSPVCK-------NGTTCLDSNCVYGIVYGDNSFTRGFFA  223



>ref|XP_002873474.1| hypothetical protein ARALYDRAFT_909035 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49733.1| hypothetical protein ARALYDRAFT_909035 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 113/179 (63%), Gaps = 21/179 (12%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL+VVH HG CS   + KD      +IL +DE+RV SIH++++       N    V + 
Sbjct  63   SSLRVVHMHGACSHLSSNKDARLDHDEILRRDEARVESIHSKLSK------NIADEVSKA  116

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
            K        +PAK+G  L + NYIVT+G+G P   ++L+FDTGSDLTWTQCEPC+ +CY+
Sbjct  117  KS-----TKLPAKNGIILGSPNYIVTIGIGTPKHDISLMFDTGSDLTWTQCEPCLGSCYS  171

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E  FNP  S++Y N+SCS+  C       GN   CS+S C+YGI YGD S +VGF A
Sbjct  172  QKEPKFNPSSSSSYHNVSCSSPMC-------GNPESCSASNCLYGIGYGDGSVTVGFLA  223



>ref|XP_007226285.1| hypothetical protein PRUPE_ppa019577mg [Prunus persica]
 gb|EMJ27484.1| hypothetical protein PRUPE_ppa019577mg [Prunus persica]
Length=454

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 114/188 (61%), Gaps = 28/188 (15%)
 Frame = +2

Query  236  LKVVHKHGGCS---------TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG CS         T   +      IL QD++RVNSIH+R+N            
Sbjct  35   LKVVHKHGPCSKFHKSSKTSTTTSDEKYHAQILEQDQARVNSIHSRLNH-----------  83

Query  389  VGRKKKIPDSKAA---VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
                 K P +++A   +PAKSG  + +GNYIVTV LG P K L+LVFDTGSDLTWTQC+P
Sbjct  84   --NNNKDPLTQSAATTLPAKSGIVIGSGNYIVTVSLGTPAKQLSLVFDTGSDLTWTQCQP  141

Query  560  C--VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDS  733
            C   ++CY Q E IFNP LS +Y  I C+ AAC+ L S +G    CS+STC+Y   YGD+
Sbjct  142  CPTTRSCYKQTEPIFNPSLSASYKKIPCTTAACTQLPS-SGLEQSCSASTCLYIAVYGDN  200

Query  734  SFSVGFFA  757
            SFS G F 
Sbjct  201  SFSKGVFG  208



>ref|XP_010068511.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Eucalyptus 
grandis]
Length=413

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 122/180 (68%), Gaps = 19/180 (11%)
 Frame = +2

Query  224  RGASLKVVHKHGGCS-TGKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            R ++L+VVHKHG CS   +D  P   T +L QDESRV  I ++ ++   D L A      
Sbjct  7    RKSTLEVVHKHGPCSPLVQDPNPLNHTKVLLQDESRVKWIQSQSSNGS-DGLKA------  59

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
                  + A++PAKSG T+ TGNY+VT+GLG P K LTL FDTGSD+TWTQCEPC  +CY
Sbjct  60   -----SATASLPAKSGITIGTGNYVVTIGLGTPKKDLTLEFDTGSDITWTQCEPCAGSCY  114

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             Q E IFNP  S++Y+NISC+A +CS L+S+      CS STC+YGI+YGD S+SVG FA
Sbjct  115  NQSEPIFNPSQSSSYANISCTATSCSQLSSSG-----CSGSTCLYGIRYGDGSYSVGIFA  169



>gb|ACN85339.1| aspartic proteinase nepenthesin-1 precursor [Oryza granulata]
Length=521

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 116/197 (59%), Gaps = 30/197 (15%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKD---NTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            G  + +VH+HG CS   D     P+  +IL  D++RV SIH RV++        V G  +
Sbjct  87   GTRMTIVHRHGPCSPLADAHGKPPSHDEILAADQNRVESIHHRVSTT-----ATVRGKPK  141

Query  398  KKKIPDSK-----------------AAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDT  526
            ++  P  +                 A++PA SG  L TGNY+VT+GLG P    T+VFDT
Sbjct  142  RRPSPSRRQQQPSAPAPAASLSSSTASLPASSGRALGTGNYVVTIGLGTPASRYTVVFDT  201

Query  527  GSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTC  706
            GSD TW QC+PCV  CY QQE +F+P  S+TY+N+SC+A ACS L +      GCS   C
Sbjct  202  GSDTTWVQCQPCVVVCYKQQEKLFDPARSSTYANVSCAAPACSDLYTR-----GCSGGHC  256

Query  707  VYGIQYGDSSFSVGFFA  757
            +Y +QYGD S+S+GFFA
Sbjct  257  LYSVQYGDGSYSIGFFA  273



>ref|NP_196637.1| aspartyl protease family protein [Arabidopsis thaliana]
 emb|CAB96831.1| nucleoid DNA-binding protein cnd41-like protein [Arabidopsis 
thaliana]
 gb|AAL59990.1| putative nucleoid DNA-binding protein cnd41 [Arabidopsis thaliana]
 gb|AAM91722.1| putative nucleoid DNA-binding protein cnd41 [Arabidopsis thaliana]
 dbj|BAE98588.1| nucleoid DNA-binding protein cnd41 - like protein [Arabidopsis 
thaliana]
 gb|AED91593.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=464

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 112/177 (63%), Gaps = 19/177 (11%)
 Frame = +2

Query  230  ASLKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            +SL+VVH HG CS    D      +I+ +D++RV SI+++++       N+ + V   K 
Sbjct  63   SSLRVVHMHGACSHLSSDARVDHDEIIRRDQARVESIYSKLSK------NSANEVSEAKS  116

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                   +PAKSG TL +GNYIVT+G+G P   L+LVFDTGSDLTWTQCEPC+ +CY+Q+
Sbjct  117  -----TELPAKSGITLGSGNYIVTIGIGTPKHDLSLVFDTGSDLTWTQCEPCLGSCYSQK  171

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E  FNP  S+TY N+SCS+  C    S       CS+S CVY I YGD SF+ GF A
Sbjct  172  EPKFNPSSSSTYQNVSCSSPMCEDAES-------CSASNCVYSIVYGDKSFTQGFLA  221



>gb|KCW63888.1| hypothetical protein EUGRSUZ_G01561 [Eucalyptus grandis]
Length=449

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 122/184 (66%), Gaps = 19/184 (10%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCS-TGKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNAVS  385
            K   R ++L+VVHKHG CS   +D  P   T +L QDESRV  I ++ ++   D L A  
Sbjct  39   KASSRKSTLEVVHKHGPCSPLVQDPNPLNHTKVLLQDESRVKWIQSQSSNGS-DGLKA--  95

Query  386  GVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCV  565
                      + A++PAKSG T+ TGNY+VT+GLG P K LTL FDTGSD+TWTQCEPC 
Sbjct  96   ---------SATASLPAKSGITIGTGNYVVTIGLGTPKKDLTLEFDTGSDITWTQCEPCA  146

Query  566  KTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSV  745
             +CY Q E IFNP  S++Y+NISC+A +CS L+S+       S STC+YGI+YGD S+SV
Sbjct  147  GSCYNQSEPIFNPSQSSSYANISCTATSCSQLSSSGC-----SGSTCLYGIRYGDGSYSV  201

Query  746  GFFA  757
            G FA
Sbjct  202  GIFA  205



>gb|AAN60226.1| unknown [Arabidopsis thaliana]
Length=464

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 112/177 (63%), Gaps = 19/177 (11%)
 Frame = +2

Query  230  ASLKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            +SL+VVH HG CS    D      +I+ +D++RV SI+++++       N+ + V   K 
Sbjct  63   SSLRVVHMHGACSHLSSDARVDHDEIIRRDQARVESIYSKLSK------NSANEVSEAKS  116

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                   +PAKSG TL +GNYIVT+G+G P   L+LVFDTGSDLTWTQCEPC+ +CY+Q+
Sbjct  117  -----TELPAKSGITLGSGNYIVTIGIGTPKHDLSLVFDTGSDLTWTQCEPCLGSCYSQK  171

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E  FNP  S+TY N+SCS+  C    S       CS+S CVY I YGD SF+ GF A
Sbjct  172  EPKFNPSSSSTYQNVSCSSPMCEDAES-------CSASNCVYSIGYGDKSFTQGFLA  221



>ref|XP_010928895.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=464

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 127/207 (61%), Gaps = 20/207 (10%)
 Frame = +2

Query  140  FHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGK-DNTPTLTDILNQD  316
            +HT+ + +L P   C     + +       ASLKVVH+HG CS  +    P    +L++D
Sbjct  32   YHTIDIQTLLPRDVCSSTEASPSPSPSPSRASLKVVHRHGPCSPLRLKQNPDHKQMLDRD  91

Query  317  ESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNP  496
            +SRVN+IH R  +      NA +             ++PA +G +L TGNY+VTVG G P
Sbjct  92   QSRVNAIHTRTTTNADLQANAAN-------------SIPAHTGDSLGTGNYVVTVGFGTP  138

Query  497  TKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATG  676
             +  +++FDTGSD+TW QC PC  +CY Q+E +F+P  S+TY+NISCS++ CS L  ++ 
Sbjct  139  RRDQSVIFDTGSDVTWIQCRPC-PSCYQQREPVFDPSHSSTYANISCSSSYCSELDLSS-  196

Query  677  NNPGCSSSTCVYGIQYGDSSFSVGFFA  757
                C+SSTCVYG+QYGD+S++ GF A
Sbjct  197  ----CTSSTCVYGVQYGDNSYTTGFLA  219



>gb|ACN85177.1| aspartic proteinase nepenthesin-1 precursor [Oryza nivara]
 gb|ACN85193.1| aspartic proteinase nepenthesin-1 precursor [Oryza rufipogon]
Length=515

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 111/187 (59%), Gaps = 18/187 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            + +VH+HG CS         P+  +IL  D+SR  SI  RV++   D +N      R+++
Sbjct  89   MTIVHRHGPCSPLAAAHGEPPSHGEILAADQSRAESIQHRVSTTTTDRVNPKRSRHRQQQ  148

Query  407  IPDSKAAVP----------AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
             P + A             A  G  L TGNY+VTVGLG P    T+VFDTGSD TW QC+
Sbjct  149  PPSAPAPAASLSSSTASLPASPGRALGTGNYVVTVGLGTPASRYTVVFDTGSDTTWVQCQ  208

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PCV  CY Q+E +F+P  S+TY+N+SC+A ACS L     +  GCS   C+YG+QYGD S
Sbjct  209  PCVVACYEQREKLFDPASSSTYANVSCAAPACSDL-----DVSGCSGGHCLYGVQYGDGS  263

Query  737  FSVGFFA  757
            +S+GFFA
Sbjct  264  YSIGFFA  270



>ref|XP_004295359.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 134/221 (61%), Gaps = 24/221 (11%)
 Frame = +2

Query  110  ASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDNTP  289
            + E L    + HTV L SL P T C+       +KG +R  SL++VHKHG CS    +  
Sbjct  28   SKERLLHEQYTHTVDLRSLLPATTCNPY-----TKGNKRKTSLELVHKHGPCSHLPQHKV  82

Query  290  TLTD---ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLST  460
            T T+   IL QD++RVNSI++R++      LN    +G+ +        +P++  T+   
Sbjct  83   TATNHTQILEQDQARVNSINSRISK----KLNGNDDLGQSEA-----TTLPSRWATSRGA  133

Query  461  GNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCS  640
            GNYIVTVGLG P K L+L FDTGS LTWTQC+PCV  CY Q + IF+P  ST+Y+ ISC+
Sbjct  134  GNYIVTVGLGTPNKQLSLEFDTGSFLTWTQCQPCVSYCYPQNDPIFDPAASTSYTKISCN  193

Query  641  AAACSGLTSATGNNPGCSSS--TCVYGIQYGDSSFSVGFFA  757
            +A C+ L  +      C S+  TC+Y + YGD S+++GFF+
Sbjct  194  SAECAQLRRSQ-----CLSTANTCLYQVIYGDESYTIGFFS  229



>gb|ACN85278.1| aspartic proteinase nepenthesin-1 precursor [Oryza alta]
Length=518

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 112/197 (57%), Gaps = 29/197 (15%)
 Frame = +2

Query  227  GASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            G  + +VH+HG CS         P+  DIL  D++R  SI  RV++      N      R
Sbjct  83   GTRMTIVHRHGPCSPLAAAHGKPPSHEDILAADQNRAESIQHRVSTTATARGNPK----R  138

Query  398  KKKIPDSK-----------------AAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDT  526
             ++ P  +                 A++PA SG  L TGNY+VTVGLG P    T+VFDT
Sbjct  139  SRRAPSRRQQPSSAPAPAASLSSSTASLPASSGRALGTGNYVVTVGLGTPASRYTVVFDT  198

Query  527  GSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTC  706
            GSD TW QC+PCV  CY QQE +F+P  S+TY+N+SC+A AC  L     +  GCS   C
Sbjct  199  GSDTTWVQCQPCVVVCYEQQEKLFDPARSSTYANVSCAAPACFDL-----DTRGCSGGHC  253

Query  707  VYGIQYGDSSFSVGFFA  757
            +YG+QYGD S+S+GFFA
Sbjct  254  LYGVQYGDGSYSIGFFA  270



>ref|XP_008811141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=464

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 114/177 (64%), Gaps = 18/177 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            LKVVH HG CS  G    P+   +LN+D++RV+S+H R+++A            R+    
Sbjct  60   LKVVHPHGPCSPIGTGREPSHAKLLNRDQARVDSLHHRISTAS----------SRESTRS  109

Query  413  DSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK-TCYTQQE  589
               A +PA +G +L TGNYIVTVG G P   LT+VFDTGSDLTW QC+PC   +CY QQ+
Sbjct  110  SLAATIPASTGGSLGTGNYIVTVGFGTPKSDLTVVFDTGSDLTWIQCKPCSSGSCYPQQQ  169

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS-SSTCVYGIQYGDSSFSVGFFA  757
             +F+P  S+TYSNISCS+  CS L S+T     CS SS C Y I+YGD+S S G+F+
Sbjct  170  PLFDPSQSSTYSNISCSSPECSLLDSST-----CSASSPCRYDIEYGDNSQSSGYFS  221



>ref|XP_002309514.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE93037.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=474

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 140/223 (63%), Gaps = 23/223 (10%)
 Frame = +2

Query  98   EKGIASESLTE-STHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTG  274
            +KG A E+      + HT+ + SL  +  C Q     +SK + + +SL+V+HK+G C   
Sbjct  28   KKGYAVEANEHIKKYVHTLEVNSLLASDSCDQ-----SSKVIDKASSLQVLHKYGPCMQV  82

Query  275  KDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTL  454
              N  +  + L QD+ RV+SI AR        L+ +SG G  +++      +PA+SG  +
Sbjct  83   L-NDRSHVEFLLQDQLRVDSIQAR--------LSKISGHGIFEEM---VTKLPAQSGIAI  130

Query  455  STGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNIS  634
             TGNY+VTVGLG P +  TLVFDTGS +TWTQC+PC+ +CY Q+E  F+P  ST+Y+N+S
Sbjct  131  GTGNYVVTVGLGTPKEDFTLVFDTGSGITWTQCQPCLGSCYPQKEQKFDPTKSTSYNNVS  190

Query  635  CSAAACSGLTSATGNNPGCSS--STCVYGIQYGDSSFSVGFFA  757
            CS+A+C+ L ++     GCS+  STC+Y I YGD S+S GFFA
Sbjct  191  CSSASCNLLPTS---ERGCSASNSTCLYQIIYGDQSYSQGFFA  230



>emb|CDY40117.1| BnaC02g00130D [Brassica napus]
Length=477

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 126/180 (70%), Gaps = 15/180 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL V H+HG CS+   +    +P   +IL  D++RVNSI ++++    D +       R
Sbjct  63   SSLHVTHRHGTCSSLTSDKATTSPDHAEILRLDQARVNSIQSKLSKKLTDRV-------R  115

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
            + K      A+PAK G+   +GNY+V+VG+G P +  +L+FDTGSDLTW QCEPCV+TCY
Sbjct  116  QSK----STALPAKDGSIFGSGNYVVSVGIGTPKRDQSLIFDTGSDLTWIQCEPCVQTCY  171

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            +Q+  IFNP  S++Y N+SCS+AACS L+SATGN+  CS+STCVYGIQYGD SFSVGF A
Sbjct  172  SQKAPIFNPSSSSSYYNVSCSSAACSSLSSATGNSGSCSASTCVYGIQYGDQSFSVGFLA  231



>ref|XP_004965901.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=499

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 112/199 (56%), Gaps = 24/199 (12%)
 Frame = +2

Query  215  GLRRGASLKVVHKHGGCSTGKDN---TPTLTDILNQDESRVNSIHARVNSARIDNLNAVS  385
            G   G  + +VH+HG CS   D     P+ ++IL  D+ RV  IH RV S          
Sbjct  60   GASTGTRMPIVHQHGPCSPLADKRGKAPSHSEILAADQRRVEYIHRRV-SETTGGARPKR  118

Query  386  GVGRKKKIPDSKAA---------------VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVF  520
            G    +  P + +A               +PA SG  L  GNY+VT+GLG P++  T+VF
Sbjct  119  GAAPVQLRPGAPSATTPASSASSYATSANLPASSGQALGAGNYVVTIGLGTPSERFTVVF  178

Query  521  DTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS  700
            DTGSD TW QC PCV  CY QQE +F+P  S++Y+NISCS++ C  L ++     GC   
Sbjct  179  DTGSDTTWVQCRPCVAYCYRQQEPLFSPAKSSSYANISCSSSYCDDLDAS-----GCDGG  233

Query  701  TCVYGIQYGDSSFSVGFFA  757
             C+YG+QYGD S+++GFFA
Sbjct  234  HCLYGVQYGDGSYTIGFFA  252



>dbj|BAJ94237.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 114/191 (60%), Gaps = 20/191 (10%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKD---NTPTLTDILNQDESRVNSIHARVNSA----RIDNLNAVSG  388
            A +++VH+HG CS   D     P   +IL  D++RV SI  RV++     ++    A   
Sbjct  69   ARMRIVHQHGPCSPLADAHGKPPAHDEILAADQNRVESIQRRVSATTGRDKLTKHAAPVQ  128

Query  389  VGRKKK--------IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTW  544
             G KK            S  ++PA SG  +STGNY+VTVGLG P    T+VFDTGSD TW
Sbjct  129  PGPKKSPGIHPGHSASSSTPSLPATSGRAVSTGNYVVTVGLGTPASKYTVVFDTGSDTTW  188

Query  545  TQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQY  724
             QC PCV  CY Q+E +F+P  S+TY+N+SC+ +AC+ L     +  GC+   C+Y +QY
Sbjct  189  VQCRPCVVKCYKQKEPLFDPAKSSTYANVSCTDSACADL-----DTNGCTGGHCLYAVQY  243

Query  725  GDSSFSVGFFA  757
            GD S++VGFFA
Sbjct  244  GDGSYTVGFFA  254



>gb|KCW64008.1| hypothetical protein EUGRSUZ_G01690, partial [Eucalyptus grandis]
Length=413

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 108/178 (61%), Gaps = 15/178 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCST-GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++LK+VHKHG CS          T  L +D +R   I ++            SG      
Sbjct  2    STLKLVHKHGPCSPLFNGELANYTQFLLEDSARAKWIRSQF-----------SGTNTAND  50

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
            +  S  +V A+ G     G+Y+VTVGLG P K LTL+FDTGS LTWTQCEPCV +CY Q 
Sbjct  51   LKGSAVSVKAQYGP--GGGSYLVTVGLGTPKKDLTLLFDTGSALTWTQCEPCVVSCYNQT  108

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD-SSFSVGFFA  757
            E IF+P  S++Y+NISCS+ +CS L S TG  P C  STCVY +QYGD  SF+VGFFA
Sbjct  109  EAIFDPSQSSSYANISCSSPSCSQLPSGTGRQPRCIDSTCVYEVQYGDRESFTVGFFA  166



>ref|XP_007224537.1| hypothetical protein PRUPE_ppa024411mg [Prunus persica]
 gb|EMJ25736.1| hypothetical protein PRUPE_ppa024411mg [Prunus persica]
Length=489

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 120/189 (63%), Gaps = 27/189 (14%)
 Frame = +2

Query  236  LKVVHKHGGCS---------TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            LKVVHKHG CS         T   +      IL QD++RVNSIH+R+N     N N+   
Sbjct  65   LKVVHKHGPCSKFHKSSKTSTTTSDEKYHAQILKQDQARVNSIHSRLN----HNNNS---  117

Query  389  VGRKKKIPDSKAA---VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
               + K P +++A   +PAKSG  + + NYIVTVGLG P K L+LVFDTGSDLTWTQC+ 
Sbjct  118  ---RIKDPLTQSAATTLPAKSGIVIGSPNYIVTVGLGTPAKQLSLVFDTGSDLTWTQCKA  174

Query  560  C--VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYG  727
            C   ++CY Q E IF+P LS +Y NISC+ AAC+ L+S +G    CS+ST  C+Y   YG
Sbjct  175  CSATQSCYNQTEPIFDPSLSASYKNISCTTAACTQLSS-SGIEHRCSASTSACLYAAGYG  233

Query  728  DSSFSVGFF  754
            D SF++G F
Sbjct  234  DMSFTIGVF  242



>gb|ACN85210.1| aspartic proteinase nepenthesin-1 precursor [Oryza glaberrima]
Length=516

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 110/187 (59%), Gaps = 18/187 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            + +VH+HG CS         P+  +IL  D+SR  SI  RV++     +N      R+++
Sbjct  90   MTIVHRHGPCSPLAAAHGEPPSHGEILAADQSRAESIQHRVSTTTTGRVNPKRSRHRQQQ  149

Query  407  IPDSKAAVP----------AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
             P + A             A  G  L TGNY+VTVGLG P    T+VFDTGSD TW QC+
Sbjct  150  PPSAPAPAASLSSSTASLPASPGRALGTGNYVVTVGLGTPASRYTVVFDTGSDTTWVQCQ  209

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PCV  CY Q+E +F+P  S+TY+N+SC+A ACS L     +  GCS   C+YG+QYGD S
Sbjct  210  PCVVACYEQREKLFDPASSSTYANVSCAAPACSDL-----DVSGCSGGHCLYGVQYGDGS  264

Query  737  FSVGFFA  757
            +S+GFFA
Sbjct  265  YSIGFFA  271



>gb|ACN85264.1| aspartic proteinase nepenthesin-1 precursor [Oryza alta]
Length=517

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 110/192 (57%), Gaps = 30/192 (16%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            + +VH+HG CS         P+  +IL  D++R  SI  RV++         +G G+ K+
Sbjct  90   MTIVHRHGPCSPLAAAHRKPPSHGEILAADQNRAESIQHRVSTT-------ATGRGKPKR  142

Query  407  IPDSKAAVP---------------AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLT  541
                + +                 A SG  L TGNY+VTVGLG P    T+VFDTGSD T
Sbjct  143  SRRQQPSSAPAPAASLSSSTASLPASSGRALGTGNYVVTVGLGTPASRYTVVFDTGSDTT  202

Query  542  WTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQ  721
            W QC+PCV  CY QQE +F+P  S+TY+N+SC+A ACS L     N  GCS   C+YG+Q
Sbjct  203  WVQCQPCVVVCYEQQEKLFDPVRSSTYANVSCAAPACSDL-----NIHGCSGGHCLYGVQ  257

Query  722  YGDSSFSVGFFA  757
            YGD S+S+GFFA
Sbjct  258  YGDGSYSIGFFA  269



>ref|XP_009122026.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=435

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 119/189 (63%), Gaps = 29/189 (15%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNT----PTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL+VVH+HG CS+         P   DIL  D++RV SIH++++               
Sbjct  60   SSLQVVHRHGPCSSLSSEKAKTGPNHDDILRLDQTRVKSIHSKLS---------------  104

Query  398  KKKIPDSKAA------VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
            KK  P  + +      + A+ G+TL +GNYIVTVG+G P   L+LVFDTGSDLTWTQCEP
Sbjct  105  KKLTPQYRVSQSQSTDLEARDGSTLGSGNYIVTVGIGTPKHDLSLVFDTGSDLTWTQCEP  164

Query  560  CVK---TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD  730
            C K   +CY Q+E IFNP  ST+YSN+SCS+  C  LTS  G    CS+S C+YG+ YGD
Sbjct  165  CGKNGTSCYPQEEPIFNPSSSTSYSNVSCSSPVCDSLTSQ-GYYRNCSASNCIYGVGYGD  223

Query  731  SSFSVGFFA  757
            SSF+VGF A
Sbjct  224  SSFTVGFLA  232



>gb|ACN85242.1| aspartic proteinase nepenthesin-1 precursor [Oryza minuta]
Length=519

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 110/192 (57%), Gaps = 30/192 (16%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            + +VH+HG CS         P+  +IL  D++R  SI  RV++         +G G+ K+
Sbjct  92   MTIVHRHGPCSPLAAAHRKPPSHGEILAADQNRAESIQHRVSTT-------ATGRGKPKR  144

Query  407  IPDSKAAVP---------------AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLT  541
                + +                 A SG  L TGNY+VTVGLG P    T+VFDTGSD T
Sbjct  145  SRRQQPSSAPAPAASLSSSTASLPASSGRALGTGNYVVTVGLGTPASRYTVVFDTGSDTT  204

Query  542  WTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQ  721
            W QC+PCV  CY Q+E +F+P  S+TY+N+SC+A ACS L     N  GCS   C+YG+Q
Sbjct  205  WVQCQPCVVVCYEQREKLFDPARSSTYANVSCAAPACSDL-----NIHGCSGGHCLYGVQ  259

Query  722  YGDSSFSVGFFA  757
            YGD S+S+GFFA
Sbjct  260  YGDGSYSIGFFA  271



>ref|XP_010491756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
Length=417

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 113/182 (62%), Gaps = 22/182 (12%)
 Frame = +2

Query  224  RGASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVG  394
            + +SL VVH HG CS   + KD      +IL +D++RV SIH++++       N   GV 
Sbjct  10   KKSSLPVVHMHGACSHLSSNKDARLDHDEILRRDQARVKSIHSKLSK------NNADGVS  63

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
              K        +PAK GTT+ + NYIVT+G+G P   ++L FDTGS LTWTQC+PC+++C
Sbjct  64   MTKS-----TELPAKDGTTIGSANYIVTIGIGTPKHDVSLTFDTGSGLTWTQCQPCLESC  118

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST-CVYGIQYGDSSFSVGF  751
            Y+QQE IFNP  S++Y N+SCS+  C       GNN  C+S T C YGI+Y D S ++G 
Sbjct  119  YSQQEPIFNPSTSSSYQNVSCSSPMC-------GNNSSCNSGTNCRYGIRYADGSVTIGV  171

Query  752  FA  757
             A
Sbjct  172  LA  173



>ref|NP_001058055.1| Os06g0610800 [Oryza sativa Japonica Group]
 dbj|BAD35493.1| putative nucleoid DNA-binding protein cnd41, chloroplast [Oryza 
sativa Japonica Group]
 dbj|BAF19969.1| Os06g0610800 [Oryza sativa Japonica Group]
 gb|EEC80962.1| hypothetical protein OsI_23679 [Oryza sativa Indica Group]
Length=519

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 110/187 (59%), Gaps = 18/187 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            + +VH+HG CS         P+  +IL  D+SR  SI  RV++     +N      R+++
Sbjct  93   MTIVHRHGPCSPLAAAHGEPPSHGEILAADQSRAESIQHRVSTTTTGRVNPKRRRHRQQQ  152

Query  407  IPDSKAAVP----------AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
             P + A             A  G  L TGNY+VTVGLG P    T+VFDTGSD TW QC+
Sbjct  153  PPSAPAPAASLSSSTASLPASPGRALGTGNYVVTVGLGTPASRYTVVFDTGSDTTWVQCQ  212

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PCV  CY Q+E +F+P  S+TY+N+SC+A ACS L     +  GCS   C+YG+QYGD S
Sbjct  213  PCVVACYEQREKLFDPASSSTYANVSCAAPACSDL-----DVSGCSGGHCLYGVQYGDGS  267

Query  737  FSVGFFA  757
            +S+GFFA
Sbjct  268  YSIGFFA  274



>gb|ACN85252.1| aspartic proteinase nepenthesin-1 precursor [Oryza officinalis]
Length=519

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 110/192 (57%), Gaps = 30/192 (16%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            + +VH+HG CS         P+  +IL  D++R  SI  RV++         +G G+ K+
Sbjct  92   MTIVHRHGPCSPLAAAHRKPPSHGEILAADQNRAESIQHRVSTT-------ATGRGKPKR  144

Query  407  IPDSKAAVP---------------AKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLT  541
                + +                 A SG  L TGNY+VTVGLG P    T+VFDTGSD T
Sbjct  145  SRRQQPSSAPAPAASLSSSTASLPASSGRALGTGNYVVTVGLGTPVSRYTVVFDTGSDTT  204

Query  542  WTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQ  721
            W QC+PCV  CY Q+E +F+P  S+TY+N+SC+A ACS L     N  GCS   C+YG+Q
Sbjct  205  WVQCQPCVVVCYEQREKLFDPARSSTYANVSCAAPACSDL-----NIHGCSGGHCLYGVQ  259

Query  722  YGDSSFSVGFFA  757
            YGD S+S+GFFA
Sbjct  260  YGDGSYSIGFFA  271



>ref|XP_011019522.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011019526.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011019528.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Populus euphratica]
Length=474

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 137/223 (61%), Gaps = 23/223 (10%)
 Frame = +2

Query  98   EKGIASESLTE-STHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTG  274
            +KG A E+      + HT+ + SL  +  C+Q     +SK + + +SL+V HK+G C   
Sbjct  28   KKGYAVEANEHIKKYVHTLEVNSLLASDSCNQ-----SSKVIDKASSLQVQHKYGPCMQV  82

Query  275  KDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTL  454
              N  +    L QD+ RV+SI A+++       N+  G+       +    +PA+SG  +
Sbjct  83   L-NDRSHVQFLLQDQLRVDSIQAKLSK------NSGHGI-----FEEMVTKLPARSGIAI  130

Query  455  STGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNIS  634
             TGNY+VTVGLG P K  TL FDTGSD+TWTQC+PC+ +CY Q+E  F+P  ST+Y+N+S
Sbjct  131  GTGNYVVTVGLGTPKKDFTLEFDTGSDITWTQCQPCLGSCYPQKEQKFDPTKSTSYNNVS  190

Query  635  CSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGFFA  757
            CS+A+C+ L ++     GC  SSSTC+Y + YGD S+S GFFA
Sbjct  191  CSSASCNLLPTS---QRGCSASSSTCLYQVIYGDQSYSQGFFA  230



>gb|ACN85307.1| aspartic proteinase nepenthesin-1 precursor [Oryza ridleyi]
Length=525

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 111/200 (56%), Gaps = 32/200 (16%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKD----NTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVG  394
            G  + +VH+HG CS   D      P+  +IL+ D++R  SI  RV++       A  G  
Sbjct  87   GTRMPIVHRHGPCSPLADAHGGKPPSHEEILDADQNRAESIQRRVST----TTTAARGKP  142

Query  395  RKKKIPDSKAAVPAKSGT-------------------TLSTGNYIVTVGLGNPTKSLTLV  517
            ++ +   S+   P+ S                      L TGNY+VT+GLG P    T+V
Sbjct  143  KRNRPSPSRRQQPSSSAPAPGASLSSSAASLPASSGRALGTGNYVVTIGLGTPAGRYTVV  202

Query  518  FDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS  697
            FDTGSD TW QCEPCV  CY QQE +F+P  S+T +NISC+A ACS L +      GCS 
Sbjct  203  FDTGSDTTWVQCEPCVVVCYEQQEKLFDPARSSTDANISCAAPACSDLYTK-----GCSG  257

Query  698  STCVYGIQYGDSSFSVGFFA  757
              C+YG+QYGD S+S+GFFA
Sbjct  258  GHCLYGVQYGDGSYSIGFFA  277



>ref|XP_010453109.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=423

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 111/177 (63%), Gaps = 21/177 (12%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            L VVH HG CS   + KD +    +IL  D++RV SI ++++       N   GV   K 
Sbjct  65   LPVVHMHGACSHLSSNKDASLDHDEILRYDQARVESIRSKLSK------NNADGVSMTKS  118

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                   +PAKS  TL +GNYIVTVG+G P  +++L FDTGSDLTWTQC+PC+ +CY+Q+
Sbjct  119  -----TKLPAKSAITLGSGNYIVTVGIGTPKHNISLAFDTGSDLTWTQCKPCLGSCYSQK  173

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IFNP  S++Y N+SCS+  C   T+  G+N       CVYGI YGD+SF+ GF A
Sbjct  174  EPIFNPSSSSSYHNVSCSSPVCKNGTTCLGSN-------CVYGIVYGDNSFTRGFLA  223



>dbj|BAJ92731.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 113/191 (59%), Gaps = 20/191 (10%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKD---NTPTLTDILNQDESRVNSIHARVNSA----RIDNLNAVSG  388
            A +++VH+HG CS   D     P   +IL  D++RV SI  RV++     ++    A   
Sbjct  69   ARMRIVHQHGPCSPLADAHGKPPAHDEILAADQNRVESIQRRVSATTGRDKLTKHAAPVQ  128

Query  389  VGRKKK--------IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTW  544
             G KK            S  ++PA SG  +STGNY+VTVGLG P    T+VFDTGSD TW
Sbjct  129  PGPKKSPGIHPGHSASSSTPSLPATSGRAVSTGNYVVTVGLGTPASKYTVVFDTGSDTTW  188

Query  545  TQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQY  724
             QC PCV  CY Q+  +F+P  S+TY+N+SC+ +AC+ L     +  GC+   C+Y +QY
Sbjct  189  VQCRPCVVKCYKQKGPLFDPAKSSTYANVSCTDSACADL-----DTNGCTGGHCLYAVQY  243

Query  725  GDSSFSVGFFA  757
            GD S++VGFFA
Sbjct  244  GDGSYTVGFFA  254



>ref|XP_010068575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=709

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 107/177 (60%), Gaps = 15/177 (8%)
 Frame = +2

Query  233  SLKVVHKHGGCST-GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKI  409
            +LK+VHKHG CS          T  L +D +R   I ++            SG      +
Sbjct  299  TLKLVHKHGPCSPLFNGELANYTQFLLEDSARAKWIRSQF-----------SGTNTANDL  347

Query  410  PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQE  589
              S  +V A+ G     G+Y+VTVGLG P K LTL+FDTGS LTWTQCEPCV +CY Q E
Sbjct  348  KGSAVSVKAQYGP--GGGSYLVTVGLGTPKKDLTLLFDTGSALTWTQCEPCVVSCYNQTE  405

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD-SSFSVGFFA  757
             IF+P  S++Y+NISCS+ +CS L S TG  P C  STCVY +QYGD  SF+VGFFA
Sbjct  406  AIFDPSQSSSYANISCSSPSCSQLPSGTGRQPRCIDSTCVYEVQYGDRESFTVGFFA  462



>ref|XP_008379455.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=510

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 134/241 (56%), Gaps = 30/241 (12%)
 Frame = +2

Query  98   EKGIASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC----  265
            EKG A     +    HTV L SL P T C      H  K    G+ L+VVH+HG C    
Sbjct  31   EKGFALAGRKDKLTHHTVQLNSLLPATTCTPSTKGHNKK---HGSVLEVVHRHGPCYEPN  87

Query  266  ----STGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAA--  427
                 T  D     T    QD++RV+SI++R+ + +  +            IP +++   
Sbjct  88   QHKTKTATDLHEYFTQFFKQDQARVDSIYSRLKATKRYSTKT------DDNIPITQSEDT  141

Query  428  --VPAKSGTTLS-TGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCV------KTCYT  580
               PA S  T+  +GNY+V VGLG P KS +LVFDTGSDLTWTQC+PC        TCY 
Sbjct  142  NTFPAPSARTVGGSGNYVVKVGLGTPAKSFSLVFDTGSDLTWTQCQPCRFGTGSDLTCYD  201

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGFF  754
            Q E I++P LST+Y+NISC+ A C+ LTSAT   P C  +++TC+Y I YGD+S S G++
Sbjct  202  QTEPIYDPSLSTSYANISCNTATCNELTSATSTGPYCYRATNTCLYLIGYGDNSTSAGYY  261

Query  755  A  757
             
Sbjct  262  G  262



>emb|CDY72573.1| BnaAnng41520D [Brassica napus]
Length=435

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 118/189 (62%), Gaps = 29/189 (15%)
 Frame = +2

Query  230  ASLKVVHKHGGCST----GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL+VVH+HG CS+        +P   DIL  D+  V SIH++++               
Sbjct  60   SSLQVVHRHGPCSSLSSEKARTSPNHDDILRLDQIHVKSIHSKLS---------------  104

Query  398  KKKIPDSKAA------VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
            KK  P  + +      + A+ G+TL +GNYIVTVG+G P   L+LVFDTGSDLTWTQCEP
Sbjct  105  KKLTPQYRVSQSQSTDLEARDGSTLGSGNYIVTVGIGTPKHDLSLVFDTGSDLTWTQCEP  164

Query  560  CVK---TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD  730
            C K   +CY Q+E IFNP  ST+YSN+SCS+  C  LTS  G    CS+S C+YG+ YGD
Sbjct  165  CGKNGTSCYPQEEPIFNPSSSTSYSNVSCSSPVCDSLTSQ-GYYRNCSASNCIYGVGYGD  223

Query  731  SSFSVGFFA  757
            SSF+VGF A
Sbjct  224  SSFTVGFLA  232



>gb|ACN85225.1| aspartic proteinase nepenthesin-1 precursor [Oryza punctata]
 gb|ACN85232.1| aspartic proteinase nepenthesin-1 precursor [Oryza minuta]
Length=516

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 109/185 (59%), Gaps = 16/185 (9%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNS--------ARIDNLNAV  382
            + +VH+HG CS         P+  +IL  D++R  SI  RV++         R       
Sbjct  91   MTIVHRHGPCSPLAAAHSKPPSHDEILAADQNRAESIQHRVSTTATSRGQPKRSRRQQPS  150

Query  383  SGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPC  562
            S       +  S A++PA  G  L TGNY+VTVGLG P    T+VFDTGSD TW QC+PC
Sbjct  151  SAPAPAASLSSSTASLPASPGRALGTGNYVVTVGLGTPASRYTVVFDTGSDTTWVQCQPC  210

Query  563  VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFS  742
            V  CY Q+E +F+P  S+TY+N+SC+A ACS L     +  GCS   C+YG+QYGD S+S
Sbjct  211  VVVCYEQREKLFDPARSSTYANVSCAAPACSDL-----DTRGCSGGHCLYGVQYGDGSYS  265

Query  743  VGFFA  757
            +GFFA
Sbjct  266  IGFFA  270



>ref|XP_010491755.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
Length=468

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 110/178 (62%), Gaps = 22/178 (12%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            L VVH HG CS   + KD      +IL +D++RV SIH++++       N   GV   K 
Sbjct  65   LPVVHMHGACSHLSSNKDARLDHDEILRRDQARVKSIHSKLSK------NNADGVSMTKS  118

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                   +PAK GTT+ + NYIVT+G+G P   ++L FDTGS LTWTQC+PC+++CY+QQ
Sbjct  119  -----TELPAKDGTTIGSANYIVTIGIGTPKHDVSLTFDTGSGLTWTQCQPCLESCYSQQ  173

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST-CVYGIQYGDSSFSVGFFA  757
            E IFNP  S++Y N+SCS+  C       GNN  C+S T C YGI+Y D S ++G  A
Sbjct  174  EPIFNPSTSSSYQNVSCSSPMC-------GNNSSCNSGTNCRYGIRYADGSVTIGVLA  224



>ref|XP_010491757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X3 [Camelina sativa]
Length=469

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 110/178 (62%), Gaps = 22/178 (12%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            L VVH HG CS   + KD      +IL +D++RV SIH++++       N   GV   K 
Sbjct  65   LPVVHMHGACSHLSSNKDARLDHDEILRRDQARVKSIHSKLSK------NNADGVSMTKS  118

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                   +PAK GTT+ + NYIVT+G+G P   ++L FDTGS LTWTQC+PC+++CY+QQ
Sbjct  119  -----TELPAKDGTTIGSANYIVTIGIGTPKHDVSLTFDTGSGLTWTQCQPCLESCYSQQ  173

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST-CVYGIQYGDSSFSVGFFA  757
            E IFNP  S++Y N+SCS+  C       GNN  C+S T C YGI+Y D S ++G  A
Sbjct  174  EPIFNPSTSSSYQNVSCSSPMC-------GNNSSCNSGTNCRYGIRYADGSVTIGVLA  224



>gb|KCW63886.1| hypothetical protein EUGRSUZ_G01558 [Eucalyptus grandis]
Length=446

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 105/156 (67%), Gaps = 21/156 (13%)
 Frame = +2

Query  302  ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTV  481
            +L QDESRV  I ++ ++   D L A            + A++PAKSG T+ TGNY+VT+
Sbjct  61   VLLQDESRVKWIQSQSSNGS-DGLKA-----------SAAASLPAKSGITIGTGNYVVTI  108

Query  482  GLGNPTKSLTLVFDTGSDL----TWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAA  649
            GLG P K LTL FDTGS++    TWTQC+PC  +CYT  E IFNP  S++Y+NISC+A +
Sbjct  109  GLGTPKKDLTLAFDTGSNITSISTWTQCKPCAGSCYTLSEPIFNPSKSSSYANISCTATS  168

Query  650  CSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            CS L  +     GCS+STC+YGIQY D S+SVGFFA
Sbjct  169  CSQLGIS-----GCSASTCLYGIQYADKSYSVGFFA  199



>gb|KCW63885.1| hypothetical protein EUGRSUZ_G01557 [Eucalyptus grandis]
Length=419

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 123/181 (68%), Gaps = 18/181 (10%)
 Frame = +2

Query  224  RGASLKVVHKHGGCST-GKDNTP-TLTDILNQDESRVNSIHAR-VNSARIDNLNAVSGVG  394
            R ++L+V+HKHG CS   +D  P   T IL QDESRV  I ++  NS+  D+L +++   
Sbjct  7    RKSTLEVIHKHGPCSQLVQDQNPLNHTKILLQDESRVKWIQSKSFNSS--DSLKSLA---  61

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
                     A++PAKSG T+ TGNY+V VGLG P K+LTL+FDTGS LTWTQC+PCV +C
Sbjct  62   --------VASLPAKSGITIGTGNYLVNVGLGTPKKNLTLIFDTGSPLTWTQCQPCVGSC  113

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y Q + IFNP  S++YSN+SC++ ACS L+S  G +    + TC Y I+YGD+S S GFF
Sbjct  114  YNQSDPIFNPSQSSSYSNVSCASTACSQLSSGHGGSR--CNGTCQYSIRYGDNSSSTGFF  171

Query  755  A  757
            A
Sbjct  172  A  172



>ref|XP_010266604.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=482

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 112/188 (60%), Gaps = 22/188 (12%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCST----GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNA  379
            +GL     L++VHK+G CS     GK  TP+L +I  QDE RV SIH+ +N+        
Sbjct  54   EGLDHSRKLQLVHKNGPCSPLSVEGK-TTPSLQEIFLQDELRVRSIHSLINN--------  104

Query  380  VSGVGRKKKIPDSKAAV-PAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
                 ++  + DSKA V P KSG  L TGNYIV +GLG P +   +  DTGSDLTW QC+
Sbjct  105  -----QQHPLGDSKATVLPTKSGVALGTGNYIVXIGLGTPXQDFXVXXDTGSDLTWIQCQ  159

Query  557  PC--VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD  730
            PC     CY Q    F+P  S++YS I+C +A CS + SAT  +P C+S+ C+Y   YGD
Sbjct  160  PCPNXPXCYXQSGPTFDPSKSSSYSGITCGSAECSHVYSATFYSPPCNSA-CIYEAHYGD  218

Query  731  SSFSVGFF  754
             SFS+G F
Sbjct  219  QSFSIGLF  226



>ref|XP_010066087.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=476

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 125/186 (67%), Gaps = 18/186 (10%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCST-GKDNTP-TLTDILNQDESRVNSIHAR-VNSARIDNLNA  379
            +K   R ++L+V+HKHG CS   +D  P   T IL QDESRV  I ++  NS+  D+L +
Sbjct  59   TKASNRKSTLEVIHKHGPCSQLVQDQNPLNHTKILLQDESRVKWIQSKSFNSS--DSLKS  116

Query  380  VSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
            ++            A++PAKSG T+ TGNY+V VGLG P K+LTL+FDTGS LTWTQC+P
Sbjct  117  LA-----------VASLPAKSGITIGTGNYLVNVGLGTPKKNLTLIFDTGSPLTWTQCQP  165

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            CV +CY Q + IFNP  S++YSN+SC++ ACS L+S  G +    + TC Y I+YGD+S 
Sbjct  166  CVGSCYNQSDPIFNPSQSSSYSNVSCASTACSQLSSGHGGSR--CNGTCQYSIRYGDNSS  223

Query  740  SVGFFA  757
            S GFFA
Sbjct  224  STGFFA  229



>ref|XP_010491754.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=468

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 110/179 (61%), Gaps = 21/179 (12%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL VVH HG CS   + KD +    +IL  D++RV SI ++++       N   GV   
Sbjct  62   SSLPVVHMHGACSHLSSNKDASLDHDEILRYDQARVESIRSKLSK------NNADGVSMT  115

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
            K        +  KSG TL +GNYIVT+ +G P   ++L FDTGSDLTWTQC+PC+ +CY+
Sbjct  116  KS-----TKLTVKSGITLGSGNYIVTIVIGTPKHDISLAFDTGSDLTWTQCKPCLGSCYS  170

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E +FNP LS++Y N+SCS+  C        N   C  S CVYG++YGD+SF+ GF A
Sbjct  171  QKEPLFNPSLSSSYHNVSCSSPVCK-------NGTTCLDSNCVYGLRYGDNSFTRGFLA  222



>ref|XP_010913225.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=463

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 108/174 (62%), Gaps = 17/174 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            LKVVH+HG CS       P  T++L+QD++RVN +H  ++++            +K    
Sbjct  60   LKVVHRHGPCSPLTPGQKPDYTELLSQDQARVNWLHHWISTSS----------NQKSTRA  109

Query  413  DSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQET  592
               A +PA SG ++ TGNY+V VG G PTK  T+VFDTGSDLTW QC PC ++CY QQ+ 
Sbjct  110  SLAANIPASSGGSIGTGNYVVNVGFGTPTKEFTVVFDTGSDLTWIQCSPC-RSCYPQQQQ  168

Query  593  IFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            +F+P  S+TYSNISC++  CS L S++     C +  C Y + YGD S S GFF
Sbjct  169  LFDPSRSSTYSNISCNSPKCSQLDSSS-----CLAGRCRYEVDYGDKSQSEGFF  217



>ref|XP_011019525.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
 ref|XP_011019527.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
 ref|XP_011019529.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Populus euphratica]
Length=472

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 118/182 (65%), Gaps = 17/182 (9%)
 Frame = +2

Query  218  LRRGASLKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            + + +SL+V HK+G C     N  +    L QD+ RV+SI A+        L+  SG G 
Sbjct  62   IDKASSLQVQHKYGPCMQVL-NDRSHVQFLLQDQLRVDSIQAK--------LSKNSGHGI  112

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
             +++      +PA+SG  + TGNY+VTVGLG P K  TL FDTGSD+TWTQC+PC+ +CY
Sbjct  113  FEEM---VTKLPARSGIAIGTGNYVVTVGLGTPKKDFTLEFDTGSDITWTQCQPCLGSCY  169

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGF  751
             Q+E  F+P  ST+Y+N+SCS+A+C+ L ++     GC  SSSTC+Y + YGD S+S GF
Sbjct  170  PQKEQKFDPTKSTSYNNVSCSSASCNLLPTS---QRGCSASSSTCLYQVIYGDQSYSQGF  226

Query  752  FA  757
            FA
Sbjct  227  FA  228



>ref|XP_010065985.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
 gb|KCW63734.1| hypothetical protein EUGRSUZ_G01380 [Eucalyptus grandis]
Length=419

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 121/181 (67%), Gaps = 18/181 (10%)
 Frame = +2

Query  224  RGASLKVVHKHGGCS--TGKDNTPTLTDILNQDESRVNSIHAR-VNSARIDNLNAVSGVG  394
            R ++L+V+HKHG CS      N    T IL QDESRV  I ++  NS+  D+L +++   
Sbjct  7    RKSTLEVIHKHGPCSQLVHDQNPLNHTKILLQDESRVKWIQSKSFNSS--DSLKSLA---  61

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
                     A++PAKSG T+ TGNY+V VGLG P K+LTL+FDTGS LTWTQC+PCV +C
Sbjct  62   --------VASLPAKSGITIGTGNYLVNVGLGTPKKNLTLIFDTGSPLTWTQCQPCVGSC  113

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y Q + IFNP  S++YSN+SC++ ACS L+S  G +    + TC Y I+YGD+S S GFF
Sbjct  114  YNQSDPIFNPSQSSSYSNVSCASTACSQLSSGHGGSR--CNGTCQYSIRYGDNSSSTGFF  171

Query  755  A  757
            A
Sbjct  172  A  172



>ref|NP_001168472.1| hypothetical protein [Zea mays]
 gb|ACN28327.1| unknown [Zea mays]
Length=434

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 109/200 (55%), Gaps = 39/200 (20%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK  403
            + VVH+HG CS   DN     P+  +IL  D+ R   IH RV           +G  R++
Sbjct  1    MPVVHQHGPCSPLADNRNGKAPSHAEILAADQRRAEYIHRRVAE--------TTGRARRR  52

Query  404  KI-------PDSKAA---------------VPAKSGTTLSTGNYIVTVGLGNPTKSLTLV  517
            K        P +  +               +PA  G  L TGNY+V V LG P +  T+V
Sbjct  53   KQGAPVELRPGTPPSSIVVPSSSSATSTTDLPASYGVALGTGNYVVPVRLGTPAERFTVV  112

Query  518  FDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS  697
            FDTGSD TW QC+PCV  CY Q+E +F+P  S TY+NISCS++ CS L  +     GCS 
Sbjct  113  FDTGSDTTWVQCQPCVAYCYRQKEPLFDPTKSATYANISCSSSYCSDLYVS-----GCSG  167

Query  698  STCVYGIQYGDSSFSVGFFA  757
              C+YGIQYGD S+++GF+A
Sbjct  168  GHCLYGIQYGDGSYTIGFYA  187



>gb|KDO67375.1| hypothetical protein CISIN_1g017894mg [Citrus sinensis]
Length=364

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  422  AAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFN  601
            A +PA  G+ + +GNYIVTVG+G P +  +L+FDTGSDLTWTQC+PCV  CY Q+E IF+
Sbjct  7    ATLPAIHGSVVGSGNYIVTVGIGTPKRKFSLIFDTGSDLTWTQCKPCVGFCYQQKEKIFD  66

Query  602  PKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFSVGFFA  757
            PK S +Y N+SCS+  CS L SATGN PGC+S+ TCVYGIQYGDSSFSVGFFA
Sbjct  67   PKRSKSYRNVSCSSTVCSSLESATGNIPGCASNKTCVYGIQYGDSSFSVGFFA  119



>ref|XP_010256103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=476

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 131/219 (60%), Gaps = 24/219 (11%)
 Frame = +2

Query  110  ASESLTESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS-TGKDNT  286
            A+  +TE +H H + + SL PTT C       +SKG +R   L+VVH+ G CS  G + T
Sbjct  30   ANGGVTEQSHHHVIGVNSLLPTTVCSS-----SSKGAKRPGLLQVVHRSGPCSPLGHEKT  84

Query  287  PTLT--DILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLST  460
              L+      QD+ RV+SIH+ +++   D L       +  K+  S+  +PAKSG +L T
Sbjct  85   TDLSSEQFFIQDQERVDSIHSALSTG--DAL-------QDSKVSSSR--LPAKSGRSLGT  133

Query  461  GNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCS  640
            GN++VTVG G P + LTLVFDTGSDLTW QC PC   CY Q E IFNP  S++YSN+ CS
Sbjct  134  GNFVVTVGFGTPKQHLTLVFDTGSDLTWIQCLPC-SHCYQQSEPIFNPSKSSSYSNLRCS  192

Query  641  AAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            +  CS  +S + N     +S C Y IQY D+S+S G  A
Sbjct  193  STRCSKQSSKSSN----CTSLCKYIIQYADNSYSSGLLA  227



>ref|XP_008648080.1| PREDICTED: uncharacterized protein LOC100382248 isoform X1 [Zea 
mays]
 gb|AFW76337.1| hypothetical protein ZEAMMB73_223549 [Zea mays]
 gb|AFW76338.1| hypothetical protein ZEAMMB73_223549 [Zea mays]
Length=499

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 109/200 (55%), Gaps = 39/200 (20%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDN----TPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK  403
            + VVH+HG CS   DN     P+  +IL  D+ R   IH RV           +G  R++
Sbjct  66   MPVVHQHGPCSPLADNRNGKAPSHAEILAADQRRAEYIHRRVAE--------TTGRARRR  117

Query  404  KI-------PDSKAA---------------VPAKSGTTLSTGNYIVTVGLGNPTKSLTLV  517
            K        P +  +               +PA  G  L TGNY+V V LG P +  T+V
Sbjct  118  KQGAPVELRPGTPPSSIVVPSSSSATSTTDLPASYGVALGTGNYVVPVRLGTPAERFTVV  177

Query  518  FDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS  697
            FDTGSD TW QC+PCV  CY Q+E +F+P  S TY+NISCS++ CS L  +     GCS 
Sbjct  178  FDTGSDTTWVQCQPCVAYCYRQKEPLFDPTKSATYANISCSSSYCSDLYVS-----GCSG  232

Query  698  STCVYGIQYGDSSFSVGFFA  757
              C+YGIQYGD S+++GF+A
Sbjct  233  GHCLYGIQYGDGSYTIGFYA  252



>gb|KCW44809.1| hypothetical protein EUGRSUZ_L01628 [Eucalyptus grandis]
Length=419

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 18/181 (10%)
 Frame = +2

Query  224  RGASLKVVHKHGGCS--TGKDNTPTLTDILNQDESRVNSIHAR-VNSARIDNLNAVSGVG  394
            R ++L+V+HKHG CS      N    T IL QDESRV  I ++  NS+  D+L +++   
Sbjct  7    RKSTLEVIHKHGPCSQLVHDQNPLNHTKILLQDESRVKWIQSKSFNSS--DSLKSLA---  61

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
                     A++PAKSG T+ TGNY+V VGLG P K+LTL+FDTGS LTWTQC+PCV +C
Sbjct  62   --------VASLPAKSGITIGTGNYLVNVGLGTPKKNLTLIFDTGSPLTWTQCQPCVGSC  113

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y Q + IFNP  S++YSN+SC++ ACS L+S  G +    + TC Y I YGD+S S GFF
Sbjct  114  YNQSDPIFNPSQSSSYSNVSCASTACSQLSSGHGGSR--CNGTCQYSILYGDNSSSTGFF  171

Query  755  A  757
            A
Sbjct  172  A  172



>ref|XP_010040897.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=476

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 122/186 (66%), Gaps = 18/186 (10%)
 Frame = +2

Query  209  SKGLRRGASLKVVHKHGGCS--TGKDNTPTLTDILNQDESRVNSIHAR-VNSARIDNLNA  379
            +K   R ++L+V+HKHG CS      N    T IL QDESRV  I ++  NS+  D+L +
Sbjct  59   TKASNRKSTLEVIHKHGPCSQLVHDQNPLNHTKILLQDESRVKWIQSKSFNSS--DSLKS  116

Query  380  VSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
            ++            A++PAKSG T+ TGNY+V VGLG P K+LTL+FDTGS LTWTQC+P
Sbjct  117  LA-----------VASLPAKSGITIGTGNYLVNVGLGTPKKNLTLIFDTGSPLTWTQCQP  165

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            CV +CY Q + IFNP  S++YSN+SC++ ACS L+S  G +    + TC Y I YGD+S 
Sbjct  166  CVGSCYNQSDPIFNPSQSSSYSNVSCASTACSQLSSGHGGSR--CNGTCQYSILYGDNSS  223

Query  740  SVGFFA  757
            S GFFA
Sbjct  224  STGFFA  229



>ref|XP_008779067.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Phoenix dactylifera]
Length=442

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 110/179 (61%), Gaps = 20/179 (11%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLT--DILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            G  L VVH+HG CS   +    L    IL++D++RV S+H R+++A            RK
Sbjct  36   GNKLTVVHRHGPCSPIINTRQKLNHRQILHRDQARVISLHNRISAAS-----------RK  84

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             K   +   VP   G + ST +YIVTVG G P KS +++FDTGSD++W QC PC   CY+
Sbjct  85   DK--STGITVPDHVGISFSTSDYIVTVGFGTPKKSFSVIFDTGSDISWIQCRPCAGGCYS  142

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q ET+F+P  S+TY+NISCS+A C    SA       +SSTC+Y ++YGD+S +VGF A
Sbjct  143  QNETLFDPSQSSTYANISCSSAVCLSFGSACD-----ASSTCIYAVRYGDNSSTVGFLA  196



>gb|KDP33484.1| hypothetical protein JCGZ_07055 [Jatropha curcas]
Length=465

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 127/208 (61%), Gaps = 33/208 (16%)
 Frame = +2

Query  143  HTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS---TGKDNTPTLTDILNQ  313
            HT+ +++LFP+T C       ++K     A+LKVVH+ G C+       N+P +++IL +
Sbjct  44   HTIEVSNLFPSTACKH-----STKVAENSATLKVVHRRGSCNHLNQDNANSPNVSEILLE  98

Query  314  DESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAA-VPAKSGTTLSTGNYIVTVGLG  490
            D+SRV+SIHAR++          SG      + ++KA  +PAK G +L T NYIVT+GLG
Sbjct  99   DQSRVDSIHARISK--------TSG-----NLEETKATRLPAKIGASLGTSNYIVTIGLG  145

Query  491  NPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSA  670
             P K L +VFDTGSDLTWT+C+P V T        F+P  S +Y+NISC +  C   TS 
Sbjct  146  TPKKDLPVVFDTGSDLTWTRCKPQVDT--------FDPTKSASYANISCRSQLC---TST  194

Query  671  TGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
             G    CSSSTC YG+QYGD S+S GF 
Sbjct  195  GGGRSICSSSTCAYGVQYGDGSYSAGFL  222



>ref|XP_010068543.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=417

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 106/178 (60%), Gaps = 15/178 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++LK+VHKHG CS          T  L +D +R   I ++            SG      
Sbjct  6    STLKLVHKHGPCSPLFNGELANYTQFLLEDSARAKWIRSQF-----------SGTNTAND  54

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
            +  S  +V AK G      +Y+VT+GLG P K LTL+FDTGS LTWTQCEPC+ +CY Q 
Sbjct  55   LKGSAVSVQAKYGP--GGESYLVTIGLGTPKKDLTLLFDTGSALTWTQCEPCIGSCYNQT  112

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGD-SSFSVGFFA  757
            E IF+P  S++Y+N SCS+ +CS L S TG  PGC  STCVY  +YGD  SF++GFFA
Sbjct  113  EAIFDPSQSSSYANTSCSSPSCSQLPSGTGRQPGCIDSTCVYDQRYGDRESFTMGFFA  170



>ref|XP_008806169.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=405

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 109/176 (62%), Gaps = 19/176 (11%)
 Frame = +2

Query  236  LKVVHKHGGCST-GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            +KVVH+HG CS       P    +LNQD++RVN +  ++         +++  G +  + 
Sbjct  2    MKVVHRHGPCSPLTPGRKPANIKLLNQDQARVNWLQRQI---------SIASNGTRASL-  51

Query  413  DSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK-TCYTQQE  589
                 +PA SG ++ TGNY+V+VG G P K  T++FDTGSD+TW QC+PC    CY+QQ+
Sbjct  52   --ATTIPANSGGSIGTGNYVVSVGFGTPKKDFTVIFDTGSDITWIQCQPCSDGNCYSQQQ  109

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             +F+P  S+TYSNISCS+ +C  L S     P CS+  C Y ++YGD+S S+GFF 
Sbjct  110  PLFDPSQSSTYSNISCSSPSCMKLDS-----PDCSAGRCRYEVEYGDNSQSMGFFG  160



>gb|KFK25358.1| hypothetical protein AALP_AA8G103000 [Arabis alpina]
Length=469

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 106/179 (59%), Gaps = 15/179 (8%)
 Frame = +2

Query  230  ASLKVVHKHGGCS-TGKDNT--PTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL+VVH+HG CS    DN   P   DIL +D+ RVNSIH +++    D +         
Sbjct  55   SSLRVVHRHGPCSPRSSDNAANPDQDDILRRDQERVNSIHVKLSKKFTDGVR--------  106

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
               P     +PAK G TL   NYIVT+G+G P   ++L+FDTGSDLTW QCEPC   CY 
Sbjct  107  ---PSQSTDLPAKDGRTLGYVNYIVTIGIGTPKHDMSLIFDTGSDLTWIQCEPCAGFCYP  163

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q+E +FNP  S++YSN SC +  C  L+SA G    CS   C Y I YGD SFS GF A
Sbjct  164  QKEPVFNPSSSSSYSNYSCLSPECGSLSSA-GVRSFCSPPDCGYRIGYGDKSFSEGFLA  221



>gb|KCW63938.1| hypothetical protein EUGRSUZ_G01615 [Eucalyptus grandis]
Length=480

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 120/206 (58%), Gaps = 22/206 (11%)
 Frame = +2

Query  146  TVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS-TGKDNTPTLTDILNQDES  322
            T+P++SLFP+ +C    T  +S       +LK+VHKHG CS          T  L +D +
Sbjct  48   TLPVSSLFPSPNCKASTTNGSS-------TLKLVHKHGPCSPLFNGELANYTQFLLEDSA  100

Query  323  RVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTK  502
            R   I ++            SG      +  S  +V AK G      +Y+VT+GLG P K
Sbjct  101  RAKWIRSQF-----------SGTNTANDLKGSAVSVQAKYGP--GGESYLVTIGLGTPKK  147

Query  503  SLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNN  682
             LTL+FDTGS LTWTQCEPC+ +CY Q E IF+P  S++Y+N SCS+ +CS L S TG  
Sbjct  148  DLTLLFDTGSALTWTQCEPCIGSCYNQTEAIFDPSQSSSYANTSCSSPSCSQLPSGTGRQ  207

Query  683  PGCSSSTCVYGIQYGD-SSFSVGFFA  757
            PGC  STCVY  +YGD  SF++GFFA
Sbjct  208  PGCIDSTCVYDQRYGDRESFTMGFFA  233



>ref|XP_006287706.1| hypothetical protein CARUB_v10000913mg [Capsella rubella]
 gb|EOA20604.1| hypothetical protein CARUB_v10000913mg [Capsella rubella]
Length=461

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 106/177 (60%), Gaps = 20/177 (11%)
 Frame = +2

Query  236  LKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            ++VVH HG CS   T KD      +IL +D++RV SI ++++       N   G     K
Sbjct  60   VRVVHMHGACSHLRTNKDARLDHEEILRRDQARVESIRSKLSK------NIADGSVSMTK  113

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
                   +PAK G+ L + NYI+TVG+G P   L+LVFDTGSDLTWTQC+PC+K+CY+Q 
Sbjct  114  ----STELPAKDGSILGSANYIITVGIGTPKHDLSLVFDTGSDLTWTQCQPCLKSCYSQT  169

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E IFN   S++Y N+ CS+  C        N   CS S C+Y + YGD+SF+ GF A
Sbjct  170  EPIFNASSSSSYHNVPCSSQMCE-------NAASCSDSKCLYEVLYGDNSFTQGFLA  219



>ref|XP_002437273.1| hypothetical protein SORBIDRAFT_10g023970 [Sorghum bicolor]
 gb|EER88640.1| hypothetical protein SORBIDRAFT_10g023970 [Sorghum bicolor]
Length=503

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 111/195 (57%), Gaps = 26/195 (13%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDN-----TPTLTDILNQDESRVNSIHARVN--SARIDNLNAVSGVG  394
            + +VH+HG CS   D+      P+ T+IL  D+ RV  IH RV+  + R+      + V 
Sbjct  67   MPIVHQHGPCSPLADDKHGKKAPSHTEILVADQRRVEYIHRRVSETTGRVRRQKHSAPVV  126

Query  395  RKKK--------------IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGS  532
              +                  +   +PAKSG +L+TGNY+V + LG P    T+VFDTGS
Sbjct  127  ELRPGTPSSTRSSSSSLSSSATSTNLPAKSGLSLNTGNYVVPIRLGTPAARFTVVFDTGS  186

Query  533  DLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVY  712
            D TW QC+PCV  CY Q+E +F P  S TY+NISC+++ CS L     +  GCS   C+Y
Sbjct  187  DTTWVQCQPCVAYCYQQKEPLFTPTKSATYANISCTSSYCSDL-----DTRGCSGGHCLY  241

Query  713  GIQYGDSSFSVGFFA  757
             +QYGD S++VGF+A
Sbjct  242  AVQYGDGSYTVGFYA  256



>ref|XP_006287688.1| hypothetical protein CARUB_v10000896mg [Capsella rubella]
 gb|EOA20586.1| hypothetical protein CARUB_v10000896mg [Capsella rubella]
Length=465

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 118/187 (63%), Gaps = 21/187 (11%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLN  376
            +SK     +S++VVH HG CS   + KD +    +IL  D++RV SI +++  ++ +N +
Sbjct  54   SSKAPNTKSSIRVVHMHGTCSHLRSNKDASLDHDEILRCDQARVESIRSKL--SKKNNAD  111

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
             +S +            + A  G TL + NYIVTVG+G P   L+LVFDTGSDLTWTQC+
Sbjct  112  GISMI--------KSTELQATIGKTLGSANYIVTVGIGTPKHDLSLVFDTGSDLTWTQCQ  163

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSS  736
            PC+ +CY+Q+E IFNP  S++Y N+SCS+  C      TG    CS+S CVYGI YGD+S
Sbjct  164  PCLGSCYSQKEPIFNPSSSSSYHNVSCSSPICK-----TG---ACSASNCVYGILYGDNS  215

Query  737  FSVGFFA  757
            F+ GF +
Sbjct  216  FTRGFLS  222



>ref|XP_010913305.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=636

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 115/180 (64%), Gaps = 19/180 (11%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLT--DILNQDESRVNSIHARVNSARID-NLNAVSGVGR  397
            G  L VVH+HG CS   +    L+   IL++D++RV S+H R++++R D +  +++GV  
Sbjct  227  GNRLTVVHQHGPCSPLINPRQRLSHRKILHRDQARVVSLHNRISTSRKDKSAGSLAGV--  284

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
                      VP + G + ST +Y+VTVG G P K  T++FDTGSD++W QC+PC   CY
Sbjct  285  ---------TVPNRVGISFSTLDYVVTVGFGTPKKHFTVIFDTGSDISWIQCQPCAGGCY  335

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             Q+ET+F+P  S+TY+NISC++A C    S        +SSTC+Y ++YGD S++VGF A
Sbjct  336  AQKETLFDPSQSSTYANISCTSADCLSFGSYCD-----ASSTCIYSVEYGDGSYTVGFLA  390



>ref|XP_003563633.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brachypodium 
distachyon]
Length=503

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 119/193 (62%), Gaps = 28/193 (15%)
 Frame = +2

Query  230  ASLKVVHKHGGCS------TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGV  391
            A + +VH+HG CS       GK   P+  +IL  D++RV S+H RV+S        + G 
Sbjct  73   ARVPIVHRHGPCSPLAGAHAGK--PPSHAEILAADQNRVESLHHRVSS----TTTGLGGK  126

Query  392  GR-KKKIPD----------SKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDL  538
             R KKK P           S ++VPA SG +L T NY+V +GLG P    T+VFDTGSD 
Sbjct  127  PRTKKKTPGHSSVPASSSSSSSSVPASSGLSLGTANYVVPIGLGTPPSRFTVVFDTGSDT  186

Query  539  TWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGI  718
            TW QC PCV +CY Q++ +F+P  S+TY+N+SC+  AC+ L ++     GC++  C+YGI
Sbjct  187  TWVQCRPCVVSCYKQKDRLFDPAKSSTYANVSCADPACADLDAS-----GCNAGHCLYGI  241

Query  719  QYGDSSFSVGFFA  757
            QYGD S++VGFFA
Sbjct  242  QYGDGSYTVGFFA  254



>ref|XP_010913306.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=168

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 105/177 (59%), Gaps = 17/177 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            + VVH+HG CS  G+        +L QD+ R+  +H R+         +     +  +  
Sbjct  1    MTVVHRHGPCSPVGQRKHMNHHRLLRQDQYRIQFLHHRI---------SFPAASKPTEPG  51

Query  413  DSKAAV--PAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
             S A+V  P++ G  L T  Y +TVG G P +  T++FDTGSDLTW QC+PCVK CY Q 
Sbjct  52   TSLASVTAPSRYGIPLRTAEYFITVGFGTPKQDYTVIFDTGSDLTWIQCKPCVKYCYPQN  111

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            E++F+P  S+TYS+I CS++ CS ++         +S  C+YG++YGD+SFS G+FA
Sbjct  112  ESLFDPLQSSTYSDILCSSSDCSLISGQCD-----ASYHCIYGVKYGDNSFSAGYFA  163



>ref|XP_010266605.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=470

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 109/187 (58%), Gaps = 20/187 (11%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAV  382
            KG      L+++ K+G CS   T     P L +I   DE RV SIH+ +N+         
Sbjct  42   KGFNHSGKLQLIDKYGPCSPLSTQGKTIPRLQEIFLLDELRVRSIHSLINN---------  92

Query  383  SGVGRKKKIPDSKAAV-PAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
                ++  + DSKA V P KSG  L TGNYIV++GLG P +   +  DTGSDLTW QC+P
Sbjct  93   ----QQHPLGDSKATVLPTKSGVALGTGNYIVSIGLGTPKQDFMVAMDTGSDLTWIQCQP  148

Query  560  CV--KTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDS  733
            C    TCY Q    F+P  S++YS I+C +A CS + SAT  +P C+S+ C+Y  +YGD 
Sbjct  149  CPNSPTCYEQSGPTFDPSKSSSYSGITCGSAECSHVYSATFYSPPCNSA-CIYEARYGDQ  207

Query  734  SFSVGFF  754
            SFS+G F
Sbjct  208  SFSIGLF  214



>ref|XP_007224453.1| hypothetical protein PRUPE_ppa022256mg [Prunus persica]
 gb|EMJ25652.1| hypothetical protein PRUPE_ppa022256mg [Prunus persica]
Length=418

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 102/156 (65%), Gaps = 23/156 (15%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTPTLT---------DILNQDESRVNSIHARVNSARIDNLNAVSG  388
            L+VVHKHG CS    ++ T T          IL QDE+RVNSIH+R+N  RI +      
Sbjct  24   LEVVHKHGPCSILHKSSKTSTTKSDDKYHAQILKQDEARVNSIHSRLN-YRIHD------  76

Query  389  VGRKKKIPDSKAA--VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPC  562
                     S AA  +PAKSG  L TGNY+VT+ LG P K L+LVFDTGSDLTWTQC PC
Sbjct  77   -----PFTQSAAATTLPAKSGLPLGTGNYLVTLALGTPAKQLSLVFDTGSDLTWTQCRPC  131

Query  563  VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSA  670
            +++CYTQ E IF+P LS +Y N+SC++A C+ L+SA
Sbjct  132  LRSCYTQSEPIFDPSLSASYKNLSCTSATCTQLSSA  167



>ref|XP_010066094.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=449

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 119/186 (64%), Gaps = 22/186 (12%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCST-GKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNA  379
            ++K   R ++LK+VHKHG CS   +D+ P  L++IL +D+SRV  I ++ +++       
Sbjct  37   SAKASNRKSTLKLVHKHGLCSPFDRDHNPLNLSEILLRDQSRVKWIQSQSSNSS------  90

Query  380  VSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
                    +   + A++P KS  T+  G+YIVT+GLG P K LTL+FDTGS +TWTQC+P
Sbjct  91   ------SGQKATAAASLPVKSDITV--GDYIVTIGLGTPKKDLTLLFDTGSSVTWTQCKP  142

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            CV +CYTQ + IFNP  S++Y+NISC++  CS   S      GC  STC Y I Y D+S 
Sbjct  143  CVGSCYTQSDPIFNPSQSSSYANISCASTFCSLAGS------GCFGSTCKYSITYADNSS  196

Query  740  SVGFFA  757
            SVGFFA
Sbjct  197  SVGFFA  202



>ref|XP_010108295.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXC18775.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=433

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 112/180 (62%), Gaps = 10/180 (6%)
 Frame = +2

Query  230  ASLKVVHKHGGCST--GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK  403
            ASL+V+HK+G CS    ++N     DI  QD++RVN I    NS R     A +      
Sbjct  12   ASLEVIHKYGPCSQLHQENNVDHAQDIHLQDQARVNWI----NSHRPKKSTATAPANDTI  67

Query  404  KIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
               D+   +PAK+G  + +G+YIV VGLG P + L+L+FDTGSDLTWTQC+PC   CY Q
Sbjct  68   YEQDA-TTLPAKTGAVIGSGDYIVKVGLGTPKEDLSLIFDTGSDLTWTQCQPCDGHCYKQ  126

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS--SSTCVYGIQYGDSSFSVGFFA  757
             E IF+P  ST+Y+ +SC++  CS L S+TG    CS  +STC Y   YGD S++ G+FA
Sbjct  127  SEAIFDPSKSTSYATVSCTSTECSQLKSSTG-TAACSRTASTCTYDEGYGDGSYTEGYFA  185



>gb|KCW63890.1| hypothetical protein EUGRSUZ_G01565, partial [Eucalyptus grandis]
Length=409

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 116/180 (64%), Gaps = 22/180 (12%)
 Frame = +2

Query  224  RGASLKVVHKHGGCST-GKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            R ++LK+VHKHG CS   +D+ P  L++IL +D+SRV  I ++ +++             
Sbjct  3    RKSTLKLVHKHGLCSPFDRDHNPLNLSEILLRDQSRVKWIQSQSSNSS------------  50

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
              +   + A++P KS  T+  G+YIVT+GLG P K LTL+FDTGS +TWTQC+PCV +CY
Sbjct  51   SGQKATAAASLPVKSDITV--GDYIVTIGLGTPKKDLTLLFDTGSSVTWTQCKPCVGSCY  108

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            TQ + IFNP  S++Y+NISC++  CS   S      GC  STC Y I Y D+S SVGFFA
Sbjct  109  TQSDPIFNPSQSSSYANISCASTFCSLAGS------GCFGSTCKYSITYADNSSSVGFFA  162



>ref|XP_008777074.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=437

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 106/177 (60%), Gaps = 16/177 (9%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            L VVH+HG CS  G+        +L QD+ RV S+H R+         +     +  K+ 
Sbjct  28   LTVVHRHGPCSPLGRWKHLNHHRLLRQDQYRVQSLHHRL---------SFPTASKPTKLG  78

Query  413  DSKAAV--PAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
             S A V  P++SG  L TGNYI+TVG G P +  T++FDTGSDLTW QCEPCVK CY Q 
Sbjct  79   TSLAGVTTPSRSGIPLGTGNYIITVGFGTPKRDFTVIFDTGSDLTWIQCEPCVK-CYAQN  137

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            ET+F+P  S+TYSNI CS++ CS     +G     SS+ C Y ++YGD S SVG  A
Sbjct  138  ETLFDPSQSSTYSNIPCSSSDCS---LPSGQTDCDSSNDCRYVVEYGDRSSSVGILA  191



>gb|KCW63937.1| hypothetical protein EUGRSUZ_G01615 [Eucalyptus grandis]
Length=481

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 120/207 (58%), Gaps = 23/207 (11%)
 Frame = +2

Query  146  TVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCS-TGKDNTPTLTDILNQDES  322
            T+P++SLFP+ +C    T  +S       +LK+VHKHG CS          T  L +D +
Sbjct  48   TLPVSSLFPSPNCKASTTNGSS-------TLKLVHKHGPCSPLFNGELANYTQFLLEDSA  100

Query  323  RVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTK  502
            R   I ++            SG      +  S  +V AK G      +Y+VT+GLG P K
Sbjct  101  RAKWIRSQF-----------SGTNTANDLKGSAVSVQAKYGP--GGESYLVTIGLGTPKK  147

Query  503  SLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSAT-GN  679
             LTL+FDTGS LTWTQCEPC+ +CY Q E IF+P  S++Y+N SCS+ +CS L S T G 
Sbjct  148  DLTLLFDTGSALTWTQCEPCIGSCYNQTEAIFDPSQSSSYANTSCSSPSCSQLPSGTGGR  207

Query  680  NPGCSSSTCVYGIQYGD-SSFSVGFFA  757
             PGC  STCVY  +YGD  SF++GFFA
Sbjct  208  QPGCIDSTCVYDQRYGDRESFTMGFFA  234



>ref|XP_002324355.2| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02920.2| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=477

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 115/191 (60%), Gaps = 23/191 (12%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGC--STGKD---NTPTLTDILNQDESRVNSIHARVNSARIDN  370
            +++ L R +SLKVV+K+G C   TG     N P+  + L QD+ RV S   R++      
Sbjct  61   STRVLNRASSLKVVNKYGPCIPVTGAPKTINVPSTAEFLLQDQLRVKSFQVRLS------  114

Query  371  LNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQ  550
            +N  SGV ++ +     + VP       + G Y+VTVGLG P K  TL FDTGSDLTWTQ
Sbjct  115  MNPSSGVFKEMQTTIPASIVP-------TGGAYVVTVGLGTPKKDFTLSFDTGSDLTWTQ  167

Query  551  CEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPG--CSSSTCVYGIQY  724
            CEPC+  C+ Q +  F+P  ST+Y N+SCS+  C  +  A GN P   C S+TC+YGIQY
Sbjct  168  CEPCLGGCFPQNQPKFDPTTSTSYKNVSCSSEFCKLI--AEGNYPAQDCISNTCLYGIQY  225

Query  725  GDSSFSVGFFA  757
            G S +++GF A
Sbjct  226  G-SGYTIGFLA  235



>ref|XP_010050792.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Eucalyptus 
grandis]
Length=382

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 96/146 (66%), Gaps = 12/146 (8%)
 Frame = +2

Query  320  SRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPT  499
            +RV  I ++++       N++SG    K   +S  ++PA  G   S+  Y+VT+GLG P 
Sbjct  2    ARVKWIQSKIS-------NSISGTSDLK---ESAVSLPASYGPYRSS--YVVTIGLGTPE  49

Query  500  KSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGN  679
            K LTL FDTGS LTWTQCEPC+ +CY Q E IFNP  S++Y+NISCSA +C  L S T  
Sbjct  50   KDLTLAFDTGSALTWTQCEPCIGSCYNQTEPIFNPSQSSSYANISCSAPSCIQLPSGTDQ  109

Query  680  NPGCSSSTCVYGIQYGDSSFSVGFFA  757
              GCS STCVYG  YGD+SF+ GFFA
Sbjct  110  LTGCSGSTCVYGASYGDASFTAGFFA  135



>ref|XP_010913226.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=468

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 104/176 (59%), Gaps = 18/176 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            LKVVH+H  CS       P   ++LNQD++RVN +H ++++A   N    S         
Sbjct  60   LKVVHRHSPCSPLTSGQKPDYAELLNQDQARVNWLHRQISTASNQNSTRTS---------  110

Query  413  DSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCV--KTCYTQQ  586
               A +PA+SG ++ TGNY+V V LG P K  T++FDTGSDLTW QC PC    +CY QQ
Sbjct  111  -LAANIPARSGGSIGTGNYVVNVSLGTPKKVFTVIFDTGSDLTWIQCLPCRTNNSCYPQQ  169

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            + +F+P  S+TYSNISC++  CS L         CS+S C Y + Y D S S GFF
Sbjct  170  QRLFDPSQSSTYSNISCTSTKCSQLDLHK-----CSASRCRYEVLYSDQSQSEGFF  220



>ref|XP_009390623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=465

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 110/175 (63%), Gaps = 18/175 (10%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTPTL-TDILNQDESRVNSIHARVNSA-RIDNLNAVSGVGRKKKI  409
            LKVVH+HG CS   +        +L+ D++RV+S+H R ++A ++D L +          
Sbjct  61   LKVVHRHGPCSPFDEGRKLPHARLLDADQARVDSLHVRASAAAQVDKLRS----------  110

Query  410  PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQE  589
              S A +PA++G +L TGNY+VTVG G P    ++VFDTGSD+TW QC+PC   CY QQE
Sbjct  111  -SSAARIPARTGGSLGTGNYVVTVGFGTPLMDFSVVFDTGSDVTWIQCKPC-NDCYAQQE  168

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
             +F+P  S+TY+ ++C++A C  L S + +N    +STC Y +QYGD S + G F
Sbjct  169  PVFDPAQSSTYATLACNSADCGRLDSHSCSN----ASTCRYDVQYGDKSQTQGTF  219



>ref|XP_007021889.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY13414.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=685

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 112/180 (62%), Gaps = 22/180 (12%)
 Frame = +2

Query  230  ASLKVVHKHGGCST---GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL +V+KHG CS     K N P+ ++IL QD++R +SIH+ ++ +  +           
Sbjct  277  SSLAIVNKHGPCSQLNQDKPNAPSHSEILRQDQARADSIHSMLSLSSTE-----------  325

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
                  K ++  K G ++ TG Y VT+G G+P   L+LVFDT S LTWTQC+PC   CY 
Sbjct  326  ------KTSLQDKPGISIGTGKYQVTMGFGSPKTELSLVFDTASQLTWTQCQPCSGYCYD  379

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGC-SSSTCVYGIQYGDSSFSVGFFA  757
            Q+E IF+P  S++Y+NI CS+  C  ++S  G   GC SSS+CVYG+ Y +++FSVGF A
Sbjct  380  QKEPIFDPSKSSSYTNIQCSSGTCKQISSE-GMREGCSSSSSCVYGVTYSNTTFSVGFMA  438



>ref|XP_006660750.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Oryza 
brachyantha]
Length=483

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 107/183 (58%), Gaps = 23/183 (13%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSAR---ID  367
            ASK     ++L VVH+HG CS     +   P+  +IL +D++RVNSIH +V +A    +D
Sbjct  65   ASKATSNSSALSVVHQHGPCSPLHARRGGAPSHVEILERDQARVNSIHRKVAAAGASVVD  124

Query  368  NLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWT  547
               A  GV           ++PA+ G +L TGNYIV+VGLG P K  ++VFDTGSDL+W 
Sbjct  125  PARASKGV-----------SLPAQRGISLGTGNYIVSVGLGTPAKQYSVVFDTGSDLSWV  173

Query  548  QCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYG  727
            QC PC   CY Q + +F+P  S+TY+ + C A  C  L S T     CSS+ C Y + YG
Sbjct  174  QCTPC-SDCYQQNDPLFDPAQSSTYAAVPCGAQECQELDSGT-----CSSNKCRYEVAYG  227

Query  728  DSS  736
            D S
Sbjct  228  DQS  230



>gb|KCW63732.1| hypothetical protein EUGRSUZ_G01378, partial [Eucalyptus grandis]
Length=395

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 105/181 (58%), Gaps = 36/181 (20%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCSTGKDNTPTL--TDILNQDESRVNSIHARVNSARIDNLNAVSGVG  394
            +R ++L+V HKHG CS        L  T  L QDESRV  I ++ ++   D L       
Sbjct  2    KRKSTLEVYHKHGPCSQLVQGHSPLNHTKSLLQDESRVKWIQSQSSNGS-DGLKV-----  55

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
                   +  ++PAKSG TL TGNYIVT+ LG P + LTL+FDTGS LTWTQC+PCV +C
Sbjct  56   ------SAATSLPAKSGITLGTGNYIVTISLGTPKQDLTLIFDTGSPLTWTQCQPCVGSC  109

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            YTQ + IF+P                S L+S      GCS STC+YGIQYGD S SVGFF
Sbjct  110  YTQSDPIFDP----------------SHLSS------GCSRSTCLYGIQYGDQSSSVGFF  147

Query  755  A  757
            A
Sbjct  148  A  148



>ref|XP_008779686.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Phoenix dactylifera]
Length=241

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 104/179 (58%), Gaps = 20/179 (11%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLT--DILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            G  L VVH+HG CS   +    L    IL++D++RV S+H R+ +A            RK
Sbjct  36   GNKLTVVHRHGPCSPIINTRQKLNHRQILHRDQARVISLHNRITAA-----------SRK  84

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             K   +   VP + G + ST +YIVTVG G P KS +++FDTGSD++W QC  C   CY+
Sbjct  85   DK--STGVTVPNRVGLSFSTSDYIVTVGFGTPKKSFSVIFDTGSDISWIQCRQCAGGCYS  142

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q ET+F+P  S+T +NISCS+A C    S        +SSTC+Y +QY D S + GF A
Sbjct  143  QNETLFDPSQSSTCANISCSSAVCLSFGSDCD-----ASSTCIYAVQYSDGSSTAGFLA  196



>ref|XP_010252879.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nelumbo 
nucifera]
Length=468

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 103/172 (60%), Gaps = 6/172 (3%)
 Frame = +2

Query  245  VHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKA  424
            +H+  G  T     P L+DIL +DE+RV S++AR+ S R+ N  A S   +   +  S  
Sbjct  61   LHRRHGLDT---PLPLLSDILARDEARVRSLNARLTSKRVINTTAASS--KLNHLRASSV  115

Query  425  AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNP  604
            ++P   G ++ TGNY V +GLG PTK   ++ DTGS  TW QC+PC   C+ Q    F+P
Sbjct  116  SLPLNPGESIGTGNYYVKIGLGTPTKYYAVLVDTGSSFTWLQCQPCTIYCHRQVGPTFDP  175

Query  605  KLSTTYSNISCSAAACSGLTSATGNNPGCS-SSTCVYGIQYGDSSFSVGFFA  757
              S T+  +SCS   C+GL +AT N P CS S+ C+Y   YGDSSFSVG+ +
Sbjct  176  SASKTHRFMSCSTPECAGLEAATLNAPSCSNSNVCIYAASYGDSSFSVGYLS  227



>gb|KCW63736.1| hypothetical protein EUGRSUZ_G01384 [Eucalyptus grandis]
Length=470

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 118/186 (63%), Gaps = 22/186 (12%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCST-GKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNA  379
            ++K   R ++LK+VHKHG  S   +D+ P  L++IL +D+SRV  I ++ +++       
Sbjct  58   SAKASNRKSTLKLVHKHGLWSPFDRDHNPLNLSEILLRDQSRVKWIQSQSSNSS------  111

Query  380  VSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEP  559
                    +   + A++P KS  T+  G+YIVT+GLG P K LTL+FDTGS +TWTQC+P
Sbjct  112  ------SGQKATAAASLPVKSDITV--GDYIVTIGLGTPKKDLTLLFDTGSSVTWTQCKP  163

Query  560  CVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSF  739
            CV +CYTQ + IFNP  S++Y+NISC++  CS   S      GC  STC Y I Y D+S 
Sbjct  164  CVGSCYTQSDPIFNPSQSSSYANISCASTFCSLAGS------GCFGSTCKYSITYADNSS  217

Query  740  SVGFFA  757
            SVGFFA
Sbjct  218  SVGFFA  223



>ref|XP_008777073.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=445

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 106/179 (59%), Gaps = 19/179 (11%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLT--DILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            G  L V+H+ G CS   +    L    +L +D++RV S+H R+++A            RK
Sbjct  38   GNRLTVIHQDGPCSPIINTRQKLNHRQLLGRDQARVISLHNRISTAS-----------RK  86

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             K   +   VP + G + ST +YIVTVG G P K  +++FDTGSD++W QC PC   CY+
Sbjct  87   DK-SAAGVTVPDRVGISFSTLDYIVTVGFGTPNKYFSVIFDTGSDISWIQCRPCAGGCYS  145

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            Q ET+F+P  S+TY+NISCS+A C    S        +SSTC+Y +QYGD S++ GF A
Sbjct  146  QNETLFDPSQSSTYANISCSSAVCLSFGSDCD-----ASSTCIYAVQYGDGSYTAGFLA  199



>ref|NP_001063501.1| Os09g0482200 [Oryza sativa Japonica Group]
 dbj|BAD33407.1| putative nucleoid DNA-binding protein cnd41 [Oryza sativa Japonica 
Group]
 dbj|BAD33410.1| putative nucleoid DNA-binding protein cnd41 [Oryza sativa Japonica 
Group]
 dbj|BAF25415.1| Os09g0482200 [Oryza sativa Japonica Group]
 gb|EAZ45148.1| hypothetical protein OsJ_29786 [Oryza sativa Japonica Group]
Length=485

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 103/174 (59%), Gaps = 18/174 (10%)
 Frame = +2

Query  236  LKVVHKHGGCST------GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            L VVH+HG CS       G     T  +IL +D++RV+SIH +V  A          V  
Sbjct  71   LGVVHRHGPCSPVQARPRGGGGAVTHAEILERDQARVDSIHRKVAGA-----GGAPSVVD  125

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
              +  +   ++PA+ G +L TGNY+V+VGLG P K   ++FDTGSDL+W QC+PC   CY
Sbjct  126  PARASEQGVSLPAQRGISLGTGNYVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPCAD-CY  184

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS-STCVYGIQYGDSS  736
             QQ+ +F+P LS+TY+ ++C A  C  L ++     GCSS S C Y +QYGD S
Sbjct  185  EQQDPLFDPSLSSTYAAVACGAPECQELDAS-----GCSSDSRCRYEVQYGDQS  233



>gb|EAZ09523.1| hypothetical protein OsI_31798 [Oryza sativa Indica Group]
Length=485

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 103/174 (59%), Gaps = 18/174 (10%)
 Frame = +2

Query  236  LKVVHKHGGCST------GKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            L VVH+HG CS       G     T  +IL +D++RV+SIH +V  A          V  
Sbjct  71   LGVVHRHGPCSPVQARRRGGGGAVTHAEILERDQARVDSIHRKVAGA-----GGAPSVVD  125

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
              +  +   ++PA+ G +L TGNY+V+VGLG P K   ++FDTGSDL+W QC+PC   CY
Sbjct  126  PARASEQGVSLPAQRGISLGTGNYVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPCAD-CY  184

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS-STCVYGIQYGDSS  736
             QQ+ +F+P LS+TY+ ++C A  C  L ++     GCSS S C Y +QYGD S
Sbjct  185  EQQDPLFDPSLSSTYAAVACGAPECQELDAS-----GCSSDSRCRYEVQYGDQS  233



>ref|XP_010928159.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=470

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 113/179 (63%), Gaps = 19/179 (11%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            LK+VH+HG CS       P+   +L++DE+RV+ +H R++ A   + N  S +       
Sbjct  60   LKLVHRHGPCSPISTSREPSHVQLLDEDEARVHLLHHRISIATSGSDNTSSSLA------  113

Query  413  DSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK-TCYTQQE  589
               A +PA +G  L TGNYIVTVG G P + LT+VFDTGSDLTW QC+PC    CYTQQE
Sbjct  114  ---ATIPAYTGVALGTGNYIVTVGFGTPKRDLTVVFDTGSDLTWIQCKPCSSGGCYTQQE  170

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST---CVYGIQYGDSSFSVGFFA  757
             +F+P  S+TYS I C ++ CS L S+T     CS++T   C Y ++YGD+S S G+F+
Sbjct  171  PLFDPSKSSTYSKIPCGSSECSLLESST-----CSTATPSACRYDVEYGDNSQSGGYFS  224



>ref|XP_006294147.1| hypothetical protein CARUB_v10023140mg [Capsella rubella]
 gb|EOA27045.1| hypothetical protein CARUB_v10023140mg [Capsella rubella]
Length=469

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 108/182 (59%), Gaps = 23/182 (13%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPTLTD---ILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            +SL+VVH HG CS  + N     D   IL  D++RV SI  +++       N+   V   
Sbjct  62   SSLRVVHLHGPCSHLRSNKDARLDHDEILRGDQARVESIRFKLSKN-----NSNGSVSTT  116

Query  401  KKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKT--C  574
            K        +P K G+T  + NYIVT+G+G P   ++L+FDTGSDLTWTQC+PC+ T  C
Sbjct  117  KS-----TELPGKLGSTFGSANYIVTIGIGTPKNDVSLIFDTGSDLTWTQCKPCLGTYRC  171

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNP-GCSSSTCVYGIQYGDSSFSVGF  751
            YTQ E IF+P  S++Y N+ CS+  C        N P  CS+S C+Y ++YGD+SF+ GF
Sbjct  172  YTQNEPIFDPSSSSSYQNVPCSSPMCE-------NGPQSCSASNCLYRVKYGDNSFTEGF  224

Query  752  FA  757
             A
Sbjct  225  LA  226



>ref|XP_009122025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Brassica rapa]
Length=473

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 130/214 (61%), Gaps = 17/214 (8%)
 Frame = +2

Query  128  ESTHFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCST--GKDNTPTLT-  298
            E   FH +  +SLFP++      +  AS      +SL V H++G CS+   K    +L  
Sbjct  27   EKASFHRIQASSLFPSSSAPCVFSPRASN---TNSSLHVAHRYGPCSSLSSKKAMTSLDH  83

Query  299  -DILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIV  475
             D+L  D++RV SIH+R+ S ++ + + VS              + A+SG TL +GNYIV
Sbjct  84   DDMLRLDQARVKSIHSRL-SKKLTSRDRVS--------QSQSTDLQARSGRTLGSGNYIV  134

Query  476  TVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACS  655
            TVG+G P   L+LVFDTGSDLTWTQCEPC  +CY Q+E IFNP  S++YSNISCS+  C 
Sbjct  135  TVGIGTPKHDLSLVFDTGSDLTWTQCEPCAGSCYPQKEPIFNPSSSSSYSNISCSSTVCD  194

Query  656  GLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             L S +     CS+S+CVY I YGD+S + GF A
Sbjct  195  SLASQS-RYKYCSASSCVYLIGYGDNSSTSGFLA  227



>gb|ABP93696.1| unknown protein isoform 1 [Lemna minor]
Length=350

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = +2

Query  425  AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNP  604
            ++PA+ G  + T NY++TVG G P K+ T++FDTGS++ W QC+PCV +CY QQE +F+P
Sbjct  2    SIPARIGLYIGTANYVITVGFGTPKKNQTVIFDTGSNVNWIQCKPCVVSCYPQQEPLFDP  61

Query  605  KLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             LS+TY NISC++AAC+GL+S      GCS STCVYG+ YGD S +VGF A
Sbjct  62   TLSSTYRNISCTSAACTGLSSR-----GCSGSTCVYGVTYGDGSSTVGFLA  107



>ref|XP_002515386.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
 gb|EEF46835.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus 
communis]
Length=387

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 12/152 (8%)
 Frame = +2

Query  302  ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTV  481
            +L QD+ RV S+HAR +     N NA S         + +A +P +SG  L  GNY+V +
Sbjct  1    MLLQDQLRVKSMHARFS-----NKNAGS------HFKEMQADIPVQSGIPLGAGNYLVKM  49

Query  482  GLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGL  661
             LG P  SL+L  DTGSD+TWTQCEPCV +CY Q +T F+P+ S++Y N+SCS+++C  +
Sbjct  50   ALGTPKLSLSLALDTGSDITWTQCEPCVGSCYRQAQTKFDPRKSSSYKNVSCSSSSCRII  109

Query  662  TSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            T + G   GC SSTC+Y +QYGD S+SVGFFA
Sbjct  110  TDSGGAR-GCVSSTCIYKVQYGDGSYSVGFFA  140



>ref|XP_010091139.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB42723.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=147

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 8/127 (6%)
 Frame = +2

Query  302  ILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTV  481
            +L QD+ RVNSIH++        L+  SG    +    +K+A+P +SG T+ +GNYIVTV
Sbjct  9    LLEQDQLRVNSIHSQ--------LSKRSGDPGFRGPKSTKSAIPVRSGQTIGSGNYIVTV  60

Query  482  GLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGL  661
            GLG P K L+LV DTGS L+WTQCEPCV+ CY Q+E IF P  ST+Y+N+SC++  C+ L
Sbjct  61   GLGTPKKQLSLVLDTGSALSWTQCEPCVRYCYAQKEPIFKPLESTSYANVSCASELCNAL  120

Query  662  TSATGNN  682
             S TG++
Sbjct  121  ESTTGHH  127



>emb|CDY70207.1| BnaA10g30140D [Brassica napus]
Length=472

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKI  409
            +SL VVH+HG CS+         +IL  D++RV SIH++++      L A   V + +  
Sbjct  61   SSLHVVHRHGPCSSLSSKKADHDEILRLDQARVKSIHSKLSK----KLTARDRVSQSQS-  115

Query  410  PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQE  589
                  +PA+ G T   GNY+VTVG+G P   L+L FDTGSD+TWTQC+PC   CY+Q+E
Sbjct  116  ----TDLPARDGITFGYGNYVVTVGIGTPKHDLSLFFDTGSDITWTQCQPCAGKCYSQKE  171

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             IFNP  S++YSN+SCS+  C  LTS  G    CS+S C+Y   YGD SF+ GF A
Sbjct  172  PIFNPSSSSSYSNVSCSSPVCDSLTSQ-GLVKQCSASNCIYLAGYGDKSFTQGFMA  226



>ref|XP_009122891.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=416

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 106/192 (55%), Gaps = 43/192 (22%)
 Frame = +2

Query  245  VHKHGGCSTGKDNTPTLTDILNQ------------DESRVNSIHARVNSARIDNLNAVSG  388
            +H+HG      DN   L  +  Q            D +  NSIH++++            
Sbjct  1    MHQHG------DNFINLVSLFPQLIQAYVTPFILLDTTTTNSIHSKLS------------  42

Query  389  VGRKKKIPD-----SKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
                KK+PD     +   +PA  G+T  +GNY+VTVG+G P    +L+FDTGSDLTW QC
Sbjct  43   ----KKLPDLIRQSTSTDLPANHGSTYGSGNYVVTVGIGTPKHDQSLMFDTGSDLTWIQC  98

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS----SSTCVYGIQ  721
            EPC  +CY Q E IFNP  S++Y N+SC +A CS L SATG    CS    SS C+Y IQ
Sbjct  99   EPCAVSCYYQTEPIFNPSSSSSYRNLSCQSAECSSLASATGRAGICSGPSPSSKCIYVIQ  158

Query  722  YGDSSFSVGFFA  757
            YGDSS+S G+ +
Sbjct  159  YGDSSYSAGYLS  170



>ref|XP_009122023.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Brassica rapa]
Length=476

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 134/221 (61%), Gaps = 18/221 (8%)
 Frame = +2

Query  110  ASESLTESTHFHTVPLTS-LFptthchqphtthASKGLRRGASLKVVHKHGGCST--GKD  280
            A E  +    +HTV +TS LFP++      +  AS      +SL V H++G CS+   K 
Sbjct  23   AQERESRKLDYHTVQVTSSLFPSSSAPCVFSPRASN---TNSSLHVAHRYGPCSSLSSKK  79

Query  281  NTPTLT--DILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTL  454
               +L   D+L  D++RV SIH+R+ S ++ + + VS              + A+SG TL
Sbjct  80   AMTSLDHDDMLRLDQARVKSIHSRL-SKKLTSRDRVS--------QSQSTDLQARSGRTL  130

Query  455  STGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNIS  634
             +GNYIVTVG+G P   L+LVFDTGSDLTWTQCEPC  +CY Q+E IFNP  S++YSNIS
Sbjct  131  GSGNYIVTVGIGTPKHDLSLVFDTGSDLTWTQCEPCAGSCYPQKEPIFNPSSSSSYSNIS  190

Query  635  CSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            CS+  C  L S +     CS+S+CVY I YGD+S + GF A
Sbjct  191  CSSTVCDSLASQS-RYKYCSASSCVYLIGYGDNSSTSGFLA  230



>ref|XP_008776166.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=431

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 102/175 (58%), Gaps = 18/175 (10%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNT-PTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            L V H+HG CS     T PTL +IL QD+ RVN +               S   R+ ++ 
Sbjct  54   LAVTHRHGPCSPIPSKTRPTLGEILRQDQLRVNYLQ-----------QVASHGSRETRVQ  102

Query  413  DSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQET  592
            +S+ +VPAK G  L +  Y+VTVG G P ++ T+ FDTGSD++W QC+PC   CY QQE 
Sbjct  103  ESQTSVPAKLGFALGSAEYVVTVGYGTPEQNQTVDFDTGSDISWIQCQPC-PACYPQQEN  161

Query  593  IFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             FN   S++Y++I CS+  CS           CS+STC+YG+ YGD S +VG+ +
Sbjct  162  YFNASQSSSYASIPCSSPECS-----LSFQHACSNSTCIYGVTYGDGSSTVGYLS  211



>ref|NP_001047956.1| Os02g0720900 [Oryza sativa Japonica Group]
 dbj|BAD12879.1| putative chloroplast nucleoid DNA-binding protein cnd41 [Oryza 
sativa Japonica Group]
 dbj|BAD12999.1| putative chloroplast nucleoid DNA-binding protein cnd41 [Oryza 
sativa Japonica Group]
 dbj|BAF09870.1| Os02g0720900 [Oryza sativa Japonica Group]
 gb|EAY87325.1| hypothetical protein OsI_08729 [Oryza sativa Indica Group]
 dbj|BAG88042.1| unnamed protein product [Oryza sativa Japonica Group]
Length=458

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 108/183 (59%), Gaps = 11/183 (6%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGK--DNTPTLTDILNQDESRVNSIHARVN---SARIDNLNAVSGV  391
            G  L++ H    CS      + P  T +L  D++R++S+ AR+    SAR  +L+A +  
Sbjct  42   GLHLELHHPRSPCSPAPVPADLP-FTAVLTHDDARISSLAARLAKTPSARATSLDADADA  100

Query  392  GRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKT  571
            G    +  S A+VP   G ++  GNY+  +GLG P     +V DTGS LTW QC PC+ +
Sbjct  101  G----LAGSLASVPLSPGASVGVGNYVTRMGLGTPATQYVMVVDTGSSLTWLQCSPCLVS  156

Query  572  CYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFSVG  748
            C+ Q   +FNPK S+TY+++ CSA  CS L SAT N   CSSS  C+Y   YGDSSFSVG
Sbjct  157  CHRQSGPVFNPKSSSTYASVGCSAQQCSDLPSATLNPSACSSSNVCIYQASYGDSSFSVG  216

Query  749  FFA  757
            + +
Sbjct  217  YLS  219



>ref|XP_006289171.1| hypothetical protein CARUB_v10002609mg [Capsella rubella]
 gb|EOA22069.1| hypothetical protein CARUB_v10002609mg [Capsella rubella]
Length=465

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 111/181 (61%), Gaps = 22/181 (12%)
 Frame = +2

Query  230  ASLKVVHKHGGCS---TGKDNT-PTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL +VH+HG CS   +GK  T P   +IL +D++RV+SI ++++  ++          R
Sbjct  65   SSLLLVHRHGPCSHLMSGKATTSPDHDEILRRDQARVDSIQSKLSKNQV----------R  114

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKT-C  574
              ++ D    +PA        G Y+V +G+G P + L+L+FDTGSDLTW QC+PC+++ C
Sbjct  115  PSQLTD----LPATQWDESGAGTYVVKIGIGTPKQDLSLLFDTGSDLTWVQCQPCLESKC  170

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y Q+E +FNP  ST+Y N+SCS+ AC+ L    G+   CS+STC Y   Y D S S GF 
Sbjct  171  YPQKEPLFNPSSSTSYVNVSCSSRACNSLRGLKGD---CSASTCRYKAVYADKSTSQGFL  227

Query  755  A  757
            A
Sbjct  228  A  228



>emb|CDX97054.1| BnaC09g45710D [Brassica napus]
Length=473

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 126/213 (59%), Gaps = 21/213 (10%)
 Frame = +2

Query  140  FHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGCSTGKDNTPTLT----DIL  307
            FH +  +SLFP+           S      +SL VV++HG CS+      T++    +IL
Sbjct  34   FHRIQASSLFPSLPAPCVLPPRVSN---TKSSLHVVNRHGPCSSLSSKKATISPDHDEIL  90

Query  308  NQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAV-PAKSGTTLSTGNYIVTVG  484
              D++RV SIH++++      L A      + ++  S++ V PA  G TL  GNYIVTVG
Sbjct  91   RLDQARVKSIHSKLSK----KLTA------RDRLSQSQSTVLPATDGITLGYGNYIVTVG  140

Query  485  LGNPTKSLTLVFDTGSDLTWTQCEPCVK--TCYTQQETIFNPKLSTTYSNISCSAAACSG  658
            +G P   L+LVFDTGSDLTWTQCEPC +  TCY Q+E IFNP  S+++SN+SCS+  C  
Sbjct  141  IGTPKHDLSLVFDTGSDLTWTQCEPCGRNGTCYPQKEPIFNPSSSSSFSNVSCSSPFCDS  200

Query  659  LTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            L S  G    C +  C YG+ YGD SF++GF A
Sbjct  201  LASQ-GRVKNCLAPNCDYGVGYGDRSFTIGFLA  232



>ref|XP_002460431.1| hypothetical protein SORBIDRAFT_02g028000 [Sorghum bicolor]
 gb|EER96952.1| hypothetical protein SORBIDRAFT_02g028000 [Sorghum bicolor]
Length=481

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 102/178 (57%), Gaps = 23/178 (13%)
 Frame = +2

Query  242  VVHKHGGCS--TGKDNTPTLTDILNQDESRVNSIH----ARVNSARIDNLNAVSGVGRKK  403
            VVH+HG CS    +   P+  +IL++D+ RV+SIH    AR +S   D  +A  GV    
Sbjct  68   VVHRHGPCSPLQARGGEPSHAEILDRDQDRVDSIHRLAAARPSSTADDPSSASKGV----  123

Query  404  KIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
                   ++PA+ G  L T NYIV+VGLG P + L +VFDTGSDL+W QC+PC   CY Q
Sbjct  124  -------SLPARRGVPLGTANYIVSVGLGTPKRDLLVVFDTGSDLSWVQCKPC-DGCYQQ  175

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             + +F+P  STTYS + C A  C  L S +     CSS  C Y + YGD S + G  A
Sbjct  176  HDPLFDPSQSTTYSAVPCGAQECRRLDSGS-----CSSGKCRYEVVYGDMSQTDGNLA  228



>ref|XP_007147550.1| hypothetical protein PHAVU_006G134200g [Phaseolus vulgaris]
 gb|ESW19544.1| hypothetical protein PHAVU_006G134200g [Phaseolus vulgaris]
Length=472

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 110/183 (60%), Gaps = 6/183 (3%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCSTGKDNTP-TLTDILNQDESRVNSIHARV-NSARIDNLNAVSGVG  394
            + G  L + H  G  S+    +P + +D++ +DE RV S+H+ + N   + N +A +   
Sbjct  42   KEGMQLNLYHVKGLESSLTSTSPFSFSDMITKDEERVRSLHSTLANKEGVRN-SATTASS  100

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
             K + P+     P KSG ++ +GNY V +GLG P K  +++ DTGS L+W QC+PCV  C
Sbjct  101  DKLRGPN-LLTTPLKSGLSIGSGNYYVKIGLGTPAKYFSMIVDTGSSLSWLQCQPCVIYC  159

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYGDSSFSVG  748
            + Q + IF P  S TY ++ CS+  CS L ++T N P CS++T  CVY   YGDSSFS+G
Sbjct  160  HEQVDPIFTPSTSKTYKSLPCSSLQCSSLKASTLNAPSCSNATGSCVYKASYGDSSFSIG  219

Query  749  FFA  757
            + +
Sbjct  220  YLS  222



>gb|ABP93697.1| unknown protein isoform 2 [Lemna minor]
Length=351

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 82/111 (74%), Gaps = 5/111 (5%)
 Frame = +2

Query  425  AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNP  604
            ++PA+ G  + +GNY++TVG G PT++ T+VFDTGSD+ W QC+PC   CY QQE +F+P
Sbjct  2    SIPARIGLFIGSGNYVITVGFGTPTRTQTVVFDTGSDVNWLQCKPCAVRCYAQQEPLFDP  61

Query  605  KLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             LS+TY N+SC+  AC GL++      GCSSSTC+YG+ YGD S ++GF A
Sbjct  62   SLSSTYRNVSCTEPACVGLSTR-----GCSSSTCLYGVFYGDGSSTIGFLA  107



>dbj|BAJ99659.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 106/178 (60%), Gaps = 17/178 (10%)
 Frame = +2

Query  233  SLKVVHKHGGCS--TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            +L VVH+ G CS    +   P   ++LN D++RV+SIH ++ +A    L+   G   KK 
Sbjct  74   ALNVVHRQGPCSPLQARGAPPPHAELLNDDQARVDSIHRKIAAAASPVLDQARG---KKG  130

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
            +      +PA+ G +L TGNY+V++GLG P + +T+VFDTGSDL+W QC PC   CY Q+
Sbjct  131  V-----TLPAQRGISLGTGNYVVSMGLGTPARDMTVVFDTGSDLSWVQCTPC-SDCYEQK  184

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS-SSTCVYGIQYGDSSFSVGFFA  757
            + +F+P  S+TYS + C++  C GL S +     CS    C Y + YGD S + G  A
Sbjct  185  DPLFDPARSSTYSAVPCASPECQGLDSRS-----CSRDKKCRYEVVYGDQSQTDGALA  237



>emb|CDX82233.1| BnaA03g35880D [Brassica napus]
Length=397

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 108/183 (59%), Gaps = 17/183 (9%)
 Frame = +2

Query  230  ASLKVVHKHGGCSTGKDNTPTLT----DILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            +SL VVH+HG CS+      T +    DIL  D++RV SIH++++      L A   V +
Sbjct  61   SSLHVVHRHGPCSSQSSKKATTSSDHDDILRLDQARVKSIHSKLSK----KLTARDRVSQ  116

Query  398  KKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPC--VKT  571
             +         PA++     +GNYI+ VG+G P ++ +LV D+G DLTWTQCEPC    T
Sbjct  117  SQS-----TDPPARNQYITGSGNYILKVGIGTPKQNRSLVLDSGYDLTWTQCEPCGVSGT  171

Query  572  CYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYG-IQYGDSSFSVG  748
            CY Q+E IFNP  S+TY+N+ CS+  C  L S  G N  CS+S C Y    Y D+SF+ G
Sbjct  172  CYPQEEPIFNPSSSSTYTNVPCSSPLCDSLPSQ-GLNKYCSASNCFYNDTIYDDNSFTSG  230

Query  749  FFA  757
            FFA
Sbjct  231  FFA  233



>ref|XP_009391801.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=455

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 102/179 (57%), Gaps = 11/179 (6%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            G    + H    CS     + + + IL+ D++RV S+ AR+        N      R   
Sbjct  43   GIHFTLHHPRSPCSPAPFPSLSFSAILSHDDARVRSLAARLR-------NTTLAPSRSSL  95

Query  407  I--PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
            I  PD+ A++P  SGT++  GNY+  VGLG P KS  +V DTGS L+W QC PC  +C++
Sbjct  96   ILHPDA-ASIPLSSGTSVGVGNYVTRVGLGTPVKSYVMVVDTGSSLSWLQCSPCRVSCHS  154

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS-SSTCVYGIQYGDSSFSVGFF  754
            Q   +F+P  S TY ++SCSA  C GL SAT N   CS ++ C+Y   YGD+SFSVG+ 
Sbjct  155  QVGAVFDPAASATYRSVSCSAPECHGLLSATLNPSSCSVANVCIYQASYGDTSFSVGYL  213



>emb|CBI29432.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK-KI  409
            + + H HG  S+     P + +D+L  D++RV ++++R+   R D     S + +K  + 
Sbjct  42   MTIHHVHGPGSSLAPQPPVSFSDVLAWDDARVKTLNSRLT--RKDTRFPKSVLTKKDIRF  99

Query  410  PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQE  589
            P S  +VP   G ++ +GNY V VG G+P +  +++ DTGS L+W QC+PCV  C+ Q +
Sbjct  100  PKS-VSVPLNPGASIGSGNYYVKVGFGSPARYYSMIVDTGSSLSWLQCKPCVVYCHVQAD  158

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGFFA  757
             +F+P  S TY ++SC+++ CS L  AT NNP C  SS+ CVY   YGDSS+S+G+ +
Sbjct  159  PLFDPSASKTYKSLSCTSSQCSSLVDATLNNPLCETSSNVCVYTASYGDSSYSMGYLS  216



>ref|XP_002324354.1| nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEF02919.1| nucleoid DNA-binding family protein [Populus trichocarpa]
Length=471

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 24/189 (13%)
 Frame = +2

Query  206  ASKGLRRGASLKVVHKHGGCS-TGKDNT-PTLTDILNQDESRVNSIHAR--VNSARIDNL  373
            ++K L + +SLKVV K+G C+ TG   T P+  +IL +D+ RV SI A+  +NS+     
Sbjct  57   SNKVLNKASSLKVVSKYGPCTVTGDPKTFPSAAEILRRDQLRVKSIRAKHSMNSSTTGVF  116

Query  374  NAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQC  553
            N +     K ++P           TT   G Y VTVGLG P K  +L+FDTGSDLTWTQC
Sbjct  117  NEM-----KTRVP-----------TTHFGGGYAVTVGLGTPKKDFSLLFDTGSDLTWTQC  160

Query  554  EPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGD  730
            EPC   C+ Q +  F+P  ST+Y N+SCS+  C  +   +    GCSSS +C+YG++YG 
Sbjct  161  EPCSGGCFPQNDEKFDPTKSTSYKNLSCSSEPCKSIGKESAQ--GCSSSNSCLYGVKYG-  217

Query  731  SSFSVGFFA  757
            + ++VGF A
Sbjct  218  TGYTVGFLA  226



>ref|XP_004957153.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=472

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 101/173 (58%), Gaps = 25/173 (14%)
 Frame = +2

Query  242  VVHKHGGCS---TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            VVH+HG CS         P+  +IL++D+ RV+SIH R             G G    I 
Sbjct  65   VVHRHGPCSPLLARVGGAPSHAEILDRDQDRVDSIHHRHR-----------GSGAAPAIN  113

Query  413  DSKAA----VPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYT  580
             ++A+    +PA  G +L TGNYIV+VGLG P K  ++VFDTGSDL+W QC+PC K CY 
Sbjct  114  PARASKGVSLPAHRGLSLGTGNYIVSVGLGTPRKDFSVVFDTGSDLSWVQCKPC-KDCYE  172

Query  581  QQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS-STCVYGIQYGDSS  736
            QQ+ +F+P  S+TY+ + C    C GL S+T     C+S + C Y + YGD S
Sbjct  173  QQDPLFDPAQSSTYAAVPCGDPHCRGLDSST-----CASGNRCRYEVVYGDQS  220



>ref|XP_002277380.3| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Vitis 
vinifera]
Length=459

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTP-TLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK-KI  409
            + + H HG  S+     P + +D+L  D++RV ++++R+   R D     S + +K  + 
Sbjct  42   MTIHHVHGPGSSLAPQPPVSFSDVLAWDDARVKTLNSRLT--RKDTRFPKSVLTKKDIRF  99

Query  410  PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQE  589
            P S  +VP   G ++ +GNY V VG G+P +  +++ DTGS L+W QC+PCV  C+ Q +
Sbjct  100  PKS-VSVPLNPGASIGSGNYYVKVGFGSPARYYSMIVDTGSSLSWLQCKPCVVYCHVQAD  158

Query  590  TIFNPKLSTTYSNISCSAAACSGLTSATGNNPGC--SSSTCVYGIQYGDSSFSVGFFA  757
             +F+P  S TY ++SC+++ CS L  AT NNP C  SS+ CVY   YGDSS+S+G+ +
Sbjct  159  PLFDPSASKTYKSLSCTSSQCSSLVDATLNNPLCETSSNVCVYTASYGDSSYSMGYLS  216



>gb|KDP33483.1| hypothetical protein JCGZ_07054 [Jatropha curcas]
Length=464

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 121/209 (58%), Gaps = 31/209 (15%)
 Frame = +2

Query  137  HFHTVPLTSLFptthchqphtthASKGLRRGASLKVVHKHGGC---STGKDNTPTLTDIL  307
            H HT+ +++L P+T C       + K     A+LKVVH+ G C   +    N+P +++IL
Sbjct  41   HTHTIQVSNLLPSTACKH-----SPKVAENSATLKVVHRRGSCIHLNQDNANSPNVSEIL  95

Query  308  NQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGL  487
            ++D+SRV+SIH+R+ S  ++   A S              +PAK G +L T N+IVTVGL
Sbjct  96   HEDQSRVDSIHSRI-SGNLEETKATS--------------LPAKIGASLGTANFIVTVGL  140

Query  488  GNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTS  667
            G PTK L L+FDTGSDLTW +C+P   T        F+P  ST+Y+N+ CS+  CS  T 
Sbjct  141  GTPTKDLQLIFDTGSDLTWARCQPNGDT--------FDPTQSTSYANVPCSSPLCSSSTG  192

Query  668  ATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
                    SSSTCVYG+QYGD S S G  
Sbjct  193  GALLRCSSSSSTCVYGLQYGDGSISTGLL  221



>ref|XP_006857554.1| hypothetical protein AMTR_s00061p00053330 [Amborella trichopoda]
 gb|ERN19021.1| hypothetical protein AMTR_s00061p00053330 [Amborella trichopoda]
Length=446

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 100/175 (57%), Gaps = 15/175 (9%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPD  415
            L + H HG CS      P + + L  D++RV+++ AR+             + ++ KI  
Sbjct  45   LDLHHVHGPCSPLNYTPPPIYETLRLDQARVHALAARI-------------LPKESKISQ  91

Query  416  SKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETI  595
            + A  P KSG ++  GNYI+ + LG P KS  +V DTGS LTW QC+PC+  C++Q    
Sbjct  92   ASAETPLKSGQSIGVGNYIIALNLGTPPKSYLMVVDTGSVLTWLQCQPCLD-CHSQLGPT  150

Query  596  FNPKLSTTYSNISCSAAACSGLTSATGNNPGCSS-STCVYGIQYGDSSFSVGFFA  757
            +NPK S+TYS ISC +  C+ L  AT N  GCS+   C Y   YGD SFS+G+ +
Sbjct  151  YNPKASSTYSTISCQSNYCTELQEATLNPSGCSALGVCEYEASYGDRSFSLGYLS  205



>ref|XP_011012151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Populus euphratica]
Length=405

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 105/179 (59%), Gaps = 24/179 (13%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNT-PTLTDILNQDESRVNSIHARV--NSARIDNLNAVSGVGRKK  403
            LKVV K+G C+ TG   T P+  +IL QD+ RV SI A++  NS+     N +       
Sbjct  1    LKVVSKYGPCTVTGDPKTFPSAAEILRQDQLRVKSIRAKLSMNSSTTGVFNEM-------  53

Query  404  KIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
                 K  VP    TT   G Y VTVGLG P K  +L+FDTGSDLTWTQCEPC   C+ Q
Sbjct  54   -----KTTVP----TTRFGGGYAVTVGLGTPKKDFSLLFDTGSDLTWTQCEPCSGGCFPQ  104

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFSVGFFA  757
             +  F+P  STTY N+SCS   C  +   +    GCSSS TC+YG++YG + ++VGF A
Sbjct  105  NDEKFDPTKSTTYKNLSCSTEPCKSIGKESPQ--GCSSSNTCLYGVKYG-TGYTVGFLA  160



>ref|XP_010913303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=453

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 99/175 (57%), Gaps = 18/175 (10%)
 Frame = +2

Query  236  LKVVHKHGGCS-TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIP  412
            L +  +HG CS       PTL +IL  D+ RVN +    +              R  ++ 
Sbjct  57   LAIYRRHGPCSPISSKKAPTLGEILRLDQLRVNYLQQMASHGP-----------RGTQVQ  105

Query  413  DSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQET  592
            +S+ ++PA  G+   T  Y+VTVG G P K  T+ FDTGSD++W QC+PC   CY QQE 
Sbjct  106  ESQTSIPANLGSAFGTAEYVVTVGYGTPKKDQTVDFDTGSDVSWIQCQPC-PDCYPQQEN  164

Query  593  IFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             F+P  S++Y++I CS+  CS       +  GC +STC+YG+ YGDSS +VG+ +
Sbjct  165  YFDPSQSSSYASIPCSSPQCS-----LSSRHGCFNSTCMYGVMYGDSSKTVGYLS  214



>ref|XP_010058011.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Eucalyptus 
grandis]
 gb|KCW75477.1| hypothetical protein EUGRSUZ_E04238 [Eucalyptus grandis]
Length=455

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 105/185 (57%), Gaps = 4/185 (2%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCSTGKDNTPT-LTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            +G      L + H  G  S+  + +P  LT +L +DE+R+ ++  R+   +    + +  
Sbjct  25   RGDEAAIYLDLYHVDGSNSSLGNKSPEPLTHVLARDENRIKALRYRITRTKERKPSVILN  84

Query  389  VGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK  568
                   P+S  ++PA  G +L +GNY V +GLG P K   ++ DTGS L+W QC+PCV 
Sbjct  85   QSIDILGPES-VSIPASPGLSLGSGNYYVKIGLGMPAKYNAMLLDTGSSLSWLQCQPCVI  143

Query  569  TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYGDSSFS  742
            +C+ Q + ++NP  S TY +I CS + CS L  AT N+P C   T  CVY   YGDSS+S
Sbjct  144  SCHAQVDPLYNPSASRTYKSIPCSTSQCSSLKEATLNDPLCEVETGKCVYTASYGDSSYS  203

Query  743  VGFFA  757
            +G+ +
Sbjct  204  IGYLS  208



>ref|XP_008805509.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=451

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (55%), Gaps = 23/184 (13%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVN-------SARIDNLNAVS  385
            G  L + H    CS    +  + + +L+ D+SR   + AR+N       SA +D      
Sbjct  41   GLHLTLHHPRSPCSPATLHHLSFSTVLSHDDSRAQFLAARLNKTAHRPKSALLD------  94

Query  386  GVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCV  565
                    PD+ A +P  SG ++  GNYI  +GLG P+ S  +V DTGS LTW QC PC 
Sbjct  95   --------PDA-ATIPLSSGMSIGVGNYITRIGLGTPSTSHVMVVDTGSSLTWLQCSPCR  145

Query  566  KTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFS  742
             +C+ Q   +FNP  S++Y  +SCSAA C GL SAT N   C++S  C+Y   YGDSSFS
Sbjct  146  VSCHEQVGAVFNPASSSSYRTVSCSAAECGGLQSATLNPSACTTSNVCIYQASYGDSSFS  205

Query  743  VGFF  754
            VG+ 
Sbjct  206  VGYL  209



>ref|XP_008796557.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=454

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 101/181 (56%), Gaps = 15/181 (8%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            G  L + H    CS    +    + +L+ D+SRV  + AR+  A            R K 
Sbjct  45   GLHLVLHHPRSPCSPATLHHLPFSTVLSHDDSRVEFLAARLTKA----------APRPKS  94

Query  407  I---PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
                PD+ A+VP  SG ++  GNYI  +GLG+P+ S  ++ DTGS LTW QC PC  +C+
Sbjct  95   PLLNPDA-ASVPLGSGMSIGVGNYITRIGLGSPSTSYVMLVDTGSSLTWLQCSPCRVSCH  153

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFSVGFF  754
             Q  +IF+P  S TY  +SCSA  C GL SAT N   CS+S  C+Y   YGDSS+SVG+ 
Sbjct  154  EQVGSIFDPTTSATYRPVSCSAPECDGLESATLNPSACSASNVCIYQASYGDSSYSVGYL  213

Query  755  A  757
            +
Sbjct  214  S  214



>ref|XP_008776818.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Phoenix dactylifera]
Length=365

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 6/113 (5%)
 Frame = +2

Query  422  AAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKT-CYTQQETIF  598
            A +PA SG ++ TGNY+V+VG G P K  T++FDTGSD+TW QC+PC  + CY+QQE +F
Sbjct  13   ATIPANSGGSIGTGNYVVSVGFGTPKKDFTVIFDTGSDITWIQCKPCSDSNCYSQQEPLF  72

Query  599  NPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
            +P  S+TY NISCS+  C  L S     PGCS+  C Y I+YGD+S S+GFF 
Sbjct  73   DPSQSSTYCNISCSSPNCMKLDS-----PGCSAGRCRYEIEYGDNSQSMGFFG  120



>ref|XP_010913256.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=453

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 98/181 (54%), Gaps = 14/181 (8%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            G  L + H    CS    +    + +L+ D+SR   + AR+           +G  R K 
Sbjct  42   GLHLTLHHPRSPCSPASLHHLPFSTVLSHDDSRAQFLAARLTK---------TGAPRPKS  92

Query  407  I---PDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCY  577
                PDS A +P  SG ++  GNYI  +GLG P+ S  +V DTGS LTW QC PC  +C+
Sbjct  93   ALIDPDS-ATIPLSSGMSVGVGNYITRIGLGTPSTSYVMVVDTGSSLTWLQCSPCRVSCH  151

Query  578  TQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFSVGFF  754
             Q  ++F P  S TY ++SCS   C GL SAT N   C++S  C+Y   YGDSSFSVG+ 
Sbjct  152  EQVGSVFKPSSSATYRSVSCSEPECDGLQSATLNPSACTTSNVCIYQASYGDSSFSVGYL  211

Query  755  A  757
            A
Sbjct  212  A  212



>emb|CAJ26370.1| chloroplast nucleoid binding protein [Brachypodium sylvaticum]
Length=443

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 99/172 (58%), Gaps = 19/172 (11%)
 Frame = +2

Query  242  VVHKHGGCSTGK--DNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPD  415
            V+H+HG CS  +  D+ P+  D+L  D++RV+SIH       I N  AV G         
Sbjct  22   VMHRHGPCSPLQTPDDAPSDADLLEHDQARVDSIHRM-----IANETAVVG---------  67

Query  416  SKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK-TCYTQQET  592
               ++PA+ G ++ TGNY+V+VGLG P + LT+VFDTGSDL+W QC PC    CY QQ+ 
Sbjct  68   QDVSLPAERGISVGTGNYVVSVGLGTPARDLTVVFDTGSDLSWVQCGPCSSGGCYHQQDP  127

Query  593  IFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVG  748
            +F P  S+T+S + C    C     +  ++PG     C Y + YGD S +VG
Sbjct  128  LFAPSSSSTFSAVRCGEPECPRARQSCSSSPG--DDRCPYEVVYGDKSRTVG  177



>gb|EMS52672.1| Aspartic proteinase nepenthesin-2 [Triticum urartu]
Length=458

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 106/186 (57%), Gaps = 13/186 (7%)
 Frame = +2

Query  236  LKVVHKHGGCS--TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNA-----VSGVG  394
            L + H  G CS  +   + P  T +L  D++R+ S+ AR+  A   + +A     V+ + 
Sbjct  35   LPLHHSRGPCSPVSAPSDLP-FTAVLTHDDARIASLAARLAKAPSSSSSARPTVTVASLY  93

Query  395  RKKKIPD----SKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPC  562
            R     D    S A+VP   GT+   GNY+  +GLG P K   +V DTGS LTW QC PC
Sbjct  94   RANDEVDGVAASLASVPLTPGTSYGVGNYVTRMGLGTPAKPYIMVVDTGSSLTWLQCSPC  153

Query  563  VKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSF  739
              +C+ Q   +F+PK S++Y+ +SCS   C+ L++AT N   CSSS  C+Y   YGDSSF
Sbjct  154  RVSCHRQSGPVFDPKTSSSYAAVSCSTPQCNDLSTATLNPAACSSSDVCIYQASYGDSSF  213

Query  740  SVGFFA  757
            SVG+ +
Sbjct  214  SVGYLS  219



>ref|XP_009407227.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=452

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 97/178 (54%), Gaps = 9/178 (5%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKK  406
            G  L + H    CS         + IL+ DE+RV S+ AR+  +       VS + R   
Sbjct  43   GLHLTLHHPRSPCSPAPFPDLPFSAILSHDEARVRSLAARLTKSMP---KPVSSLLRPAA  99

Query  407  IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQ  586
            I     +VP   G ++  GNYI  + LG P KS  ++ DTGS L+W QC PC  +C+ Q 
Sbjct  100  I-----SVPLSPGDSIGVGNYITRIDLGTPAKSYVMLVDTGSSLSWLQCSPCSVSCHAQV  154

Query  587  ETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS-SSTCVYGIQYGDSSFSVGFFA  757
             ++FNP  S TY  +SCSA+ C  L SAT N   CS S+ C+Y   YGDSSFSVG+ +
Sbjct  155  GSVFNPASSATYRAVSCSASECDSLESATLNPSACSQSNVCIYQASYGDSSFSVGYLS  212



>ref|XP_003534754.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=481

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 108/189 (57%), Gaps = 19/189 (10%)
 Frame = +2

Query  221  RRGASLKVVHKHGGCSTGKDNTP-TLTDILNQDESRVNSIHARV-------NSARIDNLN  376
            + G  L + H  G  S+    +P + +D++ +DE RV  +H+R+       NSA  D L 
Sbjct  50   QEGMQLNLYHVKGLDSSQTSTSPFSFSDMITKDEERVRFLHSRLTNKESVRNSATTDKLR  109

Query  377  AVSGVGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCE  556
                       P   +  P KSG ++ +GNY V +GLG P K  +++ DTGS L+W QC+
Sbjct  110  GG---------PSLVSTTPLKSGLSIGSGNYYVKIGLGTPAKYFSMIVDTGSSLSWLQCQ  160

Query  557  PCVKTCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST--CVYGIQYGD  730
            PCV  C+ Q + IF P  S TY  + CS++ CS L S+T N PGCS++T  CVY   YGD
Sbjct  161  PCVIYCHVQVDPIFTPSTSKTYKALPCSSSQCSSLKSSTLNAPGCSNATGACVYKASYGD  220

Query  731  SSFSVGFFA  757
            +SFS+G+ +
Sbjct  221  TSFSIGYLS  229



>ref|XP_008652856.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
Length=469

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 100/178 (56%), Gaps = 20/178 (11%)
 Frame = +2

Query  230  ASLKVVHKHGGCS--TGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKK  403
            ++L VVH+HG CS    +   P+  +IL++D+ RV+SIH      R+      +G     
Sbjct  63   SALSVVHRHGPCSPLLARGGEPSHAEILDRDQDRVDSIH------RMTAGPWTAGQSSAS  116

Query  404  KIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQ  583
            K      ++PA  G  L T NYIV+VGLG P + L +VFDTGSDL+W QC+PC   CY Q
Sbjct  117  K----GVSLPAHRGLRLGTANYIVSVGLGTPRRDLLVVFDTGSDLSWVQCKPC-NNCYKQ  171

Query  584  QETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFFA  757
             + +F+P  STTYS + C A  C  L S T     CSS  C Y + YGD S + G  A
Sbjct  172  HDPLFDPSQSTTYSAVPCGAQEC--LDSGT-----CSSGKCRYEVVYGDMSQTDGNLA  222



>gb|AFW86421.1| hypothetical protein ZEAMMB73_098827 [Zea mays]
Length=482

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 97/181 (54%), Gaps = 24/181 (13%)
 Frame = +2

Query  227  GASLKVVHK----HGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVG  394
            G ++++VH+     G   T  D+ P  T IL +D +RV SIH R+  A            
Sbjct  59   GNTIQIVHRACLQSGDRKTVPDHHPHYTGILRRDHNRVRSIHRRLTGAG-----------  107

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
                  D+ A +PA  G    +  Y+VT+G+G P ++ T++FDTGSDLTW QC+PC  +C
Sbjct  108  ------DTAATIPASLGLAFHSLEYVVTIGIGTPARNFTVLFDTGSDLTWVQCKPCTDSC  161

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y QQE +F+P  S+TY ++ C    C       G +  C  +TC Y ++YGD S + G  
Sbjct  162  YQQQEPLFDPSKSSTYVDVPCGTPQCK---IGGGQDLTCGGTTCEYSVKYGDQSVTRGNL  218

Query  755  A  757
            A
Sbjct  219  A  219



>ref|XP_007024419.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY27041.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=461

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 105/184 (57%), Gaps = 5/184 (3%)
 Frame = +2

Query  221  RRGASLKVVHKHG-GCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGR  397
            + G  +K+ H  G   S   + + + ++ L +DE RV ++ + V   R     + +    
Sbjct  33   QSGIHVKIYHVQGPESSLTPEFSLSFSNFLLRDEERVKALASIVAQDRGRGRGSTNSALS  92

Query  398  KKKIPDSKA---AVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK  568
            ++    S A   ++P   G ++ TGNY V +GLG P K   +V DTGS  +W QCEPC  
Sbjct  93   QRLGYWSSAKSLSIPLNPGLSIGTGNYYVRIGLGTPAKYYDVVMDTGSSFSWIQCEPCAV  152

Query  569  TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSST-CVYGIQYGDSSFSV  745
             C++Q + +FNP  STTY  +SC+A+ CS L  AT NNP CS+S  C+Y   YGDSS+S+
Sbjct  153  YCHSQADPVFNPSASTTYKYLSCAASECSSLKEATLNNPLCSTSNKCLYTASYGDSSYSI  212

Query  746  GFFA  757
            G+ +
Sbjct  213  GYLS  216



>ref|XP_008659479.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
Length=439

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 97/181 (54%), Gaps = 24/181 (13%)
 Frame = +2

Query  227  GASLKVVHK----HGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVG  394
            G ++++VH+     G   T  D+ P  T IL +D +RV SIH R+  A            
Sbjct  16   GNTIQIVHRACLQSGDRKTVPDHHPHYTGILRRDHNRVRSIHRRLTGAG-----------  64

Query  395  RKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTC  574
                  D+ A +PA  G    +  Y+VT+G+G P ++ T++FDTGSDLTW QC+PC  +C
Sbjct  65   ------DTAATIPASLGLAFHSLEYVVTIGIGTPARNFTVLFDTGSDLTWVQCKPCTDSC  118

Query  575  YTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVGFF  754
            Y QQE +F+P  S+TY ++ C    C       G +  C  +TC Y ++YGD S + G  
Sbjct  119  YQQQEPLFDPSKSSTYVDVPCGTPQCK---IGGGQDLTCGGTTCEYSVKYGDQSVTRGNL  175

Query  755  A  757
            A
Sbjct  176  A  176



>ref|XP_003570481.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=455

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 100/175 (57%), Gaps = 6/175 (3%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPD  415
            L + H  G CS    + P  + +L  D +R+ S  AR+      +  + +     +    
Sbjct  45   LPLHHPRGPCSPLSADIP-FSAVLTHDAARIASFAARLAKKSSPSSASAT----TQAAGS  99

Query  416  SKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETI  595
            S A+VP   GT++  GNY+  +GLG P K   +V DTGS LTW QC PC  +C+ Q   +
Sbjct  100  SLASVPLTPGTSVGVGNYVTRMGLGTPAKPYIMVVDTGSSLTWLQCSPCRVSCHRQSGPV  159

Query  596  FNPKLSTTYSNISCSAAACSGLTSATGNNPGCS-SSTCVYGIQYGDSSFSVGFFA  757
            F+PK S++Y+ +SCS+  C GL++AT N   CS S+ C+Y   YGDSSFSVG+ +
Sbjct  160  FDPKTSSSYAAVSCSSPQCDGLSTATLNPAVCSPSNVCIYQASYGDSSFSVGYLS  214



>ref|XP_003594399.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula]
 gb|AES64650.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=452

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 103/176 (59%), Gaps = 9/176 (5%)
 Frame = +2

Query  236  LKVVHKHGGCSTGKDNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRKKKIPD  415
            LK+ H     S     +     +  +DE R+   H+R+  A+  + NA S     KK+  
Sbjct  33   LKLYHMTSLKSPPNSTSLLFAYMFAKDEERIRYFHSRL--AKNSDANASS-----KKVGP  85

Query  416  SKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKTCYTQQETI  595
              A +P KSG ++ +GNY V +GLG+PTK  T++ DTGS  +W QC+PC   C+ Q++ +
Sbjct  86   KLAGIPLKSGLSMGSGNYYVKMGLGSPTKYYTMIVDTGSSFSWLQCQPCTIYCHIQEDPV  145

Query  596  FNPKLSTTYSNISCSAAACSGLTSATGNNPGCS--SSTCVYGIQYGDSSFSVGFFA  757
            FNP  S TY  + CS++ CS L SAT N P CS  S+ CVY   YGDSSFS+G+ +
Sbjct  146  FNPSASKTYKTVPCSSSQCSSLKSATLNEPTCSKQSNACVYKASYGDSSFSLGYLS  201



>gb|ABR16115.1| unknown [Picea sitchensis]
Length=482

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 104/183 (57%), Gaps = 15/183 (8%)
 Frame = +2

Query  212  KGLRRGASLKVVHKHGGCSTGKD-NTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSG  388
            + L+ G  +++ H HG CS  +  N+ +  D+++Q   R N   AR+N+ R  N    + 
Sbjct  64   EALKPGVKIRLDHIHGACSPLRPINSSSWIDLVSQSFERDN---ARLNTIRSKNSGPYT-  119

Query  389  VGRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK  568
                     + + +P +SGTT+ TGNYIVT G G P K+  L+ DTGSDLTW QC+PC  
Sbjct  120  ---------TMSNLPLQSGTTVGTGNYIVTAGFGTPAKNSLLIIDTGSDLTWIQCKPCAD  170

Query  569  TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSSTCVYGIQYGDSSFSVG  748
             CY+Q + IF PK S++Y  + C +A C+ L ++  N   C    CVY I YGD S S G
Sbjct  171  -CYSQVDAIFEPKQSSSYKTLPCLSATCTELITSESNPTPCLLGGCVYEINYGDGSSSQG  229

Query  749  FFA  757
             F+
Sbjct  230  DFS  232



>ref|XP_004965303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=462

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 103/184 (56%), Gaps = 8/184 (4%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGK--DNTPTLTDILNQDESRVNSIHARVNSARIDNLNAVSGVGRK  400
            G  L + H    CS      + P  + +L  D++R   + +R+++         + +  K
Sbjct  41   GLHLTLHHPQSACSPAPLPSDLP-FSTVLTHDDARAAHLASRLDTNNDAPPRRPTSLRSK  99

Query  401  KK----IPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVK  568
            KK    + DS A+VP   G ++  GNY+  +GLG P  S  +V DTGS LTW QC PCV 
Sbjct  100  KKAAGHLDDSLASVPLSPGASIGVGNYVTQLGLGTPATSYAMVVDTGSSLTWLQCSPCVV  159

Query  569  TCYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCS-SSTCVYGIQYGDSSFSV  745
            +C+ Q   +F+P+ S+TY+++ CSA+ C  L +AT N   CS S  CVY   YGDSSFSV
Sbjct  160  SCHRQAGPLFDPRSSSTYASVPCSASQCGELQAATLNPSACSVSGVCVYQASYGDSSFSV  219

Query  746  GFFA  757
            G+ +
Sbjct  220  GYLS  223



>ref|XP_006647807.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Oryza 
brachyantha]
Length=458

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 100/183 (55%), Gaps = 12/183 (7%)
 Frame = +2

Query  227  GASLKVVHKHGGCSTGKDNTPTLTD-----ILNQDESRVNSIHARVNSARIDNLNAVSGV  391
            G  L++ H    CS      P   D     +L  D++R+ S+ AR+  A+  +    S  
Sbjct  43   GLHLELHHPRSPCSP----VPVPADLPFSAVLTHDDARIASLAARL--AKTPSARPTSLE  96

Query  392  GRKKKIPDSKAAVPAKSGTTLSTGNYIVTVGLGNPTKSLTLVFDTGSDLTWTQCEPCVKT  571
                    S A+VP   G ++  GNY+  +GLG P     +V DTGS LTW QC PC+ +
Sbjct  97   XXXXXXAGSLASVPLSPGASVGVGNYVTRMGLGTPATQYVMVVDTGSSLTWLQCSPCLVS  156

Query  572  CYTQQETIFNPKLSTTYSNISCSAAACSGLTSATGNNPGCSSS-TCVYGIQYGDSSFSVG  748
            C+ Q   + NPK S+TY+++SCSA  C  L+SAT N   CSSS  C+Y   YGDSSFSVG
Sbjct  157  CHRQAGPVVNPKASSTYASVSCSAQQCDDLSSATLNPSACSSSNVCIYQASYGDSSFSVG  216

Query  749  FFA  757
            + +
Sbjct  217  YLS  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260