BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040P05

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788433.1|  PREDICTED: SCY1-like protein 2                     258   4e-83   Nicotiana sylvestris
ref|XP_009601552.1|  PREDICTED: SCY1-like protein 2                     250   9e-74   Nicotiana tomentosiformis
ref|XP_006362717.1|  PREDICTED: SCY1-like protein 2-like                248   9e-73   Solanum tuberosum [potatoes]
ref|XP_004250719.1|  PREDICTED: SCY1-like protein 2                     247   2e-72   Solanum lycopersicum
gb|KDO45470.1|  hypothetical protein CISIN_1g0453201mg                  230   2e-72   Citrus sinensis [apfelsine]
gb|EYU22712.1|  hypothetical protein MIMGU_mgv1a000991mg                244   1e-71   Erythranthe guttata [common monkey flower]
emb|CDP20126.1|  unnamed protein product                                243   5e-71   Coffea canephora [robusta coffee]
ref|XP_008358266.1|  PREDICTED: SCY1-like protein 2                     225   6e-71   
gb|EPS68984.1|  hypothetical protein M569_05783                         232   6e-69   Genlisea aurea
ref|XP_007019922.1|  Kinase family protein with ARM repeat domain...    232   4e-67   
ref|XP_007019921.1|  Kinase family protein with ARM repeat domain...    232   4e-67   
ref|XP_006478453.1|  PREDICTED: SCY1-like protein 2-like                231   1e-66   Citrus sinensis [apfelsine]
ref|XP_006441714.1|  hypothetical protein CICLE_v10018760mg             229   2e-66   Citrus clementina [clementine]
ref|XP_004290244.1|  PREDICTED: SCY1-like protein 2                     229   2e-66   Fragaria vesca subsp. vesca
ref|XP_008361497.1|  PREDICTED: SCY1-like protein 2                     221   2e-65   
ref|XP_010415850.1|  PREDICTED: SCY1-like protein 2                     227   2e-65   Camelina sativa [gold-of-pleasure]
gb|KHG06707.1|  SCY1-like protein 2                                     227   2e-65   Gossypium arboreum [tree cotton]
ref|XP_010471155.1|  PREDICTED: SCY1-like protein 2                     226   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006300351.1|  hypothetical protein CARUB_v10021914mg             226   3e-65   Capsella rubella
ref|XP_010427973.1|  PREDICTED: SCY1-like protein 2                     226   4e-65   Camelina sativa [gold-of-pleasure]
ref|NP_173700.2|  protein kinase family protein                         226   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306722.1|  hypothetical protein CARUB_v10008248mg             226   4e-65   Capsella rubella
ref|XP_004164535.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...    226   4e-65   
ref|XP_009105810.1|  PREDICTED: SCY1-like protein 2                     226   5e-65   Brassica rapa
gb|KJB60121.1|  hypothetical protein B456_009G290500                    226   5e-65   Gossypium raimondii
ref|XP_004141537.1|  PREDICTED: SCY1-like protein 2-like                226   5e-65   Cucumis sativus [cucumbers]
ref|XP_003534437.1|  PREDICTED: SCY1-like protein 2-like isoform X1     226   5e-65   Glycine max [soybeans]
ref|XP_002273755.1|  PREDICTED: SCY1-like protein 2                     226   6e-65   Vitis vinifera
ref|XP_010521095.1|  PREDICTED: SCY1-like protein 2                     225   7e-65   Tarenaya hassleriana [spider flower]
ref|XP_002888835.1|  kinase family protein                              225   7e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_008459573.1|  PREDICTED: SCY1-like protein 2                     225   9e-65   Cucumis melo [Oriental melon]
ref|XP_006416147.1|  hypothetical protein EUTSA_v10006737mg             225   9e-65   Eutrema salsugineum [saltwater cress]
ref|XP_008237746.1|  PREDICTED: SCY1-like protein 2                     224   1e-64   Prunus mume [ume]
ref|XP_008348711.1|  PREDICTED: SCY1-like protein 2                     224   2e-64   
ref|XP_007201757.1|  hypothetical protein PRUPE_ppa001052mg             224   2e-64   Prunus persica
ref|XP_009366853.1|  PREDICTED: SCY1-like protein 2 isoform X1          224   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_003540550.1|  PREDICTED: SCY1-like protein 2-like                224   2e-64   Glycine max [soybeans]
ref|XP_011095377.1|  PREDICTED: SCY1-like protein 2                     224   2e-64   Sesamum indicum [beniseed]
ref|XP_010477557.1|  PREDICTED: SCY1-like protein 2                     223   3e-64   Camelina sativa [gold-of-pleasure]
emb|CDX72804.1|  BnaC06g32520D                                          223   3e-64   
gb|KFK41573.1|  hypothetical protein AALP_AA2G146900                    223   3e-64   Arabis alpina [alpine rockcress]
ref|XP_010063716.1|  PREDICTED: SCY1-like protein 2                     223   4e-64   Eucalyptus grandis [rose gum]
ref|NP_177297.1|  putative protein kinase                               223   4e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01849.1|  hypothetical protein                                   223   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498773.1|  PREDICTED: SCY1-like protein 2 isoform X2          223   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010112043.1|  SCY1-like protein 2                                223   7e-64   Morus notabilis
ref|XP_010534134.1|  PREDICTED: SCY1-like protein 2 isoform X3          223   8e-64   Tarenaya hassleriana [spider flower]
ref|XP_010498772.1|  PREDICTED: SCY1-like protein 2 isoform X1          222   8e-64   
ref|XP_002890539.1|  kinase family protein                              222   8e-64   Arabidopsis lyrata subsp. lyrata
emb|CDX96321.1|  BnaA07g29320D                                          222   8e-64   
ref|XP_006390775.1|  hypothetical protein EUTSA_v10018097mg             222   1e-63   Eutrema salsugineum [saltwater cress]
ref|XP_010460052.1|  PREDICTED: SCY1-like protein 2                     222   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009115591.1|  PREDICTED: SCY1-like protein 2                     222   1e-63   Brassica rapa
emb|CDY03692.1|  BnaA02g15450D                                          222   1e-63   
emb|CDY37942.1|  BnaC02g20690D                                          221   1e-63   Brassica napus [oilseed rape]
emb|CDY04777.1|  BnaC05g18120D                                          221   2e-63   
ref|XP_010279109.1|  PREDICTED: SCY1-like protein 2 isoform X1          221   2e-63   Nelumbo nucifera [Indian lotus]
ref|XP_002319896.2|  hypothetical protein POPTR_0013s10610g             221   4e-63   Populus trichocarpa [western balsam poplar]
emb|CDP07807.1|  unnamed protein product                                219   4e-63   Coffea canephora [robusta coffee]
ref|XP_009127867.1|  PREDICTED: SCY1-like protein 2                     220   4e-63   Brassica rapa
ref|XP_002525488.1|  ATP binding protein, putative                      219   8e-63   
ref|XP_007133873.1|  hypothetical protein PHAVU_011G216200g             219   1e-62   Phaseolus vulgaris [French bean]
ref|XP_010248020.1|  PREDICTED: SCY1-like protein 2                     216   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_011004854.1|  PREDICTED: SCY1-like protein 2                     218   2e-62   Populus euphratica
gb|KDP45586.1|  hypothetical protein JCGZ_17193                         218   3e-62   Jatropha curcas
gb|KJB59598.1|  hypothetical protein B456_009G262900                    217   6e-62   Gossypium raimondii
ref|XP_003605415.1|  SCY1-like protein                                  207   1e-61   
gb|KFK44375.1|  hypothetical protein AALP_AA1G249300                    216   2e-61   Arabis alpina [alpine rockcress]
ref|XP_003569359.1|  PREDICTED: SCY1-like protein 2                     215   3e-61   Brachypodium distachyon [annual false brome]
gb|KJB26955.1|  hypothetical protein B456_004G267700                    214   3e-60   Gossypium raimondii
gb|KHG01693.1|  SCY1-like protein 2                                     213   5e-60   Gossypium arboreum [tree cotton]
emb|CDM83285.1|  unnamed protein product                                211   8e-60   Triticum aestivum [Canadian hard winter wheat]
gb|EMS46807.1|  SCY1-like protein 2                                     211   3e-59   Triticum urartu
ref|XP_010913247.1|  PREDICTED: SCY1-like protein 2                     209   6e-59   Elaeis guineensis
gb|AES87595.2|  ARM repeat kinase family protein                        209   6e-59   Medicago truncatula
ref|XP_003605398.1|  SCY1-like protein                                  208   1e-58   
ref|XP_009393077.1|  PREDICTED: SCY1-like protein 2                     207   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006852429.1|  hypothetical protein AMTR_s00021p00078920          206   6e-58   Amborella trichopoda
ref|XP_010677079.1|  PREDICTED: SCY1-like protein 2                     200   6e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010534131.1|  PREDICTED: SCY1-like protein 2 isoform X1          199   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_002455952.1|  hypothetical protein SORBIDRAFT_03g027880          199   3e-55   Sorghum bicolor [broomcorn]
ref|XP_008675496.1|  PREDICTED: SCY1-like protein 2                     199   4e-55   Zea mays [maize]
ref|XP_008654448.1|  PREDICTED: uncharacterized protein LOC100194...    198   7e-55   
ref|XP_004969167.1|  PREDICTED: SCY1-like protein 2-like                197   8e-55   Setaria italica
gb|KHN19409.1|  SCY1-like protein 2                                     195   4e-54   Glycine soja [wild soybean]
ref|XP_002963091.1|  hypothetical protein SELMODRAFT_165698             194   5e-54   Selaginella moellendorffii
ref|XP_010534132.1|  PREDICTED: SCY1-like protein 2 isoform X2          193   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_002980242.1|  hypothetical protein SELMODRAFT_178166             193   2e-53   Selaginella moellendorffii
ref|XP_001777004.1|  predicted protein                                  192   5e-53   
gb|EAZ12691.1|  hypothetical protein OsJ_02609                          192   9e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EAY74967.1|  hypothetical protein OsI_02864                          192   9e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_006646100.1|  PREDICTED: SCY1-like protein 2-like                124   6e-29   Oryza brachyantha
ref|XP_008671504.1|  PREDICTED: uncharacterized protein LOC103648904    107   5e-25   
ref|XP_009043653.1|  hypothetical protein LOTGIDRAFT_151904           94.7    7e-19   Lottia gigantea
gb|EJW76801.1|  other/SCY1 protein kinase                             92.8    2e-18   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KIY94415.1|  hypothetical protein MNEG_13548                       87.0    5e-18   Monoraphidium neglectum
ref|XP_003143373.1|  SCY1 protein kinase                              92.0    1e-17   Loa loa
gb|KDD72582.1|  hypothetical protein H632_c3167p0                     86.3    1e-17   Helicosporidium sp. ATCC 50920
ref|XP_001892158.1|  Protein kinase domain containing protein         90.9    2e-17   Brugia malayi [agent of lymphatic filariasis]
ref|XP_002127212.1|  PREDICTED: SCY1-like protein 2                   91.3    2e-17   Ciona intestinalis [sea vase]
emb|CDQ03616.1|  Protein Bm9111, isoform b                            91.3    2e-17   
gb|EUB58096.1|  SCY1-like protein                                     90.5    3e-17   Echinococcus granulosus
emb|CDS22687.1|  scy1 protein 2                                       90.5    3e-17   Echinococcus granulosus
emb|CDS35900.1|  scy1 protein 2                                       88.2    2e-16   Echinococcus multilocularis
gb|KHN80443.1|  SCY1-like protein 2                                   88.2    2e-16   Toxocara canis
emb|CDS31865.1|  scy1 protein 2                                       88.2    3e-16   Hymenolepis microstoma
emb|CDW52923.1|  Pkinase domain containing protein                    85.9    6e-16   Trichuris trichiura
ref|XP_011441145.1|  PREDICTED: SCY1-like protein 2                   86.7    7e-16   Crassostrea gigas
ref|XP_008548320.1|  PREDICTED: SCY1-like protein 2                   86.3    8e-16   Microplitis demolitor
gb|EFX89231.1|  hypothetical protein DAPPUDRAFT_1152                  84.7    2e-15   Daphnia pulex
ref|XP_005097980.1|  PREDICTED: SCY1-like protein 2-like              85.1    2e-15   
gb|ERG82889.1|  scy1-like protein 2                                   84.7    2e-15   
gb|KHJ43435.1|  VHS domain protein                                    85.1    3e-15   Trichuris suis
gb|KFM57018.1|  SCY1-like protein 2                                   83.2    9e-15   Stegodyphus mimosarum
ref|XP_008487864.1|  PREDICTED: SCY1-like protein 2                   81.6    2e-14   
emb|CAY54151.1|  unnamed protein product                              81.6    3e-14   Heliconius melpomene [common postman]
ref|XP_009171219.1|  hypothetical protein T265_07437                  81.6    3e-14   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_011065985.1|  PREDICTED: SCY1-like protein 2                   81.6    3e-14   Acromyrmex echinatior
gb|KGB40456.1|  SCY1-like protein 2                                   81.3    3e-14   Schistosoma haematobium
ref|XP_797681.2|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like prote...  81.3    4e-14   
ref|XP_011171073.1|  PREDICTED: SCY1-like protein 2                   80.5    6e-14   Solenopsis invicta [imported red fire ant]
ref|XP_001944793.1|  PREDICTED: SCY1-like protein 2                   80.5    6e-14   Acyrthosiphon pisum
gb|EFZ10635.1|  hypothetical protein SINV_03385                       80.5    6e-14   
gb|AGC92739.1|  SCY1-like protein 2                                   80.5    7e-14   Heliconius erato
gb|KDR18011.1|  hypothetical protein L798_07802                       80.1    7e-14   Zootermopsis nevadensis
ref|XP_009020976.1|  hypothetical protein HELRODRAFT_192420           76.6    8e-14   Helobdella robusta
ref|XP_011262686.1|  PREDICTED: SCY1-like protein 2                   80.1    9e-14   Camponotus floridanus
gb|KFH73263.1|  SCY1 protein kinase                                   79.7    1e-13   Mortierella verticillata NRRL 6337
ref|XP_011152169.1|  PREDICTED: SCY1-like protein 2                   79.0    2e-13   Harpegnathos saltator
ref|XP_005185357.1|  PREDICTED: SCY1-like protein 2                   79.0    2e-13   Musca domestica
ref|XP_001603554.1|  PREDICTED: SCY1-like protein 2                   79.0    2e-13   Nasonia vitripennis
ref|XP_010795536.1|  PREDICTED: SCY1-like protein 2 isoform X2        79.0    2e-13   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010795535.1|  PREDICTED: SCY1-like protein 2 isoform X1        79.0    3e-13   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_002591089.1|  hypothetical protein BRAFLDRAFT_119065           79.0    3e-13   Branchiostoma floridae
gb|EHJ75302.1|  hypothetical protein KGM_08305                        78.6    3e-13   
ref|XP_006816046.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  78.6    3e-13   Saccoglossus kowalevskii
ref|XP_010736936.1|  PREDICTED: SCY1-like protein 2                   78.6    3e-13   
ref|XP_005810784.1|  PREDICTED: SCY1-like protein 2-like              78.2    4e-13   
ref|XP_001999469.1|  GI23050                                          78.2    4e-13   Drosophila mojavensis
ref|XP_011497019.1|  PREDICTED: SCY1-like protein 2                   77.4    6e-13   Ceratosolen solmsi marchali
ref|XP_011489472.1|  PREDICTED: SCY1-like protein 2 isoform X2        77.4    6e-13   Oryzias latipes [Japanese rice fish]
ref|XP_008482138.1|  PREDICTED: SCY1-like protein 2                   72.8    6e-13   Diaphorina citri
ref|XP_008398793.1|  PREDICTED: SCY1-like protein 2 isoform X2        77.4    7e-13   Poecilia reticulata
ref|XP_011489471.1|  PREDICTED: SCY1-like protein 2 isoform X1        77.4    7e-13   Oryzias latipes [Japanese rice fish]
ref|XP_007564128.1|  PREDICTED: SCY1-like protein 2                   77.4    7e-13   Poecilia formosa
ref|XP_008398792.1|  PREDICTED: SCY1-like protein 2 isoform X1        77.4    7e-13   Poecilia reticulata
ref|XP_011332287.1|  PREDICTED: SCY1-like protein 2                   77.0    8e-13   
ref|XP_002603632.1|  hypothetical protein BRAFLDRAFT_101363           77.4    8e-13   Branchiostoma floridae
gb|AAI71604.1|  Si:ch211-244b2.1                                      77.0    9e-13   Danio rerio [leopard danio]
ref|NP_001074268.1|  SCY1-like protein 2                              77.0    9e-13   Danio rerio [leopard danio]
ref|XP_009298667.1|  PREDICTED: SCY1-like protein 2 isoform X2        77.0    9e-13   Danio rerio [leopard danio]
ref|XP_003704464.1|  PREDICTED: SCY1-like protein 2-like              77.0    1e-12   
emb|CDQ83779.1|  unnamed protein product                              75.1    1e-12   Oncorhynchus mykiss
ref|XP_002508802.1|  predicted protein                                77.0    1e-12   Micromonas commoda
ref|XP_001994272.1|  GH10138                                          76.6    1e-12   Drosophila grimshawi
ref|XP_005733558.1|  PREDICTED: SCY1-like protein 2-like isoform X2   76.6    1e-12   Pundamilia nyererei
ref|XP_005733557.1|  PREDICTED: SCY1-like protein 2-like isoform X1   76.6    1e-12   Pundamilia nyererei
ref|XP_002054795.1|  GJ24635                                          76.6    1e-12   Drosophila virilis
ref|XP_006780838.1|  PREDICTED: SCY1-like protein 2-like isoform X2   76.6    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008277103.1|  PREDICTED: SCY1-like protein 2                   76.6    1e-12   Stegastes partitus
ref|XP_004548377.1|  PREDICTED: SCY1-like protein 2-like              76.3    1e-12   
ref|XP_006780837.1|  PREDICTED: SCY1-like protein 2-like isoform X1   76.3    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005451651.1|  PREDICTED: SCY1-like protein 2 isoform X3        76.3    2e-12   Oreochromis niloticus
ref|XP_001955375.1|  GF16268                                          76.3    2e-12   Drosophila ananassae
ref|XP_007235023.1|  PREDICTED: SCY1-like protein 2-like isoform X2   76.3    2e-12   
ref|XP_005451649.1|  PREDICTED: SCY1-like protein 2 isoform X1        76.3    2e-12   Oreochromis niloticus
ref|XP_004589681.1|  PREDICTED: SCY1-like protein 2                   76.3    2e-12   Ochotona princeps [southern American pika]
ref|XP_007235022.1|  PREDICTED: SCY1-like protein 2-like isoform X1   76.3    2e-12   
emb|CDQ81367.1|  unnamed protein product                              75.1    2e-12   Oncorhynchus mykiss
emb|CAH92591.1|  hypothetical protein                                 73.9    2e-12   Pongo abelii [orang utan]
ref|XP_007893557.1|  PREDICTED: SCY1-like protein 2                   75.9    2e-12   Callorhinchus milii [Australian ghost shark]
ref|XP_003972836.1|  PREDICTED: SCY1-like protein 2-like              75.9    3e-12   
ref|XP_395903.3|  PREDICTED: SCY1-like protein 2-like                 75.5    3e-12   Apis mellifera [bee]
emb|CAG01880.1|  unnamed protein product                              75.5    3e-12   Tetraodon nigroviridis
ref|XP_003697658.1|  PREDICTED: SCY1-like protein 2                   75.5    3e-12   Apis florea [dwarf honeybee]
gb|ELK25986.1|  SCY1-like protein 2                                   73.9    3e-12   Myotis davidii
ref|XP_004930703.1|  PREDICTED: SCY1-like protein 2-like              75.1    4e-12   Bombyx mori [silk moth]
ref|XP_005930278.1|  PREDICTED: SCY1-like protein 2-like isoform X3   75.1    4e-12   Haplochromis burtoni
ref|XP_005930276.1|  PREDICTED: SCY1-like protein 2-like isoform X1   75.1    4e-12   Haplochromis burtoni
ref|XP_308053.4|  AGAP002142-PA                                       75.1    4e-12   Anopheles gambiae str. PEST
ref|XP_002105285.1|  GD21400                                          74.7    4e-12   Drosophila simulans
ref|XP_002098647.1|  GE23820                                          74.7    4e-12   Drosophila yakuba
ref|XP_002037140.1|  GM12753                                          74.7    4e-12   Drosophila sechellia
ref|NP_651655.1|  CG1951                                              74.7    4e-12   Drosophila melanogaster
ref|XP_005845619.1|  hypothetical protein CHLNCDRAFT_136879           74.3    5e-12   Chlorella variabilis
ref|XP_006871176.1|  PREDICTED: SCY1-like protein 2                   74.7    5e-12   Chrysochloris asiatica
gb|EAW97630.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_a            73.9    6e-12   Homo sapiens [man]
ref|XP_004324221.1|  PREDICTED: SCY1-like protein 2                   74.3    6e-12   
ref|XP_006888580.1|  PREDICTED: SCY1-like protein 2                   74.3    6e-12   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007945392.1|  PREDICTED: SCY1-like protein 2                   74.3    7e-12   Orycteropus afer afer
ref|XP_007465388.1|  PREDICTED: SCY1-like protein 2                   74.3    7e-12   Lipotes vexillifer [baiji]
ref|XP_007165888.1|  PREDICTED: SCY1-like protein 2 isoform X2        74.3    7e-12   Balaenoptera acutorostrata scammoni
ref|XP_007103423.1|  PREDICTED: SCY1-like protein 2 isoform X1        74.3    7e-12   Physeter catodon
ref|XP_004269537.1|  PREDICTED: SCY1-like protein 2 isoform 1         74.3    7e-12   Orcinus orca [Orca]
ref|XP_004006699.1|  PREDICTED: SCY1-like protein 2                   74.3    7e-12   
ref|XP_007165887.1|  PREDICTED: SCY1-like protein 2 isoform X1        74.3    7e-12   Balaenoptera acutorostrata scammoni
ref|XP_006620198.1|  PREDICTED: SCY1-like protein 2-like              74.3    7e-12   Apis dorsata [rock honeybee]
ref|XP_001981409.1|  GG11631                                          74.3    7e-12   Drosophila erecta
ref|XP_005305307.1|  PREDICTED: SCY1-like protein 2 isoform X2        74.3    7e-12   Chrysemys picta bellii
ref|XP_005305306.1|  PREDICTED: SCY1-like protein 2 isoform X1        74.3    7e-12   Chrysemys picta bellii
ref|XP_004650608.1|  PREDICTED: SCY1-like protein 2                   74.3    8e-12   Jaculus jaculus
gb|ERL86428.1|  hypothetical protein D910_03835                       73.6    8e-12   Dendroctonus ponderosae
gb|ELK10343.1|  SCY1-like protein 2                                   73.9    8e-12   Pteropus alecto
ref|XP_003385265.2|  PREDICTED: SCY1-like protein 2                   74.3    8e-12   Amphimedon queenslandica
gb|EAW97636.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_g            73.9    8e-12   Homo sapiens [man]
gb|EAW97634.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_e            73.9    8e-12   Homo sapiens [man]
ref|XP_969159.1|  PREDICTED: SCY1-like protein 2                      73.9    8e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_005322434.1|  PREDICTED: SCY1-like protein 2                   74.3    8e-12   Ictidomys tridecemlineatus
ref|XP_011384924.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    8e-12   Pteropus vampyrus
ref|XP_011384905.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    8e-12   Pteropus vampyrus
ref|XP_006914628.1|  PREDICTED: SCY1-like protein 2                   73.9    8e-12   Pteropus alecto
gb|EAW97631.1|  SCY1-like 2 (S. cerevisiae), isoform CRA_b            73.6    9e-12   Homo sapiens [man]
ref|XP_004675824.1|  PREDICTED: SCY1-like protein 2                   73.9    9e-12   
ref|XP_004995080.1|  SCY1 protein kinase                              73.9    9e-12   Salpingoeca rosetta
gb|EDM16977.1|  SCY1-like 2 (S. cerevisiae) (predicted), isoform ...  73.6    9e-12   Rattus norvegicus [brown rat]
gb|EPY74347.1|  hypothetical protein CB1_002098003                    73.9    9e-12   Camelus ferus
ref|XP_003475920.1|  PREDICTED: SCY1-like protein 2                   73.9    9e-12   
gb|EGW06681.1|  SCY1-like protein 2                                   73.6    9e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_007085720.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    9e-12   
ref|XP_004469271.1|  PREDICTED: SCY1-like protein 2 isoform 2         73.9    9e-12   
ref|XP_004469270.1|  PREDICTED: SCY1-like protein 2 isoform 1         73.9    9e-12   
tpg|DAA29574.1|  TPA: SCY1-like 2                                     73.9    9e-12   Bos taurus [bovine]
ref|XP_001634807.1|  predicted protein                                73.6    9e-12   Nematostella vectensis
ref|XP_009246420.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   
ref|XP_008590888.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    1e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010629690.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Fukomys damarensis [Damara mole rat]
ref|XP_008703944.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Ursus maritimus [white bear]
ref|XP_008590887.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008514598.1|  PREDICTED: SCY1-like protein 2 isoform X4        73.9    1e-11   Equus przewalskii [Przewalski horse]
ref|XP_008142998.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Eptesicus fuscus
ref|XP_002928531.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Ailuropoda melanoleuca
ref|XP_007613789.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    1e-11   
ref|XP_006769443.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_006084160.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  73.9    1e-11   
ref|XP_005956563.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    1e-11   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005882412.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Myotis brandtii
ref|XP_005680555.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_004623885.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Octodon degus
ref|XP_003783366.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Otolemur garnettii
ref|XP_011282474.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Felis catus [cat]
ref|XP_010988300.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Camelus dromedarius [camel]
ref|XP_010961079.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Camelus bactrianus [camel]
ref|XP_010829895.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Bison bison bison
ref|XP_010381872.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Rhinopithecus roxellana
ref|XP_008849370.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Nannospalax galili
ref|XP_008590886.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008514597.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    1e-11   Equus przewalskii [Przewalski horse]
ref|XP_008062879.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Carlito syrichta
ref|XP_008002559.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Chlorocebus sabaeus
ref|XP_009002693.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Callithrix jacchus [common marmoset]
ref|XP_005629329.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|NP_060458.3|  SCY1-like protein 2                                 73.9    1e-11   Homo sapiens [man]
ref|XP_007613787.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_007646084.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_006050173.1|  PREDICTED: SCY1-like protein 2 isoform X4        73.9    1e-11   Bubalus bubalis [domestic water buffalo]
ref|XP_006730222.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Leptonychotes weddellii
ref|XP_006513522.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    1e-11   
ref|XP_006141442.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  73.9    1e-11   
ref|XP_006214426.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   Vicugna pacos
ref|XP_006193396.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Camelus ferus
ref|XP_005956561.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005680554.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_004743009.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Mustela putorius furo [black ferret]
ref|XP_004418067.1|  PREDICTED: SCY1-like protein 2 isoform 1         73.9    1e-11   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004403918.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Odobenus rosmarus divergens
ref|XP_005889654.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   Bos mutus
ref|XP_004053789.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_010338511.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   Saimiri boliviensis boliviensis
ref|XP_003269950.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001095999.1|  SCY1-like protein 2                              73.9    1e-11   Bos taurus [bovine]
ref|XP_001153456.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|NP_001253819.1|  SCY1-like protein 2                              73.9    1e-11   Macaca mulatta [rhesus macaque]
ref|XP_001915850.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  73.9    1e-11   
ref|NP_932138.1|  SCY1-like protein 2                                 73.9    1e-11   Mus musculus [mouse]
ref|XP_007085718.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   Panthera tigris altaica
ref|NP_001178709.1|  SCY1-like protein 2                              73.9    1e-11   Rattus norvegicus [brown rat]
ref|XP_008255168.1|  PREDICTED: SCY1-like protein 2                   73.9    1e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_010629688.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   Fukomys damarensis [Damara mole rat]
ref|XP_006050172.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    1e-11   Bubalus bubalis [domestic water buffalo]
ref|XP_006769442.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_005882411.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_004787252.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_003907061.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  73.9    1e-11   
ref|XP_010338510.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_009002692.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_008062878.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_008002557.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_006050170.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_006513521.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_006241304.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_005629328.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_005572038.1|  PREDICTED: uncharacterized LOC101867288 isof...  73.9    1e-11   
ref|XP_004743008.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_008956284.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_011241696.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_006241303.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_008514596.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_008514595.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_008313756.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.9    1e-11   
ref|XP_003743498.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_003493344.1|  PREDICTED: SCY1-like protein 2-like              73.6    1e-11   
ref|XP_003402082.1|  PREDICTED: SCY1-like protein 2-like              73.6    1e-11   
ref|XP_008313755.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_006125915.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.9    1e-11   
ref|XP_006125914.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.9    1e-11   
ref|XP_008313753.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
ref|XP_006979886.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.6    1e-11   
ref|XP_006979885.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
ref|XP_006633186.1|  PREDICTED: SCY1-like protein 2-like              73.9    1e-11   
ref|XP_005374586.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
ref|XP_010597918.1|  PREDICTED: SCY1-like protein 2 isoform X3        73.6    1e-11   
ref|XP_011206711.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_010597909.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.6    1e-11   
ref|XP_003405335.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.6    1e-11   
ref|XP_003126739.3|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_011184986.1|  PREDICTED: SCY1-like protein 2                   73.6    1e-11   
ref|XP_004529318.1|  PREDICTED: SCY1-like protein 2-like              73.2    1e-11   
ref|XP_002936877.2|  PREDICTED: SCY1-like protein 2                   73.2    1e-11   
gb|EXX68419.1|  Scy1p                                                 72.8    2e-11   
ref|XP_005358247.1|  PREDICTED: SCY1-like protein 2 isoform X2        73.2    2e-11   
ref|XP_005358246.1|  PREDICTED: SCY1-like protein 2 isoform X1        73.2    2e-11   
ref|XP_006274020.1|  PREDICTED: SCY1-like protein 2                   72.8    2e-11   
ref|XP_006023696.1|  PREDICTED: SCY1-like protein 2                   72.8    2e-11   
gb|ESA04363.1|  hypothetical protein GLOINDRAFT_336297                72.8    2e-11   
ref|XP_005067984.1|  PREDICTED: SCY1-like protein 2                   72.4    2e-11   
ref|XP_005024592.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.8    2e-11   
ref|XP_001358671.1|  GA15148                                          72.8    2e-11   
ref|XP_005039618.1|  PREDICTED: SCY1-like protein 2                   72.8    2e-11   
ref|XP_001506383.2|  PREDICTED: SCY1-like protein 2                   72.4    3e-11   
ref|XP_009938424.1|  PREDICTED: SCY1-like protein 2                   72.4    3e-11   
ref|XP_007613798.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.0    3e-11   
ref|XP_010885696.1|  PREDICTED: SCY1-like protein 2 isoform X2        72.4    3e-11   
ref|XP_010885695.1|  PREDICTED: SCY1-like protein 2 isoform X1        72.4    3e-11   
ref|XP_002108527.1|  hypothetical protein TRIADDRAFT_18343            72.0    3e-11   
ref|XP_007646091.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  71.6    4e-11   
ref|XP_010147034.1|  PREDICTED: SCY1-like protein 2                   72.0    4e-11   
ref|XP_007536708.1|  PREDICTED: SCY1-like protein 2                   71.6    5e-11   
ref|XP_003221146.1|  PREDICTED: SCY1-like protein 2                   71.6    5e-11   
gb|ELU10963.1|  hypothetical protein CAPTEDRAFT_109432                71.2    7e-11   
ref|XP_009675887.1|  PREDICTED: SCY1-like protein 2 isoform X2        70.9    1e-10   
ref|XP_009675886.1|  PREDICTED: SCY1-like protein 2 isoform X1        70.9    1e-10   
gb|EMP28333.1|  SCY1-like protein 2                                   70.9    1e-10   
ref|XP_007067752.1|  PREDICTED: SCY1-like protein 2                   70.9    1e-10   
ref|XP_005651406.1|  hypothetical protein COCSUDRAFT_39838            70.5    1e-10   
gb|KFB53079.1|  AGAP002142-PA-like protein                            70.5    1e-10   
gb|KFP55960.1|  SCY1-like 2                                           69.7    1e-10   
ref|XP_009707520.1|  PREDICTED: SCY1-like protein 2                   69.7    1e-10   
ref|XP_003771110.1|  PREDICTED: SCY1-like protein 2                   70.1    2e-10   
ref|XP_002071981.1|  GK22563                                          69.7    2e-10   
ref|XP_002172144.1|  SCY1 protein kinase Ppk32                        69.7    2e-10   
ref|XP_007503329.1|  PREDICTED: SCY1-like protein 2 isoform X3        69.7    2e-10   
ref|XP_001365162.1|  PREDICTED: SCY1-like protein 2 isoform X1        69.7    2e-10   
ref|XP_007503328.1|  PREDICTED: SCY1-like protein 2 isoform X2        69.7    2e-10   
ref|XP_005100166.1|  PREDICTED: SCY1-like protein 2-like              69.7    2e-10   
ref|XP_001662347.1|  AAEL012247-PA                                    69.3    2e-10   
gb|KFQ00575.1|  SCY1-like 2                                           68.9    3e-10   
ref|XP_009955076.1|  PREDICTED: SCY1-like protein 2                   68.9    3e-10   
gb|KFV82709.1|  SCY1-like 2                                           69.3    3e-10   
gb|KFQ89482.1|  SCY1-like 2                                           69.3    3e-10   
ref|XP_009491643.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  69.3    3e-10   
gb|KFQ58380.1|  SCY1-like 2                                           69.3    3e-10   
ref|XP_009977654.1|  PREDICTED: SCY1-like protein 2                   69.3    3e-10   
ref|XP_008634762.1|  PREDICTED: SCY1-like protein 2                   69.3    3e-10   
ref|XP_010707737.1|  PREDICTED: SCY1-like protein 2                   69.3    3e-10   
ref|XP_009643885.1|  PREDICTED: SCY1-like protein 2                   69.3    3e-10   
ref|XP_005499807.1|  PREDICTED: SCY1-like protein 2                   69.3    3e-10   
gb|KFV15505.1|  SCY1-like 2                                           69.3    3e-10   
ref|XP_010409065.1|  PREDICTED: SCY1-like protein 2 isoform X1        69.3    3e-10   
gb|KFW89611.1|  SCY1-like 2                                           69.3    3e-10   
ref|XP_009282444.1|  PREDICTED: SCY1-like protein 2                   69.3    3e-10   
ref|XP_009500370.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...  69.3    3e-10   
ref|XP_010082046.1|  PREDICTED: SCY1-like protein 2                   69.3    3e-10   
ref|XP_002191378.1|  PREDICTED: SCY1-like protein 2 isoform 1         68.9    3e-10   
ref|XP_009927953.1|  PREDICTED: SCY1-like protein 2 isoform X1        68.9    3e-10   
ref|XP_010409067.1|  PREDICTED: SCY1-like protein 2 isoform X3        68.9    3e-10   
ref|XP_004890461.1|  PREDICTED: SCY1-like protein 2 isoform X1        68.9    4e-10   
ref|XP_009084885.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_010284684.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_008504132.1|  PREDICTED: SCY1-like protein 2 isoform X1        68.9    4e-10   
ref|XP_002164333.2|  PREDICTED: SCY1-like protein 2-like              68.9    4e-10   
ref|XP_005519513.1|  PREDICTED: SCY1-like protein 2 isoform X1        68.9    4e-10   
ref|XP_009462223.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_005444100.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_009880880.1|  PREDICTED: SCY1-like protein 2 isoform X1        68.9    4e-10   
ref|XP_005144396.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_009896784.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_005421671.1|  PREDICTED: SCY1-like protein 2 isoform X1        68.9    4e-10   
ref|XP_009997331.1|  PREDICTED: SCY1-like protein 2 isoform X1        68.9    4e-10   
ref|XP_010208812.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_009569850.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_009319572.1|  PREDICTED: SCY1-like protein 2                   68.9    4e-10   
ref|XP_009067504.1|  PREDICTED: SCY1-like protein 2                   68.6    5e-10   
ref|XP_010174079.1|  PREDICTED: SCY1-like protein 2                   68.2    5e-10   
ref|XP_008944505.1|  PREDICTED: SCY1-like protein 2                   68.2    6e-10   
ref|XP_005480773.1|  PREDICTED: SCY1-like protein 2                   68.2    6e-10   
gb|ETN58416.1|  hypothetical protein AND_010006                       68.2    6e-10   
ref|XP_009874950.1|  PREDICTED: SCY1-like protein 2                   68.2    7e-10   
emb|CCI10403.1|  unnamed protein product                              68.2    7e-10   
ref|XP_009061701.1|  hypothetical protein LOTGIDRAFT_127669           67.8    8e-10   
emb|CCA13938.1|  protein kinase putative                              67.4    1e-09   
ref|XP_009013981.1|  hypothetical protein HELRODRAFT_190932           66.6    2e-09   
ref|XP_008918486.1|  PREDICTED: SCY1-like protein 2                   67.0    2e-09   
ref|XP_002013645.1|  GL24246                                          66.2    2e-09   
ref|XP_005242731.1|  PREDICTED: SCY1-like protein 2                   66.2    3e-09   
emb|CEJ05189.1|  Putative SCY1 protein kinase                         63.2    3e-09   
gb|ETE60506.1|  SCY1-like protein 2                                   66.2    3e-09   
ref|XP_003737527.1|  PREDICTED: SCY1-like protein 2-like              65.9    3e-09   
gb|KJE97470.1|  SCY1 protein kinase                                   65.5    4e-09   
ref|XP_004343184.2|  hypothetical protein CAOG_07325                  65.1    6e-09   
gb|EEZ99986.1|  hypothetical protein TcasGA2_TC002787                 65.1    6e-09   
gb|EFX80266.1|  hypothetical protein DAPPUDRAFT_51584                 65.1    7e-09   
ref|XP_008192504.1|  PREDICTED: SCY1-like protein 2                   64.7    7e-09   
ref|XP_007438655.1|  PREDICTED: SCY1-like protein 2 isoform X2        64.7    8e-09   
ref|XP_007438654.1|  PREDICTED: SCY1-like protein 2 isoform X1        64.7    8e-09   
gb|KFM58356.1|  SCY1-like protein 2                                   63.5    2e-08   
ref|XP_002424055.1|  conserved hypothetical protein                   62.8    3e-08   
emb|CEF63111.1|  Novel protein                                        63.2    3e-08   
gb|KFB50851.1|  AGAP005207-PA-like protein                            62.8    3e-08   
ref|XP_002435761.1|  conserved hypothetical protein                   62.8    3e-08   
emb|CEG63141.1|  Putative SCY1 protein kinase                         62.4    5e-08   
emb|CEG63142.1|  Putative SCY1 protein kinase                         62.4    5e-08   
ref|XP_004845135.1|  PREDICTED: SCY1-like protein 2                   62.4    5e-08   
dbj|GAN06975.1|  SCY1 protein kinase                                  62.0    5e-08   
ref|XP_003056816.1|  predicted protein                                62.0    6e-08   
ref|XP_314106.3|  AGAP005207-PA                                       62.0    6e-08   
ref|XP_011183594.1|  PREDICTED: SCY1-like protein 2 isoform X1        61.6    7e-08   
ref|XP_008479855.1|  PREDICTED: SCY1-like protein 2                   59.3    7e-08   
ref|XP_009018428.1|  hypothetical protein HELRODRAFT_80455            61.6    8e-08   
ref|XP_011183595.1|  PREDICTED: SCY1-like protein 2 isoform X2        61.6    8e-08   
emb|CEI85546.1|  Putative SCY1 protein kinase                         61.6    8e-08   
gb|KDR18607.1|  SCY1-like protein 2                                   61.6    9e-08   
ref|XP_002029964.1|  GM25195                                          59.7    2e-07   
ref|XP_008615114.1|  SCY1 protein kinase                              60.5    2e-07   
gb|EPB88311.1|  SCY1 protein kinase                                   60.1    3e-07   
ref|XP_004374064.1|  PREDICTED: SCY1-like protein 2                   59.7    3e-07   
ref|XP_007843860.1|  other scy1 protein kinase                        59.3    5e-07   
gb|EMT11865.1|  SCY1-like protein 2                                   59.3    5e-07   
emb|CDS08018.1|  hypothetical protein LRAMOSA01967                    58.9    5e-07   
ref|XP_001867759.1|  kinase domain-containing protein ppk32           58.5    6e-07   
ref|XP_005024593.1|  PREDICTED: SCY1-like protein 2 isoform X2        58.9    7e-07   
ref|XP_011298914.1|  PREDICTED: SCY1-like protein 2                   58.5    8e-07   
ref|XP_002025405.1|  GL12542                                          58.2    8e-07   
ref|XP_003709285.1|  SCY1 protein kinase                              58.5    9e-07   
ref|XP_004530901.1|  PREDICTED: SCY1-like protein 2-like              58.2    1e-06   
gb|ETP54048.1|  SCY1 protein kinase                                   58.2    1e-06   
ref|XP_002908435.1|  protein kinase                                   58.2    1e-06   
gb|ETI56262.1|  SCY1 protein kinase                                   58.2    1e-06   
gb|ETO84990.1|  SCY1 protein kinase                                   58.2    1e-06   
ref|XP_008890824.1|  SCY1 protein kinase                              58.2    1e-06   
gb|KIM57078.1|  hypothetical protein SCLCIDRAFT_1219748               57.8    1e-06   
gb|KDO33300.1|  SCY1 protein kinase                                   57.8    1e-06   
gb|KDQ33764.1|  hypothetical protein PLEOSDRAFT_1073929               57.8    2e-06   
dbj|GAM17573.1|  hypothetical protein SAMD00019534_007480             57.8    2e-06   
ref|NP_001261670.1|  CG34356, isoform F                               57.4    2e-06   
gb|ACU27361.1|  IP12866p                                              57.4    2e-06   
ref|NP_001097570.2|  CG34356, isoform D                               57.4    2e-06   
ref|XP_001983732.1|  GH16051                                          57.4    2e-06   
gb|EJT45147.1|  clathrin-coated vesicle protein                       57.4    2e-06   
ref|XP_011336620.1|  PREDICTED: SCY1-like protein 2 isoform X1        57.4    2e-06   
emb|CCD80132.1|  protein kinase                                       57.4    2e-06   
gb|ADI82295.1|  Scy1 protein                                          56.2    2e-06   
ref|XP_011336621.1|  PREDICTED: SCY1-like protein 2 isoform X2        57.4    2e-06   
gb|ADI82353.1|  Scy1 protein                                          56.2    2e-06   
gb|ADI82313.1|  Scy1 protein                                          56.2    2e-06   
ref|XP_011290467.1|  PREDICTED: SCY1-like protein 2                   57.4    2e-06   
ref|XP_008861429.1|  SCY1 protein kinase                              57.0    2e-06   
gb|EZA55854.1|  SCY1-like protein                                     57.0    2e-06   
ref|XP_001905967.1|  hypothetical protein                             57.0    2e-06   
gb|ADI82294.1|  Scy1 protein                                          55.8    3e-06   
gb|KIO04139.1|  hypothetical protein M404DRAFT_144245                 57.0    3e-06   
ref|XP_009523806.1|  hypothetical protein PHYSODRAFT_497445           57.0    3e-06   
gb|ADI82335.1|  Scy1 protein                                          55.8    3e-06   
gb|ADI82349.1|  Scy1 protein                                          55.8    3e-06   
gb|ADI82315.1|  Scy1 protein                                          55.8    3e-06   
gb|ADI82303.1|  Scy1 protein                                          55.8    3e-06   
ref|XP_001972250.1|  GG15421                                          57.0    3e-06   
ref|XP_002047118.1|  GJ13252                                          57.0    3e-06   
ref|XP_011495511.1|  PREDICTED: SCY1-like protein 2                   57.0    3e-06   
ref|XP_009822373.1|  SCY1 protein kinase                              57.0    3e-06   
gb|KIY43669.1|  kinase-like protein                                   56.6    3e-06   
ref|XP_007411137.1|  hypothetical protein MELLADRAFT_87911            56.6    3e-06   
ref|XP_011172314.1|  PREDICTED: SCY1-like protein 2                   56.6    4e-06   
ref|XP_009964074.1|  PREDICTED: SCY1-like protein 2                   56.2    4e-06   
ref|NP_595822.1|  serine/threonine protein kinase Ppk32 (predicted)   56.2    5e-06   
gb|KIK06640.1|  hypothetical protein K443DRAFT_674298                 56.2    5e-06   
gb|KGL80009.1|  SCY1-like 2                                           55.8    6e-06   
gb|ENH84039.1|  protein kinase domain-containing protein ppk32        55.8    6e-06   
ref|XP_002094269.1|  GE21729                                          55.8    7e-06   
gb|KIK45796.1|  hypothetical protein CY34DRAFT_801098                 55.8    7e-06   
gb|KIJ44257.1|  hypothetical protein M422DRAFT_228299                 55.5    7e-06   
gb|KIJ60622.1|  hypothetical protein HYDPIDRAFT_98218                 55.5    8e-06   
dbj|GAM82353.1|  hypothetical protein ANO11243_003320                 55.5    8e-06   
gb|KII88940.1|  hypothetical protein PLICRDRAFT_91412                 55.5    8e-06   
ref|XP_007384804.1|  kinase-like protein                              55.5    1e-05   
gb|KIM23753.1|  hypothetical protein M408DRAFT_249795                 55.1    1e-05   
ref|XP_007395957.1|  hypothetical protein PHACADRAFT_95292            55.1    1e-05   
ref|XP_002135018.1|  GA23476                                          55.1    1e-05   
gb|KIY67687.1|  kinase-like protein                                   55.1    1e-05   
ref|XP_002007562.1|  GI12316                                          54.7    2e-05   
ref|XP_002062201.1|  GK16785                                          54.3    2e-05   



>ref|XP_009788433.1| PREDICTED: SCY1-like protein 2 [Nicotiana sylvestris]
Length=237

 Score =   258 bits (660),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 151/159 (95%), Gaps = 2/159 (1%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  316
            +S+NMK T T+A AKASAVIEKTVQTTVQEVTG PRALQD++L DQIGSAGPGL WKLYS
Sbjct  1    MSINMK-TLTQAFAKASAVIEKTVQTTVQEVTGLPRALQDYDLLDQIGSAGPGLAWKLYS  59

Query  317  AKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVV  496
            AKARDGHAVYPNVCVW+LDKR LSEARQRAGLSKTAED+FFD+IRADAARLVRLRHPGVV
Sbjct  60   AKARDGHAVYPNVCVWLLDKRVLSEARQRAGLSKTAEDSFFDVIRADAARLVRLRHPGVV  119

Query  497  HVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            HVVQALDESKNAMAMVTEPLFASAANALG LENIEKVPK
Sbjct  120  HVVQALDESKNAMAMVTEPLFASAANALGDLENIEKVPK  158



>ref|XP_009601552.1| PREDICTED: SCY1-like protein 2 [Nicotiana tomentosiformis]
Length=933

 Score =   250 bits (639),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  239  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSK  418
            PRALQD++L DQIGSAGPGLVWKLYSAKARDGHAVYPNVCVW+LDKRALSEARQRAGLSK
Sbjct  38   PRALQDYDLLDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWLLDKRALSEARQRAGLSK  97

Query  419  TAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  598
            TAED+FFD+IRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG LENI
Sbjct  98   TAEDSFFDVIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGDLENI  157

Query  599  EKVPK  613
            EKVPK
Sbjct  158  EKVPK  162



>ref|XP_006362717.1| PREDICTED: SCY1-like protein 2-like [Solanum tuberosum]
Length=935

 Score =   248 bits (632),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  239  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSK  418
            PRALQD++L DQIGSAGPGL WKLYSAKARDGHAVYPNVCVW+LDKRALSEARQRAGLSK
Sbjct  38   PRALQDYDLLDQIGSAGPGLAWKLYSAKARDGHAVYPNVCVWLLDKRALSEARQRAGLSK  97

Query  419  TAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  598
            TAED+FFD+IRADAARLVRLRHPGVVHVVQALDESKN MAMVTEPLFASAANALG LENI
Sbjct  98   TAEDSFFDIIRADAARLVRLRHPGVVHVVQALDESKNGMAMVTEPLFASAANALGDLENI  157

Query  599  EKVPK  613
            EKVPK
Sbjct  158  EKVPK  162



>ref|XP_004250719.1| PREDICTED: SCY1-like protein 2 [Solanum lycopersicum]
Length=934

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  239  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSK  418
            PRALQD++L DQIGSAGPGL WKLYSAKARDGHAVYPNVCVW+LDKRALSEARQRAGLSK
Sbjct  38   PRALQDYDLLDQIGSAGPGLAWKLYSAKARDGHAVYPNVCVWLLDKRALSEARQRAGLSK  97

Query  419  TAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  598
            TAED+FFD+IRADA+RLVRLRHPGVVHVVQALDESKN MAMVTEPLFASAANALG LENI
Sbjct  98   TAEDSFFDIIRADASRLVRLRHPGVVHVVQALDESKNGMAMVTEPLFASAANALGDLENI  157

Query  599  EKVPK  613
            EKVPK
Sbjct  158  EKVPK  162



>gb|KDO45470.1| hypothetical protein CISIN_1g0453201mg, partial [Citrus sinensis]
Length=199

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK TFT+ALAK +AVI KTV+TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIGKTVETTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  320  KARD---GHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            +ARD     A YP VCVWVLDKRALSEAR RAGL+K+AEDAF D++RADA +LVRLRHPG
Sbjct  60   RARDVTRQQAQYPMVCVWVLDKRALSEARARAGLTKSAEDAFLDLVRADAGKLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +VHVVQA+DE+KNAMAMVTEPLFAS AN LG  EN+ KVP+
Sbjct  120  IVHVVQAMDENKNAMAMVTEPLFASVANVLGNFENVSKVPR  160



>gb|EYU22712.1| hypothetical protein MIMGU_mgv1a000991mg [Erythranthe guttata]
Length=919

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 147/161 (91%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  316
            +S+NMK T T+A AKASAVIEKTVQ TVQEVTG PRA+QD+ELFDQIGSAGPGL WKLYS
Sbjct  1    MSINMK-TLTQAFAKASAVIEKTVQNTVQEVTGLPRAMQDYELFDQIGSAGPGLAWKLYS  59

Query  317  AKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            AK+RDGH  AVYP VCVWVLDK+ALSE+RQRAGLSK AEDAF D+IRADAARLVRLRHPG
Sbjct  60   AKSRDGHVPAVYPTVCVWVLDKKALSESRQRAGLSKAAEDAFLDVIRADAARLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDESKNAM+MVTEPLF+SAAN LG LENI KVPK
Sbjct  120  VVHVVQALDESKNAMSMVTEPLFSSAANTLGNLENIPKVPK  160



>emb|CDP20126.1| unnamed protein product [Coffea canephora]
Length=931

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 2/159 (1%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  316
            +SLNMK T T+A AKASA IEKTVQTTVQEVTG P+ LQD++L DQIGSAGPGL WKLYS
Sbjct  1    MSLNMK-TLTQAFAKASAAIEKTVQTTVQEVTGLPKPLQDYDLLDQIGSAGPGLAWKLYS  59

Query  317  AKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVV  496
            AK+RDG AVYPNVCVW+LDK+ALSEARQRAGLSK AEDAF +++RADA+RLVRLRHPGVV
Sbjct  60   AKSRDGRAVYPNVCVWLLDKKALSEARQRAGLSKAAEDAFLEVLRADASRLVRLRHPGVV  119

Query  497  HVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            HVV ALDESKNAMAMVTEPLFASAANALG LEN+EKVPK
Sbjct  120  HVVHALDESKNAMAMVTEPLFASAANALGNLENVEKVPK  158



>ref|XP_008358266.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=169

 Score =   225 bits (573),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+A AK +A IEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQAFAKTAAAIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA RD      YP VCVWVLDK+ALSEAR RAGL+K AED F ++IRADAARLVRLRHPG
Sbjct  60   KAARDSTRAHQYPTVCVWVLDKKALSEARLRAGLTKAAEDGFLEIIRADAARLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANALG ++N+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANALGNVZNVAKVPK  160



>gb|EPS68984.1| hypothetical protein M569_05783, partial [Genlisea aurea]
Length=575

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  316
            +SLNMK T T+A AKASAVIEKTVQ TVQEVTG P+ +QD+++ DQ+GSAGPGL WKLYS
Sbjct  1    MSLNMK-TLTQAFAKASAVIEKTVQNTVQEVTGLPKPMQDYDILDQVGSAGPGLAWKLYS  59

Query  317  AKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            AK+RDGH  AVY  VCVWVLDK+ALSEARQRAGLSK AEDAF D+IRADAARLVRLRHPG
Sbjct  60   AKSRDGHIPAVYSTVCVWVLDKKALSEARQRAGLSKAAEDAFLDLIRADAARLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDESK+AMAMVTEP+FAS ANALG LEN+ KVPK
Sbjct  120  VVHVVQALDESKSAMAMVTEPVFASIANALGNLENLSKVPK  160



>ref|XP_007019922.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
 gb|EOY17147.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
Length=934

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARDG     YP VCVWVLDK+ LSEAR RAGLSK AED+FFD+IRADA RLVRLRHPGV
Sbjct  60   KARDGTRPQQYPTVCVWVLDKKVLSEARARAGLSKVAEDSFFDLIRADAGRLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGNVENVANVPK  159



>ref|XP_007019921.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
 gb|EOY17146.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
Length=933

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARDG     YP VCVWVLDK+ LSEAR RAGLSK AED+FFD+IRADA RLVRLRHPGV
Sbjct  60   KARDGTRPQQYPTVCVWVLDKKVLSEARARAGLSKVAEDSFFDLIRADAGRLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGNVENVANVPK  159



>ref|XP_006478453.1| PREDICTED: SCY1-like protein 2-like [Citrus sinensis]
Length=915

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK TFT+ALAK +AVI KTV+TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIGKTVETTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  320  KARDG---HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            +ARD     A YP VCVWVLDKRALSEAR RAGL+K AEDAF D++RADA +LVRLRHPG
Sbjct  60   RARDATRQQAQYPMVCVWVLDKRALSEARARAGLTKVAEDAFLDLVRADAGKLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +VHVVQA+DE+KNAMAMVTEPLFAS AN LG  EN+ KVPK
Sbjct  120  IVHVVQAMDENKNAMAMVTEPLFASVANVLGNFENVSKVPK  160



>ref|XP_006441714.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 ref|XP_006441715.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 gb|ESR54954.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 gb|ESR54955.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
Length=913

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK TFT+ALAK +AVI KTV+TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIGKTVETTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  320  KARD---GHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            +ARD     A YP VCVWVLDKRALSEAR RAGL+K+AEDAF D++RADA +LVRLRHPG
Sbjct  60   RARDVTRQQAQYPMVCVWVLDKRALSEARARAGLTKSAEDAFLDLVRADAGKLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +VHVVQA+DE+KNAMAMVTEPLFAS AN LG  EN+ KVP+
Sbjct  120  IVHVVQAMDENKNAMAMVTEPLFASVANVLGNFENVSKVPR  160



>ref|XP_004290244.1| PREDICTED: SCY1-like protein 2 [Fragaria vesca subsp. vesca]
Length=928

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T  +ALAKA AVIEKTVQTTVQEV GPR LQD+ELFDQIGSAGP LVWKLY+A
Sbjct  1    MSLNMK-TLQQALAKAGAVIEKTVQTTVQEVAGPRPLQDYELFDQIGSAGPALVWKLYNA  59

Query  320  KA-RDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVV  496
            KA R G   YP VCVWVLDK+ALSEAR RAGLSK AEDAF D+IRADAARLVRLRHPGVV
Sbjct  60   KAARGGQHQYPTVCVWVLDKKALSEARVRAGLSKAAEDAFLDIIRADAARLVRLRHPGVV  119

Query  497  HVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            HVVQALDE+KNAMAMVTEPLFAS ANA+G L+N+ KVPK
Sbjct  120  HVVQALDENKNAMAMVTEPLFASVANAVGNLDNMAKVPK  158



>ref|XP_008361497.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=531

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDHELFDQIGSAGPGLVWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA R+      YP VCVWVLDK+ALSEAR RAGL K AED F ++IRADAARLVRLRHPG
Sbjct  60   KAARESTRAHQYPTVCVWVLDKKALSEARMRAGLPKAAEDGFLEIIRADAARLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANALG +EN+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANALGNVENVAKVPK  160



>ref|XP_010415850.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=910

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVANVPK  159



>gb|KHG06707.1| SCY1-like protein 2 [Gossypium arboreum]
Length=932

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 5/161 (3%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  320  KARDG---HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KARDG   H  YP VCVW+LDK+ LSEAR RAGLSK AED+F D+IRADAA+LVRLRHPG
Sbjct  60   KARDGTRPHQ-YPTVCVWLLDKKVLSEARARAGLSKVAEDSFLDLIRADAAKLVRLRHPG  118

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS AN LG +EN+ +VPK
Sbjct  119  VVHVVQALDENKNAMAMVTEPLFASVANTLGNVENVAQVPK  159



>ref|XP_010471155.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=909

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVANVPK  159



>ref|XP_006300351.1| hypothetical protein CARUB_v10021914mg [Capsella rubella]
 gb|EOA33249.1| hypothetical protein CARUB_v10021914mg [Capsella rubella]
Length=914

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVANVPK  159



>ref|XP_010427973.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=909

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVANVPK  159



>ref|NP_173700.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE30298.1| protein kinase family protein [Arabidopsis thaliana]
Length=913

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSGGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLSK AEDAF D+IRAD+ +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKAAEDAFLDLIRADSGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG +EN++ VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGNVENVDNVPK  159



>ref|XP_006306722.1| hypothetical protein CARUB_v10008248mg [Capsella rubella]
 gb|EOA39620.1| hypothetical protein CARUB_v10008248mg [Capsella rubella]
Length=915

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSGGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKVAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLF+S ANALG +EN++ VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFSSVANALGNVENVDNVPK  159



>ref|XP_004164535.1| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2-like [Cucumis 
sativus]
Length=927

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPG+ WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGMAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKR LSE R RAGLSK+ ED+F D+IRADA RLVRLRHPGV
Sbjct  60   KARDSSRPQQYPTVCVWVLDKRILSETRTRAGLSKSVEDSFLDLIRADAGRLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS AN +G +ENI KVPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANVIGNVENIAKVPK  159



>ref|XP_009105810.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=877

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK TFT+ALA+ +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSLNMK-TFTQALARTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDTTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVANVPK  159



>gb|KJB60121.1| hypothetical protein B456_009G290500 [Gossypium raimondii]
Length=932

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 5/161 (3%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD++L DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYQLLDQIGSAGPGLAWKLYSA  59

Query  320  KARDG---HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KARDG   H  YP VCVW+LDK+ LSEAR RAGLSK AED+F D+IRADAA+LVRLRHPG
Sbjct  60   KARDGTRPHQ-YPTVCVWLLDKKVLSEARARAGLSKVAEDSFLDLIRADAAKLVRLRHPG  118

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS AN LG +EN+ +VPK
Sbjct  119  VVHVVQALDENKNAMAMVTEPLFASVANTLGNVENVAQVPK  159



>ref|XP_004141537.1| PREDICTED: SCY1-like protein 2-like [Cucumis sativus]
 gb|KGN52653.1| hypothetical protein Csa_5G648740 [Cucumis sativus]
Length=931

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPG+ WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGMAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKR LSE R RAGLSK+ ED+F D+IRADA RLVRLRHPGV
Sbjct  60   KARDSSRPQQYPTVCVWVLDKRILSETRTRAGLSKSVEDSFLDLIRADAGRLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS AN +G +ENI KVPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANVIGNVENIAKVPK  159



>ref|XP_003534437.1| PREDICTED: SCY1-like protein 2-like isoform X1 [Glycine max]
 gb|KHN40902.1| SCY1-like protein 2 [Glycine soja]
Length=930

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL W+LYS 
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWRLYSG  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            +ARD      YP VCVWVLDKR+LSEAR RAGL+K AED+F D+IR DAA+LVRLRHPGV
Sbjct  60   RARDPSRQHQYPVVCVWVLDKRSLSEARMRAGLTKAAEDSFLDLIRTDAAKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDESKNAMAMVTEPLFASAAN LGI++NI  +PK
Sbjct  120  VHVVQALDESKNAMAMVTEPLFASAANTLGIVDNIPNLPK  159



>ref|XP_002273755.1| PREDICTED: SCY1-like protein 2 [Vitis vinifera]
 emb|CBI17053.3| unnamed protein product [Vitis vinifera]
Length=931

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIG+AGPGL WKLYS 
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGTAGPGLAWKLYSG  59

Query  320  KARDGHAV---YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KAR G AV   YP VCVWVLDK+ALSEAR RAGLS+ AE++F D+IRADA RLVRLRHPG
Sbjct  60   KARGGSAVSQQYPTVCVWVLDKKALSEARTRAGLSRAAEESFLDVIRADAGRLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANALG LE I KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANALGSLEGIGKVPK  160



>ref|XP_010521095.1| PREDICTED: SCY1-like protein 2 [Tarenaya hassleriana]
Length=920

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGPR LQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPRPLQDYELLDQIGSAGPGLAWKLYSA  59

Query  320  KA--RDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KA        YP VCVWVLDKR+LSEAR RAGLSK AEDAF D+IRADAA++VRLRHPGV
Sbjct  60   KAVGSTRSQQYPTVCVWVLDKRSLSEARVRAGLSKAAEDAFLDLIRADAAKMVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG LEN+ K+PK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGKLENVAKIPK  159



>ref|XP_002888835.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65094.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=899

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWMLDKRALSEARVRAGLSKGAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVANVPK  159



>ref|XP_008459573.1| PREDICTED: SCY1-like protein 2 [Cucumis melo]
Length=931

 Score =   225 bits (574),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ LQD+EL DQIGSAGPG+ WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKPLQDYELLDQIGSAGPGMAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKR LSEAR RAGLSK+ ED+F D+IRADA RLVRLRHPGV
Sbjct  60   KARDSSRPQQYPTVCVWVLDKRVLSEARTRAGLSKSVEDSFLDLIRADAGRLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS AN +G +EN+ KVPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANVIGNVENVAKVPK  159



>ref|XP_006416147.1| hypothetical protein EUTSA_v10006737mg [Eutrema salsugineum]
 gb|ESQ34500.1| hypothetical protein EUTSA_v10006737mg [Eutrema salsugineum]
Length=913

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGS GPGL WKL+SA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSGGPGLAWKLFSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLS+ AED+F D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSRAAEDSFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG +EN++ VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGNVENVDNVPK  159



>ref|XP_008237746.1| PREDICTED: SCY1-like protein 2 [Prunus mume]
Length=929

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA R+ +    YP VCVWVLDK+ALSEAR RAGLSK AEDAF ++IRADA+RLVRLRHPG
Sbjct  60   KAARESNRAHQYPTVCVWVLDKKALSEARVRAGLSKAAEDAFLEIIRADASRLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS AN LG +EN+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANTLGNVENVAKVPK  160



>ref|XP_008348711.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=928

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+A AK +A IEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQAFAKTAAAIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA RD      YP VCVWVLDK+ALSEAR RAGL+K AED F ++IRADAARLVRLRHPG
Sbjct  60   KAARDSTRAHQYPTVCVWVLDKKALSEARLRAGLTKAAEDGFLEIIRADAARLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANALG ++N+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANALGNVZNVAKVPK  160



>ref|XP_007201757.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
 gb|EMJ02956.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
Length=923

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA R+ +    YP VCVWVLDK+ALSEAR RAGLSK AEDAF ++IRADA+RLVRLRHPG
Sbjct  60   KAARESNRAHQYPTVCVWVLDKKALSEARVRAGLSKAAEDAFLEIIRADASRLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS AN LG +EN+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANTLGNVENVAKVPK  160



>ref|XP_009366853.1| PREDICTED: SCY1-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=924

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA R+      YP VCVWVLDK+ALSEAR RAGL+K AED F ++IRADAARLVRLRHPG
Sbjct  60   KAARESTRAHQYPTVCVWVLDKKALSEARMRAGLAKAAEDGFLEIIRADAARLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANALG +EN+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANALGNVENVAKVPK  160



>ref|XP_003540550.1| PREDICTED: SCY1-like protein 2-like [Glycine max]
Length=928

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL W+LYS 
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWRLYSG  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            +ARD      YP VCVWVLDKR LSEAR RAGL+K AED+F D+IR DA++LVRLRHPGV
Sbjct  60   RARDPSRQHQYPVVCVWVLDKRTLSEARMRAGLTKAAEDSFLDLIRMDASKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDESKNAMAMVTEPLFASAAN LGI++NI  +PK
Sbjct  120  VHVVQALDESKNAMAMVTEPLFASAANTLGIVDNILNLPK  159



>ref|XP_011095377.1| PREDICTED: SCY1-like protein 2 [Sesamum indicum]
Length=934

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = +2

Query  239  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGH--AVYPNVCVWVLDKRALSEARQRAGL  412
            PRA+QD+EL DQI SAGPGL WKLYSAK+RD H  AVYP VCVWVLDK+ALSEARQRAGL
Sbjct  38   PRAMQDYELIDQIASAGPGLAWKLYSAKSRDTHVPAVYPIVCVWVLDKKALSEARQRAGL  97

Query  413  SKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILE  592
            SK AEDAF D+IRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS AN LG +E
Sbjct  98   SKAAEDAFLDVIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASVANTLGNVE  157

Query  593  NIEKVPK  613
            NI KVPK
Sbjct  158  NISKVPK  164



>ref|XP_010477557.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=913

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPG  WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGFAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG +EN++ VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGNVENVDNVPK  159



>emb|CDX72804.1| BnaC06g32520D [Brassica napus]
Length=881

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK TFT+ALA+ +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSLNMK-TFTQALARTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSE+R RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALSESRVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANAL  +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALRNVENVANVPK  159



>gb|KFK41573.1| hypothetical protein AALP_AA2G146900 [Arabis alpina]
Length=905

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TLTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKGAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVVNVPK  159



>ref|XP_010063716.1| PREDICTED: SCY1-like protein 2 [Eucalyptus grandis]
 gb|KCW70965.1| hypothetical protein EUGRSUZ_F04075 [Eucalyptus grandis]
Length=916

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAKA AVIEKTVQTTVQEVTGP+ LQD++L DQIGSAGP L WKLYSA
Sbjct  1    MALNMK-TLTQALAKAGAVIEKTVQTTVQEVTGPKPLQDYDLIDQIGSAGPALAWKLYSA  59

Query  320  KA-RD-GHA-VYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            +A RD G A  YP VCVWVLDKR LSEAR RAGLSK AEDAF D++RADAARLVRLRHPG
Sbjct  60   RASRDAGRAHQYPQVCVWVLDKRVLSEARARAGLSKAAEDAFLDIVRADAARLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANALG LENI KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANALGNLENIPKVPK  160



>ref|NP_177297.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAG51833.1|AC016163_22 hypothetical protein; 58558-63003 [Arabidopsis thaliana]
 dbj|BAD93866.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35198.1| putative protein kinase [Arabidopsis thaliana]
Length=909

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RA LSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWMLDKRALSEARVRANLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVGNVPK  159



>dbj|BAF01849.1| hypothetical protein [Arabidopsis thaliana]
Length=909

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RA LSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWMLDKRALSEARVRANLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVGNVPK  159



>ref|XP_010498773.1| PREDICTED: SCY1-like protein 2 isoform X2 [Camelina sativa]
Length=913

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPG  WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGFAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQA+DE+KNAMAMVTEPLFAS ANALG +EN++ VPK
Sbjct  120  VHVVQAIDENKNAMAMVTEPLFASVANALGNVENVDNVPK  159



>ref|XP_010112043.1| SCY1-like protein 2 [Morus notabilis]
 gb|EXC32462.1| SCY1-like protein 2 [Morus notabilis]
Length=919

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK + T+ALAK +AVIEKTVQTTVQEV GPR LQD+EL DQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-SITQALAKTAAVIEKTVQTTVQEVAGPRPLQDYELLDQIGSAGPGLVWKLYSA  59

Query  320  KA----RDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHP  487
            KA       H  Y  VCVWVLDK+ LSEAR RAGLSK AEDAF D++RADA RLVRLRHP
Sbjct  60   KAARESTRAHNQYLTVCVWVLDKKTLSEARARAGLSKAAEDAFLDVVRADAGRLVRLRHP  119

Query  488  GVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            GVVHVVQALDE+KNAMAMVTEPLFAS ANALG +ENI KVPK
Sbjct  120  GVVHVVQALDENKNAMAMVTEPLFASVANALGNVENIAKVPK  161



>ref|XP_010534134.1| PREDICTED: SCY1-like protein 2 isoform X3 [Tarenaya hassleriana]
Length=912

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP +LQD+EL D IGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPASLQDYELLDPIGSAGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP+VCVW+LDKR+LS+AR RAGLSK AEDAF D+IRADAA+LVRLRHPGV
Sbjct  60   KARDSTRPQQYPSVCVWILDKRSLSDARIRAGLSKAAEDAFLDLIRADAAKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNA+AMVTEPLFAS ANALG +EN+ KVPK
Sbjct  120  VHVVQALDENKNAIAMVTEPLFASIANALGNVENVAKVPK  159



>ref|XP_010498772.1| PREDICTED: SCY1-like protein 2 isoform X1 [Camelina sativa]
Length=917

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPG  WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGFAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQA+DE+KNAMAMVTEPLFAS ANALG +EN++ VPK
Sbjct  120  VHVVQAIDENKNAMAMVTEPLFASVANALGNVENVDNVPK  159



>ref|XP_002890539.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66798.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=912

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 5/161 (3%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD++L DQIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYDLLDQIGSGGPGLAWKLYSA  59

Query  320  KARDG---HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KARD    H  YP VCVWVLDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPG
Sbjct  60   KARDSTRPHQ-YPTVCVWVLDKRALSEARARAGLSKAAEDAFLDLIRADAGKLVRLRHPG  118

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANA+G ++N++ VPK
Sbjct  119  VVHVVQALDENKNAMAMVTEPLFASVANAVGNVDNVDNVPK  159



>emb|CDX96321.1| BnaA07g29320D [Brassica napus]
Length=877

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFT+ALA+ +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPL AS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLVASVANALGNVENVANVPK  159



>ref|XP_006390775.1| hypothetical protein EUTSA_v10018097mg [Eutrema salsugineum]
 gb|ESQ28061.1| hypothetical protein EUTSA_v10018097mg [Eutrema salsugineum]
Length=903

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+ALA+ +AVIEKTV TTVQEVTGP+ LQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TLTQALARTAAVIEKTVHTTVQEVTGPKPLQDYELLDQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDPTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVANVPK  159



>ref|XP_010460052.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=913

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK  AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTVAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VC+WVLDKRALSEAR RAGLSK AEDAF D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCLWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS AN+LG +EN++ VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANSLGNVENVDNVPK  159



>ref|XP_009115591.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=910

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL  QIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLYQIGSGGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLSK AED+F D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKAAEDSFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG +EN++ VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGDVENVDNVPK  159



>emb|CDY03692.1| BnaA02g15450D [Brassica napus]
Length=896

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFTEALA+ +AVIEKTV TTVQEVTGP+ LQD+EL +QIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTEALARTAAVIEKTVHTTVQEVTGPKPLQDYELLNQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRAL+EAR RAGLSK AEDAF D+IR DA +LVRLRHPGV
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALTEARLRAGLSKAAEDAFLDLIRGDAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVADVPK  159



>emb|CDY37942.1| BnaC02g20690D [Brassica napus]
Length=900

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFTEALA+ +AVIEKTV TTVQEVTGP+ LQD+EL  QIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTEALARTAAVIEKTVHTTVQEVTGPKPLQDYELLHQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRALSEAR RAGLSK AEDAF D+IR DA +LVRLRHPGV
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALSEARLRAGLSKAAEDAFLDLIRGDAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVADVPK  159



>emb|CDY04777.1| BnaC05g18120D [Brassica napus]
Length=893

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL  QIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLYQIGSGGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR RAGLSK AED+F D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKAAEDSFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMAMVTEPLFAS ANALG +EN++ VPK
Sbjct  120  VHVVQALDENKNAMAMVTEPLFASVANALGDVENVDNVPK  159



>ref|XP_010279109.1| PREDICTED: SCY1-like protein 2 isoform X1 [Nelumbo nucifera]
Length=944

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ LQD++L DQIGS G GL WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKPLQDYDLLDQIGSGGHGLAWKLYSA  59

Query  320  KARDGH-AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVV  496
            KAR    A YP  CVWVLDKRA+SEAR RAGLSK AEDAFFD+IRADAARLVRLRHPG+V
Sbjct  60   KARGSTPAQYPIFCVWVLDKRAISEARARAGLSKAAEDAFFDVIRADAARLVRLRHPGIV  119

Query  497  HVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            HVVQALDE+KNAMAMVTEPLFAS AN LG+++NI KVPK
Sbjct  120  HVVQALDENKNAMAMVTEPLFASVANTLGVVDNIAKVPK  158



>ref|XP_002319896.2| hypothetical protein POPTR_0013s10610g [Populus trichocarpa]
 gb|EEE95819.2| hypothetical protein POPTR_0013s10610g [Populus trichocarpa]
Length=930

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 140/161 (87%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK TFT+ALAK +AVIEKTVQTTVQEVTGP+ LQD++L  QIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYDLLHQIGSAGPGLAWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA R+      YP VCVWVLDK+ALSEAR RAGL+K AED F D+IRADAARLVR+RHPG
Sbjct  60   KAARESTRTHQYPTVCVWVLDKKALSEARARAGLTKVAEDTFLDVIRADAARLVRIRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANA+G LEN+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANAIGNLENVGKVPK  160



>emb|CDP07807.1| unnamed protein product [Coffea canephora]
Length=743

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = +2

Query  161  TFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYSAKARDGH  337
            + T+A AK SA IEKTVQTTVQEVTG P+ LQD++L DQIGSAGPGL  KLYSAK+RDGH
Sbjct  10   SLTQAFAKDSAAIEKTVQTTVQEVTGLPKPLQDYDLLDQIGSAGPGLARKLYSAKSRDGH  69

Query  338  AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALD  517
            AVY NVCVW+LDK+  SEARQRAGLS  AEDAF D++RADA+RLVRLRHPGVVHVV ALD
Sbjct  70   AVYLNVCVWLLDKKPQSEARQRAGLSNAAEDAFLDVLRADASRLVRLRHPGVVHVVHALD  129

Query  518  ESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            ESKNAMAMVT+PLFASAANALG LEN+EKVPK
Sbjct  130  ESKNAMAMVTKPLFASAANALGNLENVEKVPK  161



>ref|XP_009127867.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=896

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK TFTEALA+ +AVIEKTV TTVQEVTGP+ LQD+EL  QIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTEALARTAAVIEKTVHTTVQEVTGPKPLQDYELVHQIGSAGPGLAWKLYAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDKRAL+EAR RAGLSK AEDAF D+IR DA +LVRLRHPGV
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALTEARLRAGLSKAAEDAFLDLIRGDAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAMA+VTEPLFAS ANALG +EN+  VPK
Sbjct  120  VHVVQALDENKNAMALVTEPLFASVANALGNVENVADVPK  159



>ref|XP_002525488.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF36846.1| ATP binding protein, putative [Ricinus communis]
Length=916

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD++L DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYDLLDQIGSAGPGLAWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA R+      YP VCVWVLDK+AL+EAR + GLSK+AED+F D+IRADA +LVRLRHPG
Sbjct  60   KAARESTRAHQYPTVCVWVLDKKALTEARVKVGLSKSAEDSFLDVIRADAGQLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLFAS ANALG LEN+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFASVANALGNLENVMKVPK  160



>ref|XP_007133873.1| hypothetical protein PHAVU_011G216200g [Phaseolus vulgaris]
 gb|ESW05867.1| hypothetical protein PHAVU_011G216200g [Phaseolus vulgaris]
Length=928

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+A AK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGSAGPGL W+LYSA
Sbjct  1    MSLNMK-TLTQAFAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSAGPGLAWRLYSA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            +ARD      YP VCVWVLDKRALSEAR RAGL+K AED+F D+IR DAA+LVRLRHPGV
Sbjct  60   RARDPARQHQYPVVCVWVLDKRALSEARMRAGLTKAAEDSFLDLIRTDAAKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDESK+AMAMVTEPLFASAAN L I++NI  +PK
Sbjct  120  VHVVQALDESKHAMAMVTEPLFASAANTLAIVDNIPVLPK  159



>ref|XP_010248020.1| PREDICTED: SCY1-like protein 2 [Nelumbo nucifera]
Length=647

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK   T+ALAK +AVIE+ VQTTVQEVTGPR LQD+ L +QIGS GPGL WKLYSA
Sbjct  1    MALNMK-ILTQALAKTAAVIERKVQTTVQEVTGPRPLQDYNLIEQIGSGGPGLAWKLYSA  59

Query  320  KARDG-HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVV  496
            KAR    + YP VCVWVLDKRA SEAR RAGLSK AEDAFFD+IR+DAARLVRLRHPG+V
Sbjct  60   KARGSIPSQYPIVCVWVLDKRAFSEARARAGLSKAAEDAFFDIIRSDAARLVRLRHPGIV  119

Query  497  HVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            HVVQALDE+KNAMAMVTEPLFAS AN LG ++NI K PK
Sbjct  120  HVVQALDENKNAMAMVTEPLFASVANTLGAVDNIAKTPK  158



>ref|XP_011004854.1| PREDICTED: SCY1-like protein 2 [Populus euphratica]
Length=928

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK +FT+ALAK +AVIEKTVQTTVQEVTGP+ LQD++L  QIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-SFTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYDLLHQIGSAGPGLAWKLYSA  59

Query  320  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA R+      YP VCVWVLDK+ALSEAR RAGL+K AED F D+IRADAARLVR+RHPG
Sbjct  60   KAARESTRTHQYPTVCVWVLDKKALSEARARAGLTKVAEDTFLDVIRADAARLVRIRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQALDE+KNAMAMVTEPLF+S ANA+G LEN+ KVPK
Sbjct  120  VVHVVQALDENKNAMAMVTEPLFSSVANAIGNLENVGKVPK  160



>gb|KDP45586.1| hypothetical protein JCGZ_17193 [Jatropha curcas]
Length=929

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNM+ T T+A+AK +AVIEKTVQTTVQEVTGP+ LQD++L DQIGSAGPGL WKLYS 
Sbjct  1    MSLNMR-TLTQAIAKTAAVIEKTVQTTVQEVTGPKPLQDYQLLDQIGSAGPGLAWKLYSG  59

Query  320  KA--RDGHA-VYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPG  490
            KA     HA  YP VCVWVLDK+ LSEAR RAGLSK AEDAF D+IRADAA+LVRLRHPG
Sbjct  60   KAVRESTHAHQYPTVCVWVLDKKELSEARVRAGLSKVAEDAFLDVIRADAAKLVRLRHPG  119

Query  491  VVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VVHVVQA+DE+KNA+AMVTEPLFAS ANALG +ENI KVPK
Sbjct  120  VVHVVQAMDENKNAIAMVTEPLFASVANALGNVENIAKVPK  160



>gb|KJB59598.1| hypothetical protein B456_009G262900 [Gossypium raimondii]
Length=925

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+A AK +AVIEKTVQTTVQEV+GP+AL D+EL  QIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVQTTVQEVSGPKALLDYELLHQIGSAGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVW+LDK+ L+EAR RAG+SK  ED+FFD+IRADAARLVRLRHPGV
Sbjct  60   KARDATRPLQYPTVCVWLLDKKMLAEARARAGISKIVEDSFFDLIRADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDE+KNAM MVTEPLFAS ANA+G +EN+ KVPK
Sbjct  120  VHVVQALDENKNAMTMVTEPLFASVANAIGNVENVAKVPK  159



>ref|XP_003605415.1| SCY1-like protein [Medicago truncatula]
Length=371

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+A AK + +IEKTV TTVQEVTGP+ LQD++L  QIGSAGP L WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTATLIEKTVSTTVQEVTGPKPLQDYDLLHQIGSAGPALAWKLYSA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            K+RD      YP VCVWVLDK+ALSEAR +AGL+K AEDAF D+IR DA ++VRLRHPG+
Sbjct  60   KSRDPSRQHQYPVVCVWVLDKKALSEARLKAGLTKAAEDAFLDLIRMDAGKMVRLRHPGI  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQ LDESKNAMAMVTEPLFAS AN LG L+N++ VPK
Sbjct  120  VHVVQGLDESKNAMAMVTEPLFASVANTLGKLDNVQSVPK  159



>gb|KFK44375.1| hypothetical protein AALP_AA1G249300 [Arabis alpina]
Length=908

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL +QIGS+GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLNQIGSSGPGLAWKLYSA  59

Query  320  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            KARD      YP VCVWVLDKRALSEAR R GLSK AED+F D+IRADA +LVRLRHPGV
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARLGLSKAAEDSFLDLIRADAGKLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEK  604
            VHVVQALDE+KNAMAMVTEPLF S ANALG +EN+ K
Sbjct  120  VHVVQALDENKNAMAMVTEPLFTSVANALGNVENVSK  156



>ref|XP_003569359.1| PREDICTED: SCY1-like protein 2 [Brachypodium distachyon]
Length=965

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T  +ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MSLNMK-TLQQALAKASAVIEKTVTTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  320  KARDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + RDG A   YP V VWVLDKRALSEAR RAGLSK AEDAF D+ RADAARLVRLRHPGV
Sbjct  60   RPRDGAASTPYPIVSVWVLDKRALSEARARAGLSKAAEDAFLDLTRADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAMVTEPLFAS +NALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMVTEPLFASVSNALGCLDNVGKVPK  159



>gb|KJB26955.1| hypothetical protein B456_004G267700 [Gossypium raimondii]
Length=1121

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 135/164 (82%), Gaps = 7/164 (4%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASA----viektvqttvqevtGPRALQDFELFDQIGSAGPGLVWK  307
            +S+NMK T T+A AK +A     +  TVQ+ VQEVTGP+ALQD+EL  QIGSAGPGL WK
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVHTTVQSAVQEVTGPKALQDYELLHQIGSAGPGLAWK  59

Query  308  LYSAKARDGHA--VYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLR  481
            LYSAKARDG     YP VCVWVLDK+A+S+AR  AGLSK  ED+FF++IRADA RLVRLR
Sbjct  60   LYSAKARDGTHPHQYPTVCVWVLDKKAMSKARACAGLSKAVEDSFFNLIRADAVRLVRLR  119

Query  482  HPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            HPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG ++N+ KVPK
Sbjct  120  HPGVVHVVQALDENKNAMAMVTEPLFASVANALGNVDNVAKVPK  163



>gb|KHG01693.1| SCY1-like protein 2 [Gossypium arboreum]
Length=1165

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 135/164 (82%), Gaps = 7/164 (4%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASA----viektvqttvqevtGPRALQDFELFDQIGSAGPGLVWK  307
            +S+NMK T T+A AK +A     +  TVQ+ VQEVTGPRALQD+EL  QIGSAGPGL WK
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVHTTVQSAVQEVTGPRALQDYELLHQIGSAGPGLAWK  59

Query  308  LYSAKARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLR  481
            LYSAKAR+G     YP VCVWVLDK+A+S+AR  AGLSK  ED+FF++IRADA RLVRLR
Sbjct  60   LYSAKAREGTHRHQYPTVCVWVLDKKAMSKARACAGLSKAVEDSFFNLIRADAVRLVRLR  119

Query  482  HPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            HPGVVHVVQALDE+KNAMAMVTEPLFAS ANALG ++N+ KVPK
Sbjct  120  HPGVVHVVQALDENKNAMAMVTEPLFASVANALGNVDNVAKVPK  163



>emb|CDM83285.1| unnamed protein product [Triticum aestivum]
Length=949

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T  +ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MSLNMK-TLQQALAKASAVIEKTVTTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  320  KARDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + RD  A   YP V VWVLDKRALSEAR RAGLS+ AEDAF D+ RADAARLVRLRHPGV
Sbjct  60   RPRDAAASTPYPVVSVWVLDKRALSEARARAGLSRAAEDAFLDLARADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAMVTEPLFAS +NALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMVTEPLFASVSNALGCLDNVGKVPK  159



>gb|EMS46807.1| SCY1-like protein 2 [Triticum urartu]
Length=1160

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T  +ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MSLNMK-TLQQALAKASAVIEKTVTTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  320  KARDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + RD  A   YP V VWVLDKRALSEAR RAGLS+ AEDAF D+ RADAARLVRLRHPGV
Sbjct  60   RPRDAAASTPYPVVSVWVLDKRALSEARARAGLSRAAEDAFLDLARADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAMVTEPLFAS +NALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMVTEPLFASVSNALGCLDNVGKVPK  159



>ref|XP_010913247.1| PREDICTED: SCY1-like protein 2 [Elaeis guineensis]
Length=924

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAK +AVIEKTVQTTVQEVTGPR LQD++L D +GS GPGL W+L++ 
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPRPLQDYDLLDPVGSGGPGLAWRLFAG  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R       YP VCVWVLDKRALSEAR RAGLSK AEDAF D++RADAARLVR+RHPGV
Sbjct  60   RPRPSAPSTQYPLVCVWVLDKRALSEARARAGLSKAAEDAFLDLLRADAARLVRIRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDESK AMAMVTEPLFAS ANALG  +N+ KVPK
Sbjct  120  VHVVQALDESKTAMAMVTEPLFASVANALGNHDNVPKVPK  159



>gb|AES87595.2| ARM repeat kinase family protein [Medicago truncatula]
Length=928

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+A AK + +IEKTV TTVQEVTGP+ LQD++L  QIGSAGP L WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTATLIEKTVSTTVQEVTGPKPLQDYDLLHQIGSAGPALAWKLYSA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            K+RD      YP VCVWVLDK+ALSEAR +AGL+K AEDAF D+IR DA ++VRLRHPG+
Sbjct  60   KSRDPSRQHQYPVVCVWVLDKKALSEARLKAGLTKAAEDAFLDLIRMDAGKMVRLRHPGI  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQ LDESKNAMAMVTEPLFAS AN LG L+N++ VPK
Sbjct  120  VHVVQGLDESKNAMAMVTEPLFASVANTLGKLDNVQSVPK  159



>ref|XP_003605398.1| SCY1-like protein [Medicago truncatula]
Length=989

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+A AK + +IEKTV TTVQEVTGP+ LQD++L  QIGSAGP L WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTATLIEKTVSTTVQEVTGPKPLQDYDLLHQIGSAGPALAWKLYSA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            K+RD      YP VCVWVLDK+ALSEAR +AGL+K AEDAF D+IR DA ++VRLRHPG+
Sbjct  60   KSRDPSRQHQYPVVCVWVLDKKALSEARLKAGLTKAAEDAFLDLIRMDAGKMVRLRHPGI  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQ LDESKNAMAMVTEPLFAS AN LG L+N++ VPK
Sbjct  120  VHVVQGLDESKNAMAMVTEPLFASVANTLGKLDNVQSVPK  159



>ref|XP_009393077.1| PREDICTED: SCY1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=924

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAKA AVIEKTVQTTVQEVTGPR LQD++L DQ GS GPGL W+L++A
Sbjct  1    MSLNMK-TLTQALAKAGAVIEKTVQTTVQEVTGPRPLQDYDLLDQAGSGGPGLAWRLFAA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R       YP V VWVLDKRAL+EAR RAGLSK AEDAF D++RADAARLVR+RHPGV
Sbjct  60   RPRASAPSTHYPLVTVWVLDKRALAEARVRAGLSKAAEDAFLDLVRADAARLVRIRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDESKNA+AMVTEP+FAS ANALG L+N+ +VPK
Sbjct  120  LHVVQALDESKNAIAMVTEPVFASVANALGHLDNVPRVPK  159



>ref|XP_006852429.1| hypothetical protein AMTR_s00021p00078920 [Amborella trichopoda]
 gb|ERN13896.1| hypothetical protein AMTR_s00021p00078920 [Amborella trichopoda]
Length=898

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQ+GS G G VWKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQVGSGGHGHVWKLYSA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R     + YP VC+W+LDK+A+SEAR RAGLSK AEDAF ++++ADA+RLVRLRHPGV
Sbjct  60   RPRTKTLQSQYPLVCIWLLDKKAVSEARIRAGLSKAAEDAFMELVKADASRLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQ LDE+KN+MAMVTEP+FAS AN LG+ +NI  VPK
Sbjct  120  VHVVQGLDETKNSMAMVTEPIFASVANVLGVFDNIGSVPK  159



>ref|XP_010677079.1| PREDICTED: SCY1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=919

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 133/162 (82%), Gaps = 5/162 (3%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +S+NMK T T+A AK +AVIEKTV TTVQEVTGP+ LQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVTTTVQEVTGPKPLQDYELVDQIGSAGPGLAWKLYSA  59

Query  320  KARDGHAVYPN----VCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHP  487
            K R G +   +    VCVW+LDKR+L+EAR RAGLSK  ED+F +++R DAARLVR+RHP
Sbjct  60   KPRGGSSSTSSQYSAVCVWLLDKRSLTEARTRAGLSKALEDSFLEVLRNDAARLVRIRHP  119

Query  488  GVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            GVVH+VQALDE+KNAMA VTEPLFAS ANALG L N+  VPK
Sbjct  120  GVVHLVQALDETKNAMAFVTEPLFASVANALGDLHNVGNVPK  161



>ref|XP_010534131.1| PREDICTED: SCY1-like protein 2 isoform X1 [Tarenaya hassleriana]
Length=879

 Score =   199 bits (507),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 2/124 (2%)
 Frame = +2

Query  248  LQDFELFDQIGSAGPGLVWKLYSAKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKT  421
            LQD+EL D IGSAGPGL WKLYSAKARD      YP+VCVW+LDKR+LS+AR RAGLSK 
Sbjct  3    LQDYELLDPIGSAGPGLAWKLYSAKARDSTRPQQYPSVCVWILDKRSLSDARIRAGLSKA  62

Query  422  AEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIE  601
            AEDAF D+IRADAA+LVRLRHPGVVHVVQALDE+KNA+AMVTEPLFAS ANALG +EN+ 
Sbjct  63   AEDAFLDLIRADAAKLVRLRHPGVVHVVQALDENKNAIAMVTEPLFASIANALGNVENVA  122

Query  602  KVPK  613
            KVPK
Sbjct  123  KVPK  126



>ref|XP_002455952.1| hypothetical protein SORBIDRAFT_03g027880 [Sorghum bicolor]
 gb|EES01072.1| hypothetical protein SORBIDRAFT_03g027880 [Sorghum bicolor]
Length=959

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + RDG   A YP V VWVLDKRAL+EAR RAGLSK AEDAF D++RADAARLVRLRHPGV
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGLSKAAEDAFLDLVRADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAM TEP+FAS ANALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMATEPVFASVANALGCLDNVGKVPK  159



>ref|XP_008675496.1| PREDICTED: SCY1-like protein 2 [Zea mays]
 tpg|DAA58977.1| TPA: hypothetical protein ZEAMMB73_586293 [Zea mays]
 tpg|DAA58978.1| TPA: hypothetical protein ZEAMMB73_586293 [Zea mays]
Length=959

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + RDG   A YP V VWVLDKRAL+EAR RAGLSK AEDAF D++RADAARLVRLRHPGV
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGLSKAAEDAFLDLVRADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAM TEP+FAS ANALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMATEPVFASVANALGCLDNVGKVPK  159



>ref|XP_008654448.1| PREDICTED: uncharacterized protein LOC100194347 isoform X1 [Zea 
mays]
Length=961

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + RDG   A YP V VWVLDKRAL+EAR RAG+SK AEDAF D++RADAARLVRLRHPGV
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGMSKAAEDAFLDLVRADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAM TEP+FAS ANALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMATEPVFASVANALGCLDNVGKVPK  159



>ref|XP_004969167.1| PREDICTED: SCY1-like protein 2-like [Setaria italica]
Length=960

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + RDG   A YP V VWVLDKRAL+EAR RAGLSK AEDAF D++RADAARLVRLRHPGV
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGLSKAAEDAFLDLVRADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAM TEP+FAS +NALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMATEPVFASVSNALGCLDNVGKVPK  159



>gb|KHN19409.1| SCY1-like protein 2 [Glycine soja]
Length=915

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 129/160 (81%), Gaps = 16/160 (10%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL W+LYS 
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWRLYSG  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            ++RD      YP VCVWVLDK+A             AED+F D+IR DA++LVRLRHPGV
Sbjct  60   RSRDPSRQHQYPVVCVWVLDKQA-------------AEDSFLDLIRMDASKLVRLRHPGV  106

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            VHVVQALDESKNAMAMVTEPLFASAAN LGI++NI  +PK
Sbjct  107  VHVVQALDESKNAMAMVTEPLFASAANTLGIVDNILNLPK  146



>ref|XP_002963091.1| hypothetical protein SELMODRAFT_165698 [Selaginella moellendorffii]
 gb|EFJ36554.1| hypothetical protein SELMODRAFT_165698 [Selaginella moellendorffii]
Length=866

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK + T+ALAK +AVIEK VQ+TVQEVTGP+ LQD+EL +QIGS GP L WKLYS 
Sbjct  1    MALNMK-SLTQALAKTAAVIEKHVQSTVQEVTGPKPLQDYELVEQIGSGGPALAWKLYSG  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R+   HA  P VCVWVLDK+ LSE RQR G++K AEDAF +++RADA ++++LRHPGV
Sbjct  60   RPRNKAEHAHNPEVCVWVLDKKLLSETRQRIGITKAAEDAFLEVVRADAGQMLKLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            + VVQALDESK AMAMVTEP+FAS AN LG LEN+ K PK
Sbjct  120  LRVVQALDESKTAMAMVTEPIFASVANVLGNLENVSKTPK  159



>ref|XP_010534132.1| PREDICTED: SCY1-like protein 2 isoform X2 [Tarenaya hassleriana]
Length=871

 Score =   193 bits (491),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +2

Query  248  LQDFELFDQIGSAGPGLVWKLYSAKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKT  421
            LQD+EL D IGSAGPGL WKLYSAKARD      YP+VCVW+LDKR+LS+AR RAGLSK 
Sbjct  3    LQDYELLDPIGSAGPGLAWKLYSAKARDSTRPQQYPSVCVWILDKRSLSDARIRAGLSKA  62

Query  422  AEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIE  601
            AEDAF D+IRADAA+LVRLRHPGVVHVVQALDE+KNA+AMVTEPLFAS ANALG +EN+ 
Sbjct  63   AEDAFLDLIRADAAKLVRLRHPGVVHVVQALDENKNAIAMVTEPLFASIANALGNVENVA  122

Query  602  K  604
            K
Sbjct  123  K  123



>ref|XP_002980242.1| hypothetical protein SELMODRAFT_178166 [Selaginella moellendorffii]
 gb|EFJ18502.1| hypothetical protein SELMODRAFT_178166 [Selaginella moellendorffii]
Length=866

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK + T+ALAK +AVIEK VQ+TVQEVTGP+ LQD+EL +QIGS GP L WKLYS 
Sbjct  1    MALNMK-SLTQALAKTAAVIEKHVQSTVQEVTGPKPLQDYELVEQIGSGGPALAWKLYSG  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R+   HA  P VCVWVLDK+ LSE RQR G++K AEDAF +++RADA ++++LRHPGV
Sbjct  60   RPRNKAEHAHNPEVCVWVLDKKLLSETRQRIGITKAAEDAFLEVVRADAGQMLKLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            + VVQALDESK AMAMVTEP+FA+ AN LG LEN+ K PK
Sbjct  120  LRVVQALDESKTAMAMVTEPIFAAVANVLGNLENVSKTPK  159



>ref|XP_001777004.1| predicted protein [Physcomitrella patens]
 gb|EDQ58253.1| predicted protein [Physcomitrella patens]
Length=862

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            +SLNMK +FT+ALAKASAVIEKTV +TV EVTGP+A+QD+EL +Q+GS GP L+WKLY+ 
Sbjct  1    MSLNMK-SFTQALAKASAVIEKTVSSTVHEVTGPKAMQDYELLEQVGSGGPDLIWKLYAG  59

Query  320  KARD--GHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R+       P VCVWVLDK+AL++ R R G+S+ AE+AF D++R DAA+L+RLRHPGV
Sbjct  60   RPRNKATQMHNPEVCVWVLDKKALTDLRLRVGISRAAEEAFLDLVRQDAAQLMRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            V V+QALDESK  MAMVTEP+FAS AN LG L+N+ KVP 
Sbjct  120  VRVIQALDESKTTMAMVTEPIFASVANVLGRLDNVGKVPN  159



>gb|EAZ12691.1| hypothetical protein OsJ_02609 [Oryza sativa Japonica Group]
Length=949

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQDFEL +Q GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVTTTVQEVTGPRPLQDFELLEQAGSGGPGLAWRIYTA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R+G   A YP V VWVLDKRAL+EAR RAGL+K AEDAF D+ RADAARLVRLRHPGV
Sbjct  60   RPREGAPSAPYPVVSVWVLDKRALAEARARAGLTKAAEDAFLDLARADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAM TEP+FAS ANALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMATEPVFASVANALGCLDNVGKVPK  159



>gb|EAY74967.1| hypothetical protein OsI_02864 [Oryza sativa Indica Group]
Length=949

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = +2

Query  140  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  319
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQDFEL +Q GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVTTTVQEVTGPRPLQDFELLEQAGSGGPGLAWRIYTA  59

Query  320  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGV  493
            + R+G   A YP V VWVLDKRAL+EAR RAGL+K AEDAF D+ RADAARLVRLRHPGV
Sbjct  60   RPREGAPSAPYPVVSVWVLDKRALAEARARAGLTKAAEDAFLDLARADAARLVRLRHPGV  119

Query  494  VHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVPK  613
            +HVVQALDE+K AMAM TEP+FAS ANALG L+N+ KVPK
Sbjct  120  LHVVQALDETKAAMAMATEPVFASVANALGCLDNVGKVPK  159



>ref|XP_006646100.1| PREDICTED: SCY1-like protein 2-like [Oryza brachyantha]
Length=913

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  389  EARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASA  568
            EAR RAGLSK AEDAF D+ RADAARLVRLRHPGV+HVVQALDE+K AMAM TEPLFAS 
Sbjct  38   EARARAGLSKAAEDAFLDLTRADAARLVRLRHPGVLHVVQALDETKAAMAMATEPLFASV  97

Query  569  ANALGILENIEKVPK  613
            ANALG L+N+ KVPK
Sbjct  98   ANALGCLDNVGKVPK  112



>ref|XP_008671504.1| PREDICTED: uncharacterized protein LOC103648904 [Zea mays]
Length=208

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +2

Query  158  KTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSAKARDG-  334
            KT T+ALAKASAVIEKTV T VQEVTGPR LQD+EL DQ GS GPGL W++Y+A+ RDG 
Sbjct  2    KTLTQALAKASAVIEKTVSTKVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTARPRDGA  61

Query  335  -HAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRA  454
              A YP V VWVLDKRAL+EAR RAG+SK AEDAF D++RA
Sbjct  62   PSAPYPVVSVWVLDKRALAEARARAGMSKVAEDAFLDLVRA  102



>ref|XP_009043653.1| hypothetical protein LOTGIDRAFT_151904 [Lottia gigantea]
 gb|ESP05108.1| hypothetical protein LOTGIDRAFT_151904 [Lottia gigantea]
Length=600

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (58%), Gaps = 9/121 (7%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            +DF+   QIGS GPGL+WK+YS   R          ++VL+K+ L    +R        +
Sbjct  22   RDFDTHSQIGSGGPGLLWKIYSGVKRTTKQ---EASIFVLEKKVLERYSRRD------RE  72

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  610
               + +R   ++L RLRHP ++ V+Q L+ES+  +A  TEP+FAS AN LG  ENI  VP
Sbjct  73   RILESLRRGVSQLTRLRHPKILSVLQPLEESREYLAFATEPVFASLANVLGNHENITPVP  132

Query  611  K  613
            K
Sbjct  133  K  133



>gb|EJW76801.1| other/SCY1 protein kinase [Wuchereria bancrofti]
Length=480

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (60%), Gaps = 9/126 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +D+E+  Q+GSAGP L WK+Y+A+ R        V VW+ +KR L +        
Sbjct  29   GNPVTRDYEVLSQVGSAGPTLSWKIYAAQKRSTKK---PVSVWLFEKRNLEK------WP  79

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            +  ++ F ++++   ++L RLRHP ++ +   L+ES+++ A  TEP+FAS AN LG L+N
Sbjct  80   RYEKELFSEILKRGVSQLTRLRHPRILVIEHPLEESRDSYAFCTEPVFASLANVLGGLDN  139

Query  596  IEKVPK  613
            I   PK
Sbjct  140  ISPYPK  145



>gb|KIY94415.1| hypothetical protein MNEG_13548, partial [Monoraphidium neglectum]
Length=136

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +2

Query  242  RALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKT  421
            +AL+D+ L   + +AGP   W+++ A ++   AV+P VCVW+LDKR L +   RAG ++ 
Sbjct  41   KALKDYRLAGHVATAGPCGTWRIFLAISKKPGAVFPEVCVWILDKRTLMDQASRAGRAR-  99

Query  422  AEDAFFDMIRADAARLVRLRHPGVVHVVQALDES  523
            A D FF+  R   A+++R++HPGVV V++ ++ES
Sbjct  100  AFDTFFEQQRRACAQMLRIKHPGVVRVLEPMEES  133



>ref|XP_003143373.1| SCY1 protein kinase [Loa loa]
 gb|EFO20697.1| SCY1 protein kinase [Loa loa]
Length=880

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/125 (36%), Positives = 75/125 (60%), Gaps = 9/125 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +D+E+  Q+GSAGP   WK+Y+A+ R   +    V VW+ +KR+L +        
Sbjct  29   GNPVTRDYEVLSQVGSAGPAFSWKVYAAQKR---STKKPVSVWLFEKRSLEK------WP  79

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            +   + F ++++   ++L RLRHP ++ +   L+ES+++ A  TEP+FAS ANA+G L+N
Sbjct  80   RYERELFSEILKRGVSQLTRLRHPRILIIEHPLEESRDSYAFCTEPVFASLANAVGRLDN  139

Query  596  IEKVP  610
            I   P
Sbjct  140  ISPCP  144



>gb|KDD72582.1| hypothetical protein H632_c3167p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=152

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (62%), Gaps = 5/110 (5%)
 Frame = +2

Query  242  RALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS--  415
            R LQ + +  Q+ +AGPG +W++Y+AKAR   A +P V VWVL KR  ++   + GLS  
Sbjct  42   RCLQSYSVEGQVCTAGPGGLWRVYAAKARKPDAPHPTVSVWVLTKRQAADLDSQQGLSSG  101

Query  416  ---KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPL  556
                T  +A+F   R   A   RL+HPG++ VV+ L+E+++ +  VTEP+
Sbjct  102  QQVSTRAEAYFANARRGFALAQRLQHPGLLRVVEPLEETRSQLVAVTEPI  151



>ref|XP_001892158.1| Protein kinase domain containing protein [Brugia malayi]
Length=640

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 9/125 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +D+E+  Q+GSAGP   WK+Y+A+ R   +    V VW+ +KR L +        
Sbjct  29   GNPVTRDYEVLSQVGSAGPVFSWKIYAAQKR---STKKPVSVWLFEKRNLEK------WP  79

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   + F ++++   ++L RLRHP ++ +   L+ES+++ A  TEP+FAS AN LG L+N
Sbjct  80   KYERELFSEILKRGVSQLTRLRHPRILVIEHPLEESRDSYAFCTEPVFASLANVLGHLDN  139

Query  596  IEKVP  610
            I   P
Sbjct  140  ISPYP  144



>ref|XP_002127212.1| PREDICTED: SCY1-like protein 2 [Ciona intestinalis]
Length=925

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 74/122 (61%), Gaps = 9/122 (7%)
 Frame = +2

Query  248  LQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAE  427
            L++++  DQ+GS GP  +WK+Y A  +   A   +V +W+ +K+ L +       ++T  
Sbjct  31   LREYDAGDQVGSGGPRYLWKIYKATKKSTKA---DVALWIFEKKQLDQ------FNRTDR  81

Query  428  DAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKV  607
            +   +++R    ++ +LRHP V+ V  +L+ES+ ++A  TEP+FAS  N LG   NI+K+
Sbjct  82   EMIIEVLRKGCVQMTKLRHPRVLIVEHSLEESRESIAFCTEPVFASLGNVLGRKNNIDKI  141

Query  608  PK  613
            PK
Sbjct  142  PK  143



>emb|CDQ03616.1| Protein Bm9111, isoform b [Brugia malayi]
Length=880

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 9/125 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +D+E+  Q+GSAGP   WK+Y+A+ R   +    V VW+ +KR L +        
Sbjct  29   GNPVTRDYEVLSQVGSAGPVFSWKIYAAQKR---STKKPVSVWLFEKRNLEK------WP  79

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   + F ++++   ++L RLRHP ++ +   L+ES+++ A  TEP+FAS AN LG L+N
Sbjct  80   KYERELFSEILKRGVSQLTRLRHPRILVIEHPLEESRDSYAFCTEPVFASLANVLGHLDN  139

Query  596  IEKVP  610
            I   P
Sbjct  140  ISPYP  144



>gb|EUB58096.1| SCY1-like protein [Echinococcus granulosus]
Length=829

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G +  ++F+L +Q+GS+GPGL+WKLYSA  R          VW+ +K+AL         S
Sbjct  18   GNQVSREFDLEEQVGSSGPGLLWKLYSATKRSSKEA---ATVWIFEKKALER------FS  68

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +   + ++   A L R RHP ++ VV  L+ES+ ++   TE LF S +NALG + N
Sbjct  69   KREREMILEKLKQGVAALTRFRHPRILSVVHPLEESRESLGFATESLFTSLSNALGKVTN  128

Query  596  IEK  604
            + +
Sbjct  129  LSR  131



>emb|CDS22687.1| scy1 protein 2 [Echinococcus granulosus]
Length=816

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G +  ++F+L +Q+GS+GPGL+WKLYSA  R          VW+ +K+AL         S
Sbjct  18   GNQVSREFDLEEQVGSSGPGLLWKLYSATKRSSKEA---ATVWIFEKKALER------FS  68

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +   + ++   A L R RHP ++ VV  L+ES+ ++   TE LF S +NALG + N
Sbjct  69   KREREMILEKLKQGVAALTRFRHPRILSVVHPLEESRESLGFATESLFTSLSNALGKVTN  128

Query  596  IEK  604
            + +
Sbjct  129  LSR  131



>emb|CDS35900.1| scy1 protein 2 [Echinococcus multilocularis]
Length=816

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G +  ++F+L +Q+GS+GPGL+WKLYSA  R          VW+ +K+AL          
Sbjct  18   GNQVSREFDLEEQVGSSGPGLLWKLYSATKRSSKE---EATVWIFEKKALER------FP  68

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +   + ++   A L R RHP ++ VV  L+ES+ ++   TE LF S +NALG + N
Sbjct  69   KREREMILEKLKQGVAALTRFRHPRILSVVHPLEESRESLGFATESLFTSLSNALGKVTN  128

Query  596  I  598
            +
Sbjct  129  L  129



>gb|KHN80443.1| SCY1-like protein 2 [Toxocara canis]
Length=1422

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 71/121 (59%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+  QI SAGPGL WK+Y+ +    H+    V VW+ DK+ L          
Sbjct  54   GNPVTREYEILSQIASAGPGLSWKIYAGRK---HSTKQAVAVWLFDKKDLDR------WP  104

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            +  ++ F +++R   A+L RLRHP ++ +   L+ES+++ A  TEP+FAS AN LG  EN
Sbjct  105  RHEKELFTEVLRRGVAQLTRLRHPRILVIEHPLEESRDSFAFCTEPMFASLANCLGRHEN  164

Query  596  I  598
            +
Sbjct  165  L  165



>emb|CDS31865.1| scy1 protein 2 [Hymenolepis microstoma]
Length=1663

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            ++F+L +Q+GS+GPGL+WKL+SA  +          VW+ +K+ +         SK   +
Sbjct  843  REFDLENQVGSSGPGLLWKLFSANKKSSKE---PATVWIFEKKLVDR------FSKRERE  893

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  598
               D ++   A L RLRHP V+ VV  L++S+ ++   TEP+F S ANALG  +N+
Sbjct  894  LIIDKLKQGVATLTRLRHPRVLSVVHPLEDSRESLCFATEPVFTSLANALGKTKNL  949



>emb|CDW52923.1| Pkinase domain containing protein [Trichuris trichiura]
Length=591

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 9/124 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+W++YS   R        V VW+L+K+ L          
Sbjct  24   GNPVTREFEASVHVASAGPGLLWRIYSGFKRSTQQ---EVSVWILEKKFLDR------FQ  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   DA  +++R    +L RL+HP ++ V   L+ES++++A  TEP+FAS AN LG ++N
Sbjct  75   KQHRDAVIEILRRGVLQLTRLKHPYLITVEHPLEESRDSLAFCTEPIFASLANLLGRIDN  134

Query  596  IEKV  607
            +  +
Sbjct  135  MPPI  138



>ref|XP_011441145.1| PREDICTED: SCY1-like protein 2 [Crassostrea gigas]
 ref|XP_011441146.1| PREDICTED: SCY1-like protein 2 [Crassostrea gigas]
Length=941

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            +DF++ + + S GPGL WK+Y+A  R          V+V +K+ L +       SK   D
Sbjct  22   KDFDVSNHVASGGPGLSWKIYNAIKR---TTKQEASVFVFEKKNLEK------YSKKDRD  72

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  598
               D ++   ++L RLRHP ++ V+Q L+ES+ A+A  TEP+FAS AN LG   N+
Sbjct  73   LIIDSLKKGVSQLTRLRHPKILSVLQPLEESREALAFATEPVFASLANVLGDHTNV  128



>ref|XP_008548320.1| PREDICTED: SCY1-like protein 2 [Microplitis demolitor]
 gb|EZA45223.1| SCY1-like protein 2-like protein [Microplitis demolitor]
Length=854

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 43/124 (35%), Positives = 70/124 (56%), Gaps = 8/124 (6%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+  QI SAGPGL+WK+YS   +          ++V +KR L         S
Sbjct  35   GNPVTREFEVTAQIASAGPGLLWKIYSGYKKSTKQA---AAIFVFEKRLLDRCS-----S  86

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +   + ++    +L +LRHP ++ V   L+ES++++A  TEP+FAS AN +G +EN
Sbjct  87   KQEREVILEALKRGVTQLTKLRHPQILTVQHPLEESRDSLAFATEPVFASLANVIGNIEN  146

Query  596  IEKV  607
            I ++
Sbjct  147  ISQI  150



>gb|EFX89231.1| hypothetical protein DAPPUDRAFT_1152 [Daphnia pulex]
Length=617

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 74/126 (59%), Gaps = 9/126 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+   IGSAGP L+WK++S   +   +      ++VL+K+ L +       S
Sbjct  24   GNPVTREYEVGKLIGSAGPDLLWKIFSGFKK---STKQEASIFVLEKKLLEK------YS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   +++R   A+L RLRHP ++ V   ++ES+ ++A  TEP+FAS AN LG  EN
Sbjct  75   KKDKDQLVEVLRRGVAQLTRLRHPQILTVQHPVEESRESLAFATEPVFASLANVLGCHEN  134

Query  596  IEKVPK  613
            I  +P+
Sbjct  135  ISPLPQ  140



>ref|XP_005097980.1| PREDICTED: SCY1-like protein 2-like [Aplysia californica]
Length=937

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/121 (36%), Positives = 73/121 (60%), Gaps = 9/121 (7%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            +DF++  Q+ SAGP L+WK++SA  +   +      V++ +K++L   ++R        +
Sbjct  22   RDFDIQAQVASAGPRLLWKVFSAVKK---STKEEASVFLFEKKSLERFQKRD------RE  72

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  610
               D +R    +L +LRHP ++ V+Q L+E++ A+A  TEP+FAS AN LG L+NI   P
Sbjct  73   VIVDGLRRGVQQLTKLRHPRILSVIQPLEETREALAFATEPVFASLANVLGSLDNIGSPP  132

Query  611  K  613
            +
Sbjct  133  Q  133



>gb|ERG82889.1| scy1-like protein 2 [Ascaris suum]
Length=941

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +D+E+  QI SAGPGL WK+++      ++    V VW+ DK+ L          
Sbjct  24   GNPVTRDYEIHSQIASAGPGLSWKIHAGTK---YSTKQAVAVWLFDKKDLER------WP  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   D F D++R   ++L +LRHP ++ +   L+ES+++ A  TEP+FAS AN LG  +N
Sbjct  75   KHERDLFMDVLRRGVSQLTKLRHPRILVIEHPLEESRDSFAFCTEPVFASLANCLGRHDN  134

Query  596  I  598
            +
Sbjct  135  L  135



>gb|KHJ43435.1| VHS domain protein [Trichuris suis]
Length=1147

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/124 (35%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+W++YS   R   +    V VW+L+K+ L          
Sbjct  24   GNPVTREFEASVHVASAGPGLLWRIYSGFKR---STQQEVSVWILEKKLLDR------FQ  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   DA  +++R    +L RL+HP ++ +   L+ES++++A  TEP+FAS AN LG ++N
Sbjct  75   KQHRDAVIEILRRGVLQLTRLKHPYLITIEHPLEESRDSLAFCTEPIFASLANLLGRIDN  134

Query  596  IEKV  607
            +  +
Sbjct  135  MPSI  138



>gb|KFM57018.1| SCY1-like protein 2, partial [Stegodyphus mimosarum]
Length=867

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 9/125 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ + I SAGP L+WK+Y    +   +      V+VL+K+ L         S
Sbjct  20   GNPVTREYEIIEHIASAGPALLWKVYKGIKK---STKEEAAVFVLEKKLLER------YS  70

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  ++    +++   A L RLRHP ++ V  +L+ES+ ++A  TEP+FAS AN LG  EN
Sbjct  71   KQEKELILSILKKGVANLTRLRHPSILTVQHSLEESRESLAFATEPVFASLANILGYQEN  130

Query  596  IEKVP  610
            +   P
Sbjct  131  MPVPP  135



>ref|XP_008487864.1| PREDICTED: SCY1-like protein 2 [Diaphorina citri]
Length=697

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++++   IGSAG GL+WK+YS   R  +    +  ++VL+KR L +      L 
Sbjct  24   GNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQ---DASIFVLEKRQLEK------LD  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
                + +F  ++   ++L RLRHP ++ V   L+ES+ ++A  TEP+ AS AN LG  EN
Sbjct  75   MKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESRESLAFATEPVLASLANVLGHTEN  134

Query  596  I  598
            +
Sbjct  135  L  135



>emb|CAY54151.1| unnamed protein product [Heliconius melpomene]
Length=830

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    I SAGPGL+WK+Y    +   +      ++V +K+ L         S
Sbjct  24   GNPVTREFEATQYIASAGPGLLWKVYKGFKK---STKQEASIFVFEKKQLDR------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            KT  D   D+++    +L +LRHP ++ V  +L+ES+ ++A  TEP+FAS AN LG  EN
Sbjct  75   KTDRDIMIDILKRGIVQLTKLRHPQILTVQHSLEESRESLAFATEPVFASLANILGYSEN  134

Query  596  IEK  604
            + +
Sbjct  135  MPQ  137



>ref|XP_009171219.1| hypothetical protein T265_07437 [Opisthorchis viverrini]
 gb|KER25046.1| hypothetical protein T265_07437 [Opisthorchis viverrini]
Length=856

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 67/105 (64%), Gaps = 9/105 (9%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            ++++L  QIGSAGPG++WKL++AK R   +      VW  DK+++          K+ ++
Sbjct  23   REYDLGKQIGSAGPGMLWKLFAAKKR---STQQEATVWAFDKKSIDN------YPKSQKE  73

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFAS  565
            +  ++++   A L R++HP V+ V+Q L+ES+ ++A  +EPLF+S
Sbjct  74   SMIEILKYGVATLTRIKHPKVLSVLQPLEESRESLAFASEPLFSS  118



>ref|XP_011065985.1| PREDICTED: SCY1-like protein 2 [Acromyrmex echinatior]
 gb|EGI58244.1| SCY1-like protein 2 [Acromyrmex echinatior]
Length=860

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 8/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+WK+YS   +   +      ++V +KR L     RA   
Sbjct  35   GNPVTREFEATAHVASAGPGLLWKIYSGYKK---STKQEAAIFVFEKRMLERWSSRAD--  89

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
                +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  90   ---RELVLETLKRGVMQLTKLRHPQVLTVQHPLEESRDSLAFATEPVFASLANVLGNYEN  146

Query  596  IEK  604
            I +
Sbjct  147  ISQ  149



>gb|KGB40456.1| SCY1-like protein 2 [Schistosoma haematobium]
Length=839

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            +++++  QIG  GPG +WKLYSAK R  H       +W+++K+ L          K   +
Sbjct  23   REYDIEKQIGQTGPGSLWKLYSAKKRSTHQ---EATIWIMEKKLLES------YPKLQRE  73

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANAL  580
            +  ++++   + L+R++HP +V V+Q L+ES+ ++A  TEPLF S  + L
Sbjct  74   SMIEILKYGVSTLMRIKHPKIVSVLQPLEESRESLAYATEPLFTSLNSVL  123



>ref|XP_797681.2| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2-like [Strongylocentrotus 
purpuratus]
Length=972

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G   ++++E+   +GS GPG +WK+Y A  R   +      V+V +K+ L         +
Sbjct  16   GNPVMREYEIIRHVGSGGPGCLWKIYHAVKR---STKQEAGVFVFEKKLLER------FA  66

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   D   +++R  + +L RLRHP V+ V   L+E++ ++A  TEP+FAS AN LG  +N
Sbjct  67   KRDRDPLLEILRKGSTQLTRLRHPCVLTVQHPLEETRESLAFATEPVFASLANILGCHDN  126

Query  596  I  598
            +
Sbjct  127  M  127



>ref|XP_011171073.1| PREDICTED: SCY1-like protein 2 [Solenopsis invicta]
Length=859

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+WK+YS   +   +      ++V +KR L +   RA   
Sbjct  35   GNPVTREFEATAHVASAGPGLLWKIYSGYKK---STKQEAAIFVFEKRMLEKWSARAD--  89

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
                +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  90   ---RELVLETLKRGVMQLTKLRHPQVLIVQHPLEESRDSLAFATEPVFASLANVLGNYEN  146

Query  596  IEK  604
            I +
Sbjct  147  IPQ  149



>ref|XP_001944793.1| PREDICTED: SCY1-like protein 2 [Acyrthosiphon pisum]
Length=798

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 9/120 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E    I SAG GL+WK+YS   +   +      ++VL+KR L +       S
Sbjct  24   GNPVTREYEATKHIASAGVGLLWKIYSGYKK---STQQPASIFVLEKRLLDK------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            KT  +   ++++   A+L RL+HP V+ V   L+ES+ ++A  TEP+F S AN LG +EN
Sbjct  75   KTEREHIIEVVKKGVAQLARLKHPQVLTVQHTLEESRESLAFATEPVFCSLANVLGKMEN  134



>gb|EFZ10635.1| hypothetical protein SINV_03385 [Solenopsis invicta]
Length=887

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+WK+YS   +   +      ++V +KR L +   RA   
Sbjct  35   GNPVTREFEATAHVASAGPGLLWKIYSGYKK---STKQEAAIFVFEKRMLEKWSARAD--  89

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
                +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  90   ---RELVLETLKRGVMQLTKLRHPQVLIVQHPLEESRDSLAFATEPVFASLANVLGNYEN  146

Query  596  IEK  604
            I +
Sbjct  147  IPQ  149



>gb|AGC92739.1| SCY1-like protein 2 [Heliconius erato]
Length=830

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    I SAGPGL+WK+Y    +   +      ++VL+K+ L         S
Sbjct  24   GNPVTREFEATQYIASAGPGLLWKVYKGFKK---STKQEASIFVLEKKQLDR------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   D   D+++    +L +LRHP ++ V  +L+ES+ ++A  TEP+FAS AN LG  EN
Sbjct  75   KPDRDIMIDILKRGIVQLTKLRHPQILTVQHSLEESRESLAFATEPVFASLANVLGNSEN  134

Query  596  IEK  604
            + +
Sbjct  135  MPQ  137



>gb|KDR18011.1| hypothetical protein L798_07802, partial [Zootermopsis nevadensis]
Length=603

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    I SAGPGL+WK+Y    +          ++V +KR L          
Sbjct  24   GNPVTREFEATCHIASAGPGLLWKIYQGYKKSTKQ---EAAIFVFEKRQLERW------P  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            ++  +A  +M+R   ++L RLRHP ++ V   L+ES+ ++A  TEP+FAS AN +G  EN
Sbjct  75   RSDREAMLEMLRRGVSQLTRLRHPQILIVQHPLEESRESLAFATEPVFASLANIVGFTEN  134

Query  596  I  598
            +
Sbjct  135  M  135



>ref|XP_009020976.1| hypothetical protein HELRODRAFT_192420 [Helobdella robusta]
 gb|ESO00805.1| hypothetical protein HELRODRAFT_192420 [Helobdella robusta]
Length=210

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +2

Query  254  DFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDA  433
            + E+     S GPG++WK+Y A  +          V++ +K+ L         SK   D 
Sbjct  24   ELEIHGHRASGGPGMMWKIYDAVFKSSKQ---EASVFIFEKKQLDR------FSKRERDH  74

Query  434  FFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  610
            F D+++    +L +LRHP ++ +V  L++S+ ++A  TEP+F+S AN LG  +N+   P
Sbjct  75   FIDILKRGVQQLTKLRHPKILSIVHPLEDSRESLAFATEPIFSSLANVLGSHDNLPNPP  133



>ref|XP_011262686.1| PREDICTED: SCY1-like protein 2 [Camponotus floridanus]
 gb|EFN63968.1| SCY1-like protein 2 [Camponotus floridanus]
Length=858

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+WK+YS   +   +      ++V +KR L         +
Sbjct  35   GNPVTREFEATAHVASAGPGLLWKIYSGYKK---STKQEAAIFVFEKRMLERWP-----A  86

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            KT  +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  87   KTDRELVLETLKRGVMQLTKLRHPQVLIVQHPLEESRDSLAFATEPVFASLANVLGNYEN  146

Query  596  IEK  604
            I +
Sbjct  147  IPQ  149



>gb|KFH73263.1| SCY1 protein kinase [Mortierella verticillata NRRL 6337]
Length=925

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 74/123 (60%), Gaps = 8/123 (7%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSE--ARQRAGLSKTA  424
            +++E+  QI SAG   +WK++    R        V V++ +K  +    + +R   SK  
Sbjct  7    KNYEVGGQIASAG---LWKIHRGTKR---TTGQEVAVFIFEKNIVESISSLRRQTPSKRD  60

Query  425  EDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEK  604
            ++  ++ ++ +A++L RLRHP ++ VV+ +DES+ A+A  TEP+FAS +N LG  EN+  
Sbjct  61   QERVYEFLKKEASQLARLRHPSMLEVVEPVDESRTAIAFATEPIFASLSNLLGNYENLAS  120

Query  605  VPK  613
            VP+
Sbjct  121  VPE  123



>ref|XP_011152169.1| PREDICTED: SCY1-like protein 2 [Harpegnathos saltator]
 ref|XP_011152170.1| PREDICTED: SCY1-like protein 2 [Harpegnathos saltator]
 gb|EFN76018.1| SCY1-like protein 2 [Harpegnathos saltator]
Length=871

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+WK+YS   +   +      ++V +KR L +       S
Sbjct  35   GNPVTREFEATAHVASAGPGLLWKVYSGYKK---STKQEAAIFVFEKRILEKWS-----S  86

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +   + ++    +L +LRHP ++ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  87   KADRELVLETLKRGVTQLTKLRHPQILTVQHPLEESRDSLAFATEPVFASLANVLGNDEN  146

Query  596  IEK  604
            I +
Sbjct  147  IPQ  149



>ref|XP_005185357.1| PREDICTED: SCY1-like protein 2 [Musca domestica]
Length=876

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ DQ+ +AG GL+WK+Y+   +   +    V V+V +K+AL         S
Sbjct  24   GNNVTREYEVLDQVCTAGVGLLWKVYNGYKK---STKQEVSVFVFEKKALDR------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +A  + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KEDREAILETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_001603554.1| PREDICTED: SCY1-like protein 2 [Nasonia vitripennis]
 ref|XP_008206177.1| PREDICTED: SCY1-like protein 2 [Nasonia vitripennis]
 ref|XP_008206187.1| PREDICTED: SCY1-like protein 2 [Nasonia vitripennis]
Length=842

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/151 (28%), Positives = 80/151 (53%), Gaps = 8/151 (5%)
 Frame = +2

Query  152  MKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSAKARD  331
            ++ T +  L+   +    ++      + G    ++FE    I +AGPGL+WK+YS   + 
Sbjct  7    LRNTVSNTLSNTVSSTAHSLSQLSSVLPGNPVTREFEATAHICNAGPGLLWKVYSGFKK-  65

Query  332  GHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQA  511
              +      ++V +KR L +  ++A       D   + ++    +L +LRHP ++ V   
Sbjct  66   --STKQKAAIFVFEKRLLEQWPEKA-----VRDNVVETLKKGVVQLTKLRHPQILTVQHP  118

Query  512  LDESKNAMAMVTEPLFASAANALGILENIEK  604
            L+ES++++A  TEP+FAS AN LG ++N+ +
Sbjct  119  LEESRDSLAFATEPVFASLANILGSVDNLPQ  149



>ref|XP_010795536.1| PREDICTED: SCY1-like protein 2 isoform X2 [Notothenia coriiceps]
Length=918

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKTVDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIVDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQREN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_010795535.1| PREDICTED: SCY1-like protein 2 isoform X1 [Notothenia coriiceps]
Length=922

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKTVDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIVDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQREN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_002591089.1| hypothetical protein BRAFLDRAFT_119065 [Branchiostoma floridae]
 gb|EEN47100.1| hypothetical protein BRAFLDRAFT_119065 [Branchiostoma floridae]
Length=1244

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+ + + S GPG +WK+Y+   +        V V+V +KR      +R    
Sbjct  24   GNPVTREFEIRNHVASGGPGCLWKIYNGIKK---TTKQEVSVFVCEKRQFERMNRRD---  77

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
                DA  + ++    +L RLRHP ++ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  78   ---RDAVIEAMKRGVTQLTRLRHPRLLTVQHPLEESRDSLAFATEPVFASLANVLGNYEN  134

Query  596  I  598
            +
Sbjct  135  M  135



>gb|EHJ75302.1| hypothetical protein KGM_08305 [Danaus plexippus]
Length=856

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    I SAGPGL+WK+Y    +   +      ++V +K+ L         S
Sbjct  24   GNPVTREFEATQFIASAGPGLLWKVYKGFKK---STKQEASIFVFEKKQLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   D   D+++    +L +LRHP ++ V  +L+ES+ ++A  TEP+FAS AN LG  EN
Sbjct  75   KADRDIMIDILKRGIVQLTKLRHPQILTVQHSLEESRESLAFATEPVFASLANILGNTEN  134

Query  596  I  598
            +
Sbjct  135  M  135



>ref|XP_006816046.1| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2-like [Saccoglossus 
kowalevskii]
Length=934

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            +DF++     SAGPG +WK+YSA  R   +    V V+VL+K+ L +  +R        +
Sbjct  25   KDFDINKHHASAGPGYIWKIYSAVKR---STKEEVSVFVLEKKLLEKYSRRE------RE  75

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  598
               D+ +     L RLRHP ++ V   L+ES+   A  TEP+FAS  N LG  +N+
Sbjct  76   FLLDIFKKGVTXLTRLRHPKLLTVQHPLEESREYFAFATEPVFASLGNVLGCHDNL  131



>ref|XP_010736936.1| PREDICTED: SCY1-like protein 2 [Larimichthys crocea]
Length=916

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  EN
Sbjct  76   KFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005810784.1| PREDICTED: SCY1-like protein 2-like [Xiphophorus maculatus]
Length=914

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I-EKVPK  613
            +   VPK
Sbjct  136  LPSPVPK  142



>ref|XP_001999469.1| GI23050 [Drosophila mojavensis]
 gb|EDW14930.1| GI23050 [Drosophila mojavensis]
Length=851

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ DQI +AG GL+WK+YS   +   +    V V+V +K+ L         S
Sbjct  24   GNNVTREYEVLDQICTAGVGLMWKVYSGHKK---STKQEVSVFVFEKKVLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_011497019.1| PREDICTED: SCY1-like protein 2 [Ceratosolen solmsi marchali]
Length=823

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 41/149 (28%), Positives = 80/149 (54%), Gaps = 8/149 (5%)
 Frame = +2

Query  152  MKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSAKARD  331
            ++ T +  L+   +     +      + G    ++FE+   I SAGPGL+WK+YS   + 
Sbjct  7    LRNTVSNTLSNTVSSTAHGLSQLSSVLPGNPVAREFEVSSFICSAGPGLLWKVYSGFKK-  65

Query  332  GHAVYPNVCVWVLDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQA  511
              +      ++V +KR L +  +     K+  D   ++++    +L +L+HP ++ V   
Sbjct  66   --STKQKAAIFVFEKRLLDQWPE-----KSIRDNVVEILKKGVIQLTKLKHPQILTVQHP  118

Query  512  LDESKNAMAMVTEPLFASAANALGILENI  598
            L+ES+++++  TEP+FAS AN LG ++N+
Sbjct  119  LEESRDSLSFATEPVFASLANLLGCIDNL  147



>ref|XP_011489472.1| PREDICTED: SCY1-like protein 2 isoform X2 [Oryzias latipes]
Length=921

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGKHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I-EKVPK  613
            +   VPK
Sbjct  136  LPSPVPK  142



>ref|XP_008482138.1| PREDICTED: SCY1-like protein 2 [Diaphorina citri]
Length=129

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 62/111 (56%), Gaps = 9/111 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++++   IGSAG GL+WK+YS   R  +    +  ++VL+KR L +      L 
Sbjct  24   GNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQ---DASIFVLEKRQLEK------LD  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASA  568
                + +F  ++   ++L RLRHP ++ V   L+ES+ ++A  TEP+ AS 
Sbjct  75   MKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESRESLAFATEPVLAST  125



>ref|XP_008398793.1| PREDICTED: SCY1-like protein 2 isoform X2 [Poecilia reticulata]
Length=914

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKIIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I-EKVPK  613
            +   VPK
Sbjct  136  LPSPVPK  142



>ref|XP_011489471.1| PREDICTED: SCY1-like protein 2 isoform X1 [Oryzias latipes]
Length=925

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGKHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I-EKVPK  613
            +   VPK
Sbjct  136  LPSPVPK  142



>ref|XP_007564128.1| PREDICTED: SCY1-like protein 2 [Poecilia formosa]
Length=913

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I-EKVPK  613
            +   VPK
Sbjct  136  LPSPVPK  142



>ref|XP_008398792.1| PREDICTED: SCY1-like protein 2 isoform X1 [Poecilia reticulata]
Length=918

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKIIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I-EKVPK  613
            +   VPK
Sbjct  136  LPSPVPK  142



>ref|XP_011332287.1| PREDICTED: SCY1-like protein 2 [Cerapachys biroi]
 gb|EZA58274.1| SCY1-like protein [Cerapachys biroi]
Length=867

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    + SAGPGL+W++YS   +   +      ++V +KR L +   +A   
Sbjct  35   GNPVTREFEATAHVASAGPGLLWRVYSGYKK---STKQEAAIFVFEKRMLEKWSTKAD--  89

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
                +   + ++    +L +LRHP V+ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  90   ---RELVLETLKRGVMQLTKLRHPQVLTVQHPLEESRDSLAFATEPVFASLANVLGNQEN  146

Query  596  IEK  604
            I +
Sbjct  147  IPQ  149



>ref|XP_002603632.1| hypothetical protein BRAFLDRAFT_101363 [Branchiostoma floridae]
 gb|EEN59643.1| hypothetical protein BRAFLDRAFT_101363, partial [Branchiostoma 
floridae]
Length=1608

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+ + + S GPG +WK+Y+   +        V V+V +KR      +R    
Sbjct  24   GNPVTREFEIRNHVASGGPGCLWKIYNGIKK---TTKQEVSVFVCEKRQFERMNRRD---  77

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
                DA  + ++    +L RLRHP ++ V   L+ES++++A  TEP+FAS AN LG  EN
Sbjct  78   ---RDAVIEAMKRGVTQLTRLRHPRLLTVQHPLEESRDSLAFATEPVFASLANVLGNYEN  134

Query  596  I  598
            +
Sbjct  135  M  135



>gb|AAI71604.1| Si:ch211-244b2.1 [Danio rerio]
Length=929

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y+   +   +    V V+V DK+ +   +      
Sbjct  25   GNPVTREFEVGKHIASGGPGMSWRIYNGTKK---STKQEVAVFVFDKKVIDRYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  +N
Sbjct  76   KFEKDQIIDSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|NP_001074268.1| SCY1-like protein 2 [Danio rerio]
 ref|XP_005164885.1| PREDICTED: SCY1-like protein 2 isoform X1 [Danio rerio]
 emb|CAK04864.1| novel protein [Danio rerio]
Length=929

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y+   +   +    V V+V DK+ +   +      
Sbjct  25   GNPVTREFEVGKHIASGGPGMSWRIYNGTKK---STKQEVAVFVFDKKVIDRYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  +N
Sbjct  76   KFEKDQIIDSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_009298667.1| PREDICTED: SCY1-like protein 2 isoform X2 [Danio rerio]
Length=933

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y+   +   +    V V+V DK+ +   +      
Sbjct  25   GNPVTREFEVGKHIASGGPGMSWRIYNGTKK---STKQEVAVFVFDKKVIDRYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  +N
Sbjct  76   KFEKDQIIDSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_003704464.1| PREDICTED: SCY1-like protein 2-like [Megachile rotundata]
Length=827

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 69/123 (56%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I SAGP L+W++YS   +   +      ++V +KR L +       S
Sbjct  35   GNPVTREFEINAHIASAGPALLWRVYSGYKK---STKQEAAIFVFEKRVLDK------FS  85

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG  +N
Sbjct  86   KNDKELILETLKRGVAQLTKLRHPQILTVQHPLEESRDSLAFATEPVLASLANVLGNHDN  145

Query  596  IEK  604
            + +
Sbjct  146  LPQ  148



>emb|CDQ83779.1| unnamed protein product [Oncorhynchus mykiss]
Length=337

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y+   +        V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGMCWRIYNGTKKSTKQ---EVAVFVFDKKMVEKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   + ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIESLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_002508802.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70060.1| predicted protein [Micromonas sp. RCC299]
Length=865

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 77/137 (56%), Gaps = 21/137 (15%)
 Frame = +2

Query  242  RALQDFELFDQIG-SAGPGLVWKLYSAKAR-DGHAV--------------YPN--VCVWV  367
            R  ++++L   +  S GPG ++ +  A  R  G A                PN  V VW+
Sbjct  48   RCTREYDLDAPVAASGGPGCLFTVVDATRRCKGGATSKAAAAAAAAADPTTPNSRVSVWL  107

Query  368  LDKRALSEARQRAGLSKTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVT  547
            LDKRAL+E  +    SK   +    +IR DA+R+++LRHPGV+ + Q L+E++  +A+VT
Sbjct  108  LDKRALTEDGRH---SKEEVEQMLQLIRDDASRMLKLRHPGVLRLEQPLEETRTHLALVT  164

Query  548  EPLFASAANALGILENI  598
            EP+FASAA+ L    N+
Sbjct  165  EPVFASAADILAKGANL  181



>ref|XP_001994272.1| GH10138 [Drosophila grimshawi]
 gb|EDV95008.1| GH10138 [Drosophila grimshawi]
Length=862

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ DQI +AG GL+WK+Y+   +   +    V V+V +K+ L         S
Sbjct  24   GNNVTREYEVLDQICTAGVGLMWKVYNGHKK---STKQEVSVFVFEKKVLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_005733558.1| PREDICTED: SCY1-like protein 2-like isoform X2 [Pundamilia nyererei]
Length=919

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005733557.1| PREDICTED: SCY1-like protein 2-like isoform X1 [Pundamilia nyererei]
Length=923

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_002054795.1| GJ24635 [Drosophila virilis]
 gb|EDW68315.1| GJ24635 [Drosophila virilis]
Length=854

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ DQI +AG GL+WK+Y+   +   +    V V+V +K+ L         S
Sbjct  24   GNNVTREYEVLDQICTAGVGLMWKVYNGHKK---STKQEVSVFVFEKKVLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_006780838.1| PREDICTED: SCY1-like protein 2-like isoform X2 [Neolamprologus 
brichardi]
Length=919

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008277103.1| PREDICTED: SCY1-like protein 2 [Stegastes partitus]
 ref|XP_008277105.1| PREDICTED: SCY1-like protein 2 [Stegastes partitus]
Length=919

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004548377.1| PREDICTED: SCY1-like protein 2-like [Maylandia zebra]
Length=917

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_006780837.1| PREDICTED: SCY1-like protein 2-like isoform X1 [Neolamprologus 
brichardi]
Length=923

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005451651.1| PREDICTED: SCY1-like protein 2 isoform X3 [Oreochromis niloticus]
Length=920

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_001955375.1| GF16268 [Drosophila ananassae]
 gb|EDV43936.1| GF16268 [Drosophila ananassae]
Length=832

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/116 (33%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ DQ+ +AG GL+WK+Y+   +   +    V V+V +K++L         S
Sbjct  24   GNNVTREYEVLDQVCTAGVGLMWKVYNGYKK---STKQEVSVFVFEKKSLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_007235023.1| PREDICTED: SCY1-like protein 2-like isoform X2 [Astyanax mexicanus]
Length=927

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y+   +   +    V V+V DK+ +   +      
Sbjct  25   GNPVTREFEVGRHIASGGPGMCWRIYNGTKK---STKQEVAVFVFDKKIVDRYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  +N
Sbjct  76   KFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005451649.1| PREDICTED: SCY1-like protein 2 isoform X1 [Oreochromis niloticus]
 ref|XP_005451650.1| PREDICTED: SCY1-like protein 2 isoform X2 [Oreochromis niloticus]
Length=924

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004589681.1| PREDICTED: SCY1-like protein 2 [Ochotona princeps]
Length=927

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG LEN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNLEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007235022.1| PREDICTED: SCY1-like protein 2-like isoform X1 [Astyanax mexicanus]
Length=931

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y+   +   +    V V+V DK+ +   +      
Sbjct  25   GNPVTREFEVGRHIASGGPGMCWRIYNGTKK---STKQEVAVFVFDKKIVDRYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  +N
Sbjct  76   KFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>emb|CDQ81367.1| unnamed protein product [Oncorhynchus mykiss]
Length=407

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGMCWRIYNGTKK---STKQEVAVFVFDKKMVEKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   + ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFDKDQIIESLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>emb|CAH92591.1| hypothetical protein [Pongo abelii]
Length=335

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007893557.1| PREDICTED: SCY1-like protein 2 [Callorhinchus milii]
Length=954

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   + S GPGL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHVASGGPGLTWKIFNGVKK---STKQEVAVFVFDKKTIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  ++
Sbjct  76   KFDKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGCYDH  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_003972836.1| PREDICTED: SCY1-like protein 2-like [Takifugu rubripes]
Length=925

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y    +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLCWRIYDGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_395903.3| PREDICTED: SCY1-like protein 2-like [Apis mellifera]
Length=845

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 69/123 (56%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I SAGP L+WK+Y+   +   +      ++V +KR L +       S
Sbjct  35   GNPVTREFEVIAHIASAGPSLLWKVYNGYKK---STKQEAAIFVFEKRILEK------FS  85

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K+ ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG   N
Sbjct  86   KSDKELILETLKRGVAQLTKLRHPQILIVQHPLEESRDSLAFATEPVLASLANILGNHNN  145

Query  596  IEK  604
            + +
Sbjct  146  LPQ  148



>emb|CAG01880.1| unnamed protein product [Tetraodon nigroviridis]
Length=930

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPG+ W++Y    +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGMCWRIYDGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_003697658.1| PREDICTED: SCY1-like protein 2 [Apis florea]
Length=845

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 70/123 (57%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I SAGP L+WK+Y+   +   +      ++V +KR L +       S
Sbjct  35   GNPVTREFEVTAHIASAGPSLLWKVYNGYKK---STKQEAAIFVFEKRILEK------FS  85

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K+ ++   ++++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG   N
Sbjct  86   KSDKELILEILKRGVAQLTKLRHPQILIVQHPLEESRDSLAFATEPVLASLANILGNHNN  145

Query  596  IEK  604
            + +
Sbjct  146  LPQ  148



>gb|ELK25986.1| SCY1-like protein 2 [Myotis davidii]
Length=361

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +        V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQ---EVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004930703.1| PREDICTED: SCY1-like protein 2-like [Bombyx mori]
Length=815

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 66/123 (54%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE    I SAGPGL+WK+Y    +   +      ++V +K+ L   +      
Sbjct  24   GNPVTREFEATQFIASAGPGLLWKIYKGYKK---STKQEASIFVFEKKQLDRWQ------  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   D   + ++    +L +LRHP ++ V  +L+ES+ ++A  TEP+FAS AN LG  EN
Sbjct  75   KADRDIMLETLKRGIIQLTKLRHPQILTVQHSLEESRESLAFATEPVFASLANILGYTEN  134

Query  596  IEK  604
            + +
Sbjct  135  MPQ  137



>ref|XP_005930278.1| PREDICTED: SCY1-like protein 2-like isoform X3 [Haplochromis 
burtoni]
Length=919

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L++S++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEDSRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005930276.1| PREDICTED: SCY1-like protein 2-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005930277.1| PREDICTED: SCY1-like protein 2-like isoform X2 [Haplochromis 
burtoni]
Length=923

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I S GPGL W++Y+   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFEVGRHIASGGPGLSWRIYNGTKK---STKQEVAVFVFDKKMIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L++S++ +A  TEP+FAS +N LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEDSRDCLAFCTEPVFASLSNVLGQWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_308053.4| AGAP002142-PA [Anopheles gambiae str. PEST]
 gb|EAA03816.4| AGAP002142-PA [Anopheles gambiae str. PEST]
Length=810

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            +D+++ + IGSAG  LVWK+Y+   R    V     ++V DK+ L         +K   +
Sbjct  29   KDYDIAEHIGSAGTELVWKIYTGSKRTTKEV---ASIFVFDKKQLEL------FTKDERE  79

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENI  598
               + IR    +L ++RHP V+ V  A++ES++ +A  TEP+ AS AN LG   N+
Sbjct  80   EICENIRRGVVQLTKIRHPQVLTVQHAMEESRDTIAFATEPVVASLANLLGNTTNV  135



>ref|XP_002105285.1| GD21400 [Drosophila simulans]
 gb|EDX14788.1| GD21400 [Drosophila simulans]
Length=834

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ +Q+ +AG GL+WK+Y+   +   +    V V+V +K++L         S
Sbjct  24   GNNVTREYEVLEQVCTAGVGLMWKVYNGHKK---STKQEVSVFVFEKKSLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_002098647.1| GE23820 [Drosophila yakuba]
 gb|EDW98359.1| GE23820 [Drosophila yakuba]
Length=835

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ +Q+ +AG GL+WK+Y+   +   +    V V+V +K++L         S
Sbjct  24   GNNVTREYEVLEQVCTAGVGLMWKVYNGHKK---STKQEVSVFVFEKKSLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_002037140.1| GM12753 [Drosophila sechellia]
 gb|EDW53299.1| GM12753 [Drosophila sechellia]
Length=835

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ +Q+ +AG GL+WK+Y+   +   +    V V+V +K++L         S
Sbjct  24   GNNVTREYEVLEQVCTAGVGLMWKVYNGHKK---STKQEVSVFVFEKKSLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|NP_651655.1| CG1951 [Drosophila melanogaster]
 gb|AAF56841.1| CG1951 [Drosophila melanogaster]
 gb|AAL39769.1| LD39455p [Drosophila melanogaster]
Length=835

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ +Q+ +AG GL+WK+Y+   +   +    V V+V +K++L         S
Sbjct  24   GNNVTREYEVLEQVCTAGVGLMWKVYNGHKK---STKQEVSVFVFEKKSLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_005845619.1| hypothetical protein CHLNCDRAFT_136879 [Chlorella variabilis]
 gb|EFN53517.1| hypothetical protein CHLNCDRAFT_136879 [Chlorella variabilis]
Length=643

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 75/129 (58%), Gaps = 16/129 (12%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPG-LVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQR---  403
            G + L D+ +  Q+ +AG G  +W++++A+++   + +P V  W+LDKR L++  ++   
Sbjct  37   GAQCLLDYAVGGQVATAGSGHALWRIFTARSKKEGSPHPVVSAWILDKRELTQTEEQLYG  96

Query  404  ---------AGLSKTAE---DAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVT  547
                      GL++ ++   DAF +  R D   L RL+HPGV+ ++  L+E++  +  +T
Sbjct  97   GHGGGGGGGGGLTRPSQRRLDAFVEQCRHDVHALARLKHPGVLRLIAPLEETRTQLVFIT  156

Query  548  EPLFASAAN  574
            E +FAS A+
Sbjct  157  EHVFASLAD  165



>ref|XP_006871176.1| PREDICTED: SCY1-like protein 2 [Chrysochloris asiatica]
Length=928

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDTLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>gb|EAW97630.1| SCY1-like 2 (S. cerevisiae), isoform CRA_a [Homo sapiens]
Length=479

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +        V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQ---EVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004324221.1| PREDICTED: SCY1-like protein 2, partial [Tursiops truncatus]
Length=878

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_006888580.1| PREDICTED: SCY1-like protein 2 [Elephantulus edwardii]
Length=929

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDCLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007945392.1| PREDICTED: SCY1-like protein 2 [Orycteropus afer afer]
Length=929

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007465388.1| PREDICTED: SCY1-like protein 2 [Lipotes vexillifer]
Length=929

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007165888.1| PREDICTED: SCY1-like protein 2 isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=929

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007103423.1| PREDICTED: SCY1-like protein 2 isoform X1 [Physeter catodon]
 ref|XP_007103424.1| PREDICTED: SCY1-like protein 2 isoform X2 [Physeter catodon]
Length=929

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004269537.1| PREDICTED: SCY1-like protein 2 isoform 1 [Orcinus orca]
 ref|XP_004269538.1| PREDICTED: SCY1-like protein 2 isoform 2 [Orcinus orca]
Length=929

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004006699.1| PREDICTED: SCY1-like protein 2 [Ovis aries]
Length=929

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007165887.1| PREDICTED: SCY1-like protein 2 isoform X1 [Balaenoptera acutorostrata 
scammoni]
Length=933

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_006620198.1| PREDICTED: SCY1-like protein 2-like [Apis dorsata]
Length=797

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 69/123 (56%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++FE+   I SAGP L+WK+Y+   +   +      ++V +KR L +       S
Sbjct  35   GNPVTREFEVTAHIASAGPSLLWKVYNGYKK---STKQEAAIFVFEKRILEK------FS  85

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K+ ++   + ++   A+L +LRHP ++ V   L+ES++++A  TEP+ AS AN LG   N
Sbjct  86   KSDKELILETLKRGIAQLTKLRHPQILIVQHPLEESRDSLAFATEPVLASLANILGNHNN  145

Query  596  IEK  604
            + +
Sbjct  146  LPQ  148



>ref|XP_001981409.1| GG11631 [Drosophila erecta]
 gb|EDV53279.1| GG11631 [Drosophila erecta]
Length=835

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E+ +Q+ +AG GL+WK+Y+   +   +    V V+V +K++L         S
Sbjct  24   GNNVTREYEVLEQVCTAGVGLMWKVYNGHKK---STKQEVSVFVFEKKSLER------WS  74

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALG  583
            K   +   + +R    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN +G
Sbjct  75   KDDRENMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVG  130



>ref|XP_005305307.1| PREDICTED: SCY1-like protein 2 isoform X2 [Chrysemys picta bellii]
Length=929

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP +V V   L+ES++ +A  TEP+FAS AN LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLVTVQHPLEESRDCLAFCTEPVFASLANVLGNWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005305306.1| PREDICTED: SCY1-like protein 2 isoform X1 [Chrysemys picta bellii]
Length=933

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGSGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP +V V   L+ES++ +A  TEP+FAS AN LG  +N
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLVTVQHPLEESRDCLAFCTEPVFASLANVLGNWDN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004650608.1| PREDICTED: SCY1-like protein 2 [Jaculus jaculus]
Length=896

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPIFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>gb|ERL86428.1| hypothetical protein D910_03835 [Dendroctonus ponderosae]
Length=446

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 66/123 (54%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    +++E    I SAGPGL+WK+Y    R       +  ++V +KR L +       +
Sbjct  28   GNPVTREYESSAHIASAGPGLLWKIYKGTKRSTKQ---DASIFVFEKRQLEK------FN  78

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +   + ++    +L ++RHP V+ V   L+ES++++A  TEP+FAS AN LG   N
Sbjct  79   KNDRELVLESLKHGVQQLTKIRHPQVLTVQHPLEESRDSIAFATEPVFASLANILGETTN  138

Query  596  IEK  604
            + +
Sbjct  139  MPQ  141



>gb|ELK10343.1| SCY1-like protein 2 [Pteropus alecto]
Length=817

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLMDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_003385265.2| PREDICTED: SCY1-like protein 2 [Amphimedon queenslandica]
Length=1106

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 66/121 (55%), Gaps = 7/121 (6%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G   L+++EL  Q+ SAGPGL+WK+++ + +        V V++  K     A +   + 
Sbjct  13   GNPVLREYELGKQVASAGPGLLWKVFNGEKKSTKQA---VSVFIFYK----TAPELEKVP  65

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +A F++++     L + RHP ++ V   ++ES + +A  TEP+ AS AN LG   N
Sbjct  66   KKEREALFELLKKGPTHLAKFRHPKILTVDHPVEESSDCLAFATEPIVASLANVLGYYAN  125

Query  596  I  598
            +
Sbjct  126  L  126



>gb|EAW97636.1| SCY1-like 2 (S. cerevisiae), isoform CRA_g [Homo sapiens]
Length=587

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +        V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQ---EVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>gb|EAW97634.1| SCY1-like 2 (S. cerevisiae), isoform CRA_e, partial [Homo sapiens]
Length=675

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_969159.1| PREDICTED: SCY1-like protein 2 [Tribolium castaneum]
 gb|EFA12879.1| hypothetical protein TcasGA2_TC011557 [Tribolium castaneum]
Length=789

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/123 (33%), Positives = 65/123 (53%), Gaps = 9/123 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F+    I SAGPGLVWK+Y    R   +      ++V +KR L +        
Sbjct  28   GNPVTREFDASTHIASAGPGLVWKIYKGCKR---STKQEASIFVFEKRQLEK------WG  78

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K   +   + ++   ++L ++RHP V+ V   L+ES+ ++A  TEP+FAS AN LG   N
Sbjct  79   KADREMILESLKRGVSQLTKIRHPQVLTVQHPLEESRESLAFATEPVFASLANVLGKTTN  138

Query  596  IEK  604
            + +
Sbjct  139  MPQ  141



>ref|XP_005322434.1| PREDICTED: SCY1-like protein 2 [Ictidomys tridecemlineatus]
Length=927

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDALKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_011384924.1| PREDICTED: SCY1-like protein 2 isoform X2 [Pteropus vampyrus]
Length=928

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLMDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_011384905.1| PREDICTED: SCY1-like protein 2 isoform X1 [Pteropus vampyrus]
 ref|XP_011384910.1| PREDICTED: SCY1-like protein 2 isoform X1 [Pteropus vampyrus]
 ref|XP_011384917.1| PREDICTED: SCY1-like protein 2 isoform X1 [Pteropus vampyrus]
Length=929

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLMDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_006914628.1| PREDICTED: SCY1-like protein 2 [Pteropus alecto]
Length=929

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLMDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>gb|EAW97631.1| SCY1-like 2 (S. cerevisiae), isoform CRA_b [Homo sapiens]
Length=549

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +        V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQ---EVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004675824.1| PREDICTED: SCY1-like protein 2 [Condylura cristata]
Length=932

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNCEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004995080.1| SCY1 protein kinase [Salpingoeca rosetta]
 gb|EGD83576.1| SCY1 protein kinase [Salpingoeca rosetta]
Length=956

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 74/124 (60%), Gaps = 6/124 (5%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G   L+++++   + SAG  L+W+++ A  R G +   N  V++ DK+A++   Q   L 
Sbjct  10   GNACLKEYDVGTHVASAGTCLLWRVHDAVHR-GRS--ENASVFIFDKKAIN---QDKTLD  63

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            +  +D  F++ R  A++L +LRHP V+ +V  + ESK+ +A  TE + AS +N LG  +N
Sbjct  64   RRTKDRVFELARQGASQLQKLRHPNVLRIVFPVTESKDYIAFATERVVASLSNLLGKFDN  123

Query  596  IEKV  607
            + KV
Sbjct  124  LPKV  127



>gb|EDM16977.1| SCY1-like 2 (S. cerevisiae) (predicted), isoform CRA_a [Rattus 
norvegicus]
 gb|EDM16978.1| SCY1-like 2 (S. cerevisiae) (predicted), isoform CRA_a [Rattus 
norvegicus]
Length=564

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +        V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQ---EVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>gb|EPY74347.1| hypothetical protein CB1_002098003 [Camelus ferus]
Length=862

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  22   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  72

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  73   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  132

Query  596  I  598
            +
Sbjct  133  L  133



>ref|XP_003475920.1| PREDICTED: SCY1-like protein 2 [Cavia porcellus]
Length=878

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>gb|EGW06681.1| SCY1-like protein 2 [Cricetulus griseus]
Length=631

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  22   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  72

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  73   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  132

Query  596  I  598
            +
Sbjct  133  L  133



>ref|XP_007085720.1| PREDICTED: SCY1-like protein 2 isoform X3 [Panthera tigris altaica]
Length=890

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004469271.1| PREDICTED: SCY1-like protein 2 isoform 2 [Dasypus novemcinctus]
Length=926

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDCLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004469270.1| PREDICTED: SCY1-like protein 2 isoform 1 [Dasypus novemcinctus]
Length=930

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDCLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>tpg|DAA29574.1| TPA: SCY1-like 2 [Bos taurus]
Length=904

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_001634807.1| predicted protein [Nematostella vectensis]
 gb|EDO42744.1| predicted protein, partial [Nematostella vectensis]
Length=608

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +2

Query  251  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAED  430
            +D+E+   + S GP L WK++  KA+          + V +KR L    +R        D
Sbjct  18   KDYEVGKHVASFGPNLAWKVFEGKAKTTGQ---EASLVVFEKRLLDTVDKRD------RD  68

Query  431  AFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILENIEKVP  610
               ++++  A +L RLRHP ++ +  A++ES++ +A  TEP+FAS +N LG  +N+   P
Sbjct  69   VVLELMKKGAVQLTRLRHPRLLLIQHAMEESRDCLAFATEPIFASLSNVLGRHDNMPSPP  128



>ref|XP_009246420.1| PREDICTED: SCY1-like protein 2 [Pongo abelii]
Length=922

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008590888.1| PREDICTED: SCY1-like protein 2 isoform X3 [Galeopterus variegatus]
Length=925

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_010629690.1| PREDICTED: SCY1-like protein 2 isoform X2 [Fukomys damarensis]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008703944.1| PREDICTED: SCY1-like protein 2 [Ursus maritimus]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008590887.1| PREDICTED: SCY1-like protein 2 isoform X2 [Galeopterus variegatus]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008514598.1| PREDICTED: SCY1-like protein 2 isoform X4 [Equus przewalskii]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008142998.1| PREDICTED: SCY1-like protein 2 [Eptesicus fuscus]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_002928531.1| PREDICTED: SCY1-like protein 2 [Ailuropoda melanoleuca]
 gb|EFB28710.1| hypothetical protein PANDA_018499 [Ailuropoda melanoleuca]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_007613789.1| PREDICTED: SCY1-like protein 2 isoform X3 [Cricetulus griseus]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_006769443.1| PREDICTED: SCY1-like protein 2 isoform X2 [Myotis davidii]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_006084160.1| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2 [Myotis lucifugus]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005956563.1| PREDICTED: SCY1-like protein 2 isoform X3 [Pantholops hodgsonii]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005882412.1| PREDICTED: SCY1-like protein 2 isoform X2 [Myotis brandtii]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_005680555.1| PREDICTED: SCY1-like protein 2 isoform X2 [Capra hircus]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_004623885.1| PREDICTED: SCY1-like protein 2 [Octodon degus]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_003783366.1| PREDICTED: SCY1-like protein 2 [Otolemur garnettii]
Length=928

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_011282474.1| PREDICTED: SCY1-like protein 2 [Felis catus]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_010988300.1| PREDICTED: SCY1-like protein 2 [Camelus dromedarius]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_010961079.1| PREDICTED: SCY1-like protein 2 [Camelus bactrianus]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_010829895.1| PREDICTED: SCY1-like protein 2 [Bison bison bison]
 ref|XP_010829896.1| PREDICTED: SCY1-like protein 2 [Bison bison bison]
 ref|XP_010829898.1| PREDICTED: SCY1-like protein 2 [Bison bison bison]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_010381872.1| PREDICTED: SCY1-like protein 2 [Rhinopithecus roxellana]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008849370.1| PREDICTED: SCY1-like protein 2 [Nannospalax galili]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008590886.1| PREDICTED: SCY1-like protein 2 isoform X1 [Galeopterus variegatus]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008514597.1| PREDICTED: SCY1-like protein 2 isoform X3 [Equus przewalskii]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008062879.1| PREDICTED: SCY1-like protein 2 isoform X2 [Tarsius syrichta]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_008002559.1| PREDICTED: SCY1-like protein 2 isoform X2 [Chlorocebus sabaeus]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



>ref|XP_009002693.1| PREDICTED: SCY1-like protein 2 isoform X2 [Callithrix jacchus]
Length=929

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +2

Query  236  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  415
            G    ++F++   I S G GL WK+++   +   +    V V+V DK+ + + +      
Sbjct  25   GNPVTREFDVGRHIASGGNGLAWKIFNGTKK---STKQEVAVFVFDKKLIDKYQ------  75

Query  416  KTAEDAFFDMIRADAARLVRLRHPGVVHVVQALDESKNAMAMVTEPLFASAANALGILEN  595
            K  +D   D ++    +L RLRHP ++ V   L+ES++ +A  TEP+FAS AN LG  EN
Sbjct  76   KFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWEN  135

Query  596  I  598
            +
Sbjct  136  L  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660