BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040N06

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010446199.1|  PREDICTED: actin-85C                               401   4e-138   Camelina sativa [gold-of-pleasure]
ref|XP_009409104.1|  PREDICTED: actin-like                              403   1e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010690498.1|  PREDICTED: actin-1                                 402   2e-137   Beta vulgaris subsp. vulgaris [field beet]
gb|ABY19575.1|  actin                                                   397   3e-137   Ipomoea batatas [batate]
gb|EYU20691.1|  hypothetical protein MIMGU_mgv1a008334mg                402   4e-137   Erythranthe guttata [common monkey flower]
emb|CDP00088.1|  unnamed protein product                                401   6e-137   Coffea canephora [robusta coffee]
ref|XP_009388742.1|  PREDICTED: actin-like                              401   6e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004239790.1|  PREDICTED: actin-58                                401   7e-137   Solanum lycopersicum
ref|XP_006345961.1|  PREDICTED: actin-58-like                           401   8e-137   Solanum tuberosum [potatoes]
gb|KDO67622.1|  hypothetical protein CISIN_1g017081mg                   401   8e-137   Citrus sinensis [apfelsine]
ref|XP_009621805.1|  PREDICTED: actin-like                              401   8e-137   Nicotiana tomentosiformis
ref|XP_009397437.1|  PREDICTED: actin-like                              401   8e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010520278.1|  PREDICTED: actin-like                              401   9e-137   Tarenaya hassleriana [spider flower]
ref|XP_006351346.1|  PREDICTED: actin-58-like                           401   9e-137   Solanum tuberosum [potatoes]
gb|AAO42312.1|  putative actin 4                                        401   1e-136   Arabidopsis thaliana [mouse-ear cress]
gb|KJB73913.1|  hypothetical protein B456_011G260600                    400   1e-136   Gossypium raimondii
gb|KHG29096.1|  Actin                                                   401   1e-136   Gossypium arboreum [tree cotton]
gb|KJB16973.1|  hypothetical protein B456_002G257900                    400   1e-136   Gossypium raimondii
gb|KHF98170.1|  Actin                                                   400   1e-136   Gossypium arboreum [tree cotton]
ref|XP_006400969.1|  hypothetical protein EUTSA_v10013840mg             400   1e-136   Eutrema salsugineum [saltwater cress]
gb|KJB76087.1|  hypothetical protein B456_012G070300                    400   1e-136   Gossypium raimondii
ref|NP_200745.1|  actin 4                                               400   1e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418890.1|  hypothetical protein EUTSA_v10002572mg             400   1e-136   Eutrema salsugineum [saltwater cress]
ref|XP_006282193.1|  hypothetical protein CARUB_v10028459mg             400   2e-136   Capsella rubella
ref|XP_009150245.1|  PREDICTED: actin-12                                400   2e-136   Brassica rapa
ref|NP_190236.1|  actin-12                                              400   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150339.1|  PREDICTED: actin-12-like                           400   2e-136   Brassica rapa
emb|CDY38066.1|  BnaC03g75050D                                          400   2e-136   Brassica napus [oilseed rape]
emb|CDY30846.1|  BnaC04g27010D                                          400   2e-136   Brassica napus [oilseed rape]
gb|AET50987.1|  actin                                                   397   2e-136   Lactuca sativa [cultivated lettuce]
gb|KHG03218.1|  Actin                                                   400   2e-136   Gossypium arboreum [tree cotton]
gb|AAC49652.1|  actin                                                   400   2e-136   Striga asiatica [witchweed]
emb|CDX82985.1|  BnaA01g19850D                                          400   2e-136   
pir||T45915  actin (ACT3) - Arabidopsis thaliana                        402   2e-136
gb|AIR74902.1|  beta-actin                                              400   2e-136   Mentha spicata
gb|KJB76085.1|  hypothetical protein B456_012G070300                    400   2e-136   Gossypium raimondii
gb|KHG21354.1|  Actin-7 -like protein                                   396   3e-136   Gossypium arboreum [tree cotton]
gb|KHF99778.1|  Actin                                                   400   3e-136   Gossypium arboreum [tree cotton]
ref|XP_009802880.1|  PREDICTED: actin-like                              400   3e-136   Nicotiana sylvestris
ref|XP_009625006.1|  PREDICTED: actin-like                              400   3e-136   Nicotiana tomentosiformis
emb|CDY53444.1|  BnaA02g07080D                                          400   3e-136   Brassica napus [oilseed rape]
gb|EPS69959.1|  actin                                                   400   3e-136   Genlisea aurea
sp|Q05214.1|ACT1_TOBAC  RecName: Full=Actin                             400   3e-136   Nicotiana tabacum [American tobacco]
gb|AAC49651.1|  actin                                                   400   3e-136   Striga asiatica [witchweed]
gb|KHG18648.1|  Actin-58                                                400   3e-136   Gossypium arboreum [tree cotton]
ref|XP_009773924.1|  PREDICTED: actin                                   400   3e-136   Nicotiana sylvestris
sp|O81221.1|ACT_GOSHI  RecName: Full=Actin                              400   3e-136   Gossypium hirsutum [American cotton]
ref|XP_009618901.1|  PREDICTED: actin                                   399   3e-136   Nicotiana tomentosiformis
gb|KJB73912.1|  hypothetical protein B456_011G260600                    399   3e-136   Gossypium raimondii
gb|ACH69153.1|  actin                                                   399   3e-136   Nicotiana tabacum [American tobacco]
ref|XP_007009347.1|  Actin-11 isoform 2                                 400   3e-136   
dbj|BAK06400.1|  predicted protein                                      399   4e-136   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB36724.1|  hypothetical protein B456_006G173100                    399   4e-136   Gossypium raimondii
gb|KHG29811.1|  Actin                                                   399   4e-136   Gossypium arboreum [tree cotton]
gb|KHG15514.1|  Actin                                                   399   4e-136   Gossypium arboreum [tree cotton]
ref|XP_002876223.1|  hypothetical protein ARALYDRAFT_323914             401   4e-136   
gb|KDP24628.1|  hypothetical protein JCGZ_25544                         399   4e-136   Jatropha curcas
ref|XP_010257475.1|  PREDICTED: actin                                   399   4e-136   Nelumbo nucifera [Indian lotus]
sp|P30167.1|ACT3_SOLTU  RecName: Full=Actin-58                          399   4e-136   Solanum tuberosum [potatoes]
ref|XP_009787806.1|  PREDICTED: actin-like                              399   5e-136   Nicotiana sylvestris
ref|XP_008382817.1|  PREDICTED: actin                                   399   5e-136   Malus domestica [apple tree]
ref|XP_007009346.1|  Actin-11 isoform 1                                 399   5e-136   Theobroma cacao [chocolate]
ref|XP_004250955.1|  PREDICTED: actin-97-like                           399   5e-136   
ref|XP_009381010.1|  PREDICTED: actin-like                              399   5e-136   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAJ44725.1|  actin                                                  396   5e-136   Capsicum chinense [bonnet pepper]
ref|XP_010030965.1|  PREDICTED: actin                                   399   6e-136   Eucalyptus grandis [rose gum]
ref|XP_009600120.1|  PREDICTED: actin-like                              399   6e-136   Nicotiana tomentosiformis
ref|XP_002879687.1|  hypothetical protein ARALYDRAFT_321465             399   6e-136   
gb|EPS69960.1|  actin-97                                                399   7e-136   Genlisea aurea
gb|AAM65657.1|  actin 4                                                 399   7e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534357.1|  PREDICTED: actin-1-like                            399   7e-136   Tarenaya hassleriana [spider flower]
ref|NP_566988.1|  actin 3                                               399   7e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006350765.1|  PREDICTED: actin-like                              399   7e-136   Solanum tuberosum [potatoes]
ref|XP_002879684.1|  hypothetical protein ARALYDRAFT_321462             399   7e-136   Arabidopsis lyrata subsp. lyrata
ref|XP_010454923.1|  PREDICTED: actin-12-like                           399   7e-136   Camelina sativa [gold-of-pleasure]
ref|XP_004241231.1|  PREDICTED: actin-82                                399   7e-136   Solanum lycopersicum
gb|AAA32727.1|  actin-1                                                 399   7e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435988.1|  hypothetical protein CICLE_v10031847mg             399   7e-136   Citrus clementina [clementine]
gb|KHG20063.1|  Actin-7 -like protein                                   392   8e-136   Gossypium arboreum [tree cotton]
ref|XP_010541399.1|  PREDICTED: actin-12-like                           399   9e-136   Tarenaya hassleriana [spider flower]
ref|XP_011078821.1|  PREDICTED: actin                                   399   9e-136   Sesamum indicum [beniseed]
ref|XP_009139296.1|  PREDICTED: actin-1                                 399   9e-136   Brassica rapa
gb|EEC78366.1|  hypothetical protein OsI_18129                          398   9e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_009131999.1|  PREDICTED: actin-12-like                           398   1e-135   Brassica rapa
ref|XP_011091473.1|  PREDICTED: actin-11                                398   1e-135   Sesamum indicum [beniseed]
ref|XP_009801998.1|  PREDICTED: actin-97-like                           398   1e-135   Nicotiana sylvestris
gb|KJB20092.1|  hypothetical protein B456_003G132400                    398   1e-135   Gossypium raimondii
ref|XP_010535499.1|  PREDICTED: actin-11                                398   1e-135   Tarenaya hassleriana [spider flower]
ref|XP_009591335.1|  PREDICTED: actin-97                                398   1e-135   Nicotiana tomentosiformis
gb|EPS60057.1|  hypothetical protein M569_14747                         398   1e-135   Genlisea aurea
emb|CDP10143.1|  unnamed protein product                                398   1e-135   Coffea canephora [robusta coffee]
ref|XP_009116071.1|  PREDICTED: actin-1-like                            398   1e-135   Brassica rapa
ref|XP_002463566.1|  hypothetical protein SORBIDRAFT_01g002170          398   1e-135   Sorghum bicolor [broomcorn]
gb|ADY38689.1|  actin                                                   398   1e-135   Camellia sinensis [black tea]
emb|CDP06619.1|  unnamed protein product                                398   1e-135   Coffea canephora [robusta coffee]
gb|ADU52545.1|  actin 2                                                 398   1e-135   Morus alba
ref|XP_011080749.1|  PREDICTED: actin-1-like                            398   1e-135   Sesamum indicum [beniseed]
gb|AEO45960.1|  actin 4                                                 398   1e-135   Mangifera indica
ref|NP_001141313.1|  uncharacterized protein LOC100273404               398   1e-135   Zea mays [maize]
gb|KJB76088.1|  hypothetical protein B456_012G070300                    400   1e-135   Gossypium raimondii
gb|ADX97327.1|  actin 7                                                 398   2e-135   Mangifera indica
gb|ADU52548.1|  actin 2                                                 398   2e-135   Morus alba
ref|XP_003533915.1|  PREDICTED: actin-like isoform X1                   398   2e-135   Glycine max [soybeans]
ref|XP_009381444.1|  PREDICTED: actin-like                              398   2e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010111138.1|  hypothetical protein L484_010751                   398   2e-135   Morus notabilis
gb|EMT00396.1|  Actin-3                                                 398   2e-135   
gb|ABI14668.1|  actin                                                   394   2e-135   Aegiceras corniculatum
ref|NP_001159156.1|  putative actin family protein                      398   2e-135   Zea mays [maize]
ref|XP_009403146.1|  PREDICTED: actin                                   398   2e-135   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN54250.1|  hypothetical protein Csa_4G296030                       395   2e-135   Cucumis sativus [cucumbers]
ref|XP_009410069.1|  PREDICTED: actin                                   398   2e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010682856.1|  PREDICTED: actin-11                                398   2e-135   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007027035.1|  Actin 3                                            398   2e-135   Theobroma cacao [chocolate]
gb|KJB76649.1|  hypothetical protein B456_012G100700                    397   2e-135   Gossypium raimondii
ref|XP_003519037.1|  PREDICTED: actin-like isoform X1                   398   2e-135   Glycine max [soybeans]
ref|XP_004981971.1|  PREDICTED: actin-1-like isoform X2                 398   2e-135   
gb|AGZ90152.1|  actin 11                                                397   2e-135   Litsea cubeba [may chang]
gb|AFN53639.1|  putative actin-97 protein                               397   2e-135   Linum usitatissimum
gb|AFW82911.1|  putative actin family protein isoform 1                 398   2e-135   
gb|AIS84126.1|  actin                                                   391   2e-135   Fraxinus mandshurica [Manchurian ash]
dbj|BAL14664.1|  actin                                                  397   2e-135   Chrysanthemum seticuspe f. boreale
ref|XP_003562930.1|  PREDICTED: actin-3                                 397   2e-135   Brachypodium distachyon [annual false brome]
gb|ACJ83287.1|  unknown                                                 391   2e-135   Medicago truncatula
ref|XP_010067406.1|  PREDICTED: actin-1-like                            397   2e-135   Eucalyptus grandis [rose gum]
gb|AFZ78525.1|  actin                                                   393   2e-135   Populus tomentosa [Chinese white poplar]
ref|XP_004156708.1|  PREDICTED: actin-97-like                           397   2e-135   
ref|XP_009143470.1|  PREDICTED: LOW QUALITY PROTEIN: actin-1            397   2e-135   Brassica rapa
gb|AFW75038.1|  putative actin family protein                           397   2e-135   
ref|XP_006855625.1|  hypothetical protein AMTR_s00044p00088410          398   2e-135   
ref|XP_006650864.1|  PREDICTED: actin-3-like                            397   2e-135   Oryza brachyantha
gb|AAF71264.1|AF246714_1  actin-like protein                            397   3e-135   Phalaenopsis hybrid cultivar
ref|XP_002530852.1|  actin, putative                                    395   3e-135   
emb|CDX91373.1|  BnaC04g07770D                                          397   3e-135   
gb|AFW75045.1|  putative actin family protein                           397   3e-135   
gb|KJB76652.1|  hypothetical protein B456_012G100700                    398   3e-135   Gossypium raimondii
ref|XP_006297921.1|  hypothetical protein CARUB_v10013962mg             397   3e-135   Capsella rubella
ref|NP_001051822.1|  Os03g0836000                                       397   3e-135   
gb|AAN08622.1|  actin                                                   397   3e-135   Phalaenopsis hybrid cultivar
ref|XP_010554872.1|  PREDICTED: actin-1                                 397   3e-135   Tarenaya hassleriana [spider flower]
ref|XP_010553283.1|  PREDICTED: actin                                   397   3e-135   Tarenaya hassleriana [spider flower]
gb|AHY94895.1|  actin                                                   397   3e-135   Prunella vulgaris
ref|XP_003525105.1|  PREDICTED: actin-7-like                            397   3e-135   
ref|XP_010520033.1|  PREDICTED: actin-1-like                            397   3e-135   Tarenaya hassleriana [spider flower]
ref|XP_009141678.1|  PREDICTED: actin-1-like                            397   3e-135   Brassica rapa
ref|XP_002882767.1|  actin-11                                           397   3e-135   
emb|CDP12785.1|  unnamed protein product                                397   3e-135   Coffea canephora [robusta coffee]
gb|KJB76650.1|  hypothetical protein B456_012G100700                    397   3e-135   Gossypium raimondii
ref|XP_010528400.1|  PREDICTED: actin-1                                 397   3e-135   Tarenaya hassleriana [spider flower]
ref|XP_010524532.1|  PREDICTED: actin-1-like                            397   3e-135   Tarenaya hassleriana [spider flower]
ref|XP_008363858.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like         397   3e-135   Malus domestica [apple tree]
gb|AFZ78523.1|  actin                                                   397   3e-135   Populus tomentosa [Chinese white poplar]
gb|KHG27347.1|  Actin                                                   397   3e-135   Gossypium arboreum [tree cotton]
ref|XP_006407369.1|  hypothetical protein EUTSA_v10020950mg             397   3e-135   Eutrema salsugineum [saltwater cress]
emb|CDY01102.1|  BnaC05g40980D                                          397   3e-135   
ref|XP_009393674.1|  PREDICTED: actin-like                              397   4e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_187818.1|  actin-11                                              397   4e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498525.1|  PREDICTED: actin-11                                397   4e-135   Camelina sativa [gold-of-pleasure]
gb|ADK11998.1|  putative actin protein                                  397   4e-135   Salvia miltiorrhiza [Chinese salvia]
gb|ACJ85292.1|  unknown                                                 390   4e-135   Medicago truncatula
ref|XP_003575839.1|  PREDICTED: actin-1-like                            397   4e-135   Brachypodium distachyon [annual false brome]
ref|XP_009146643.1|  PREDICTED: actin-11                                397   4e-135   Brassica rapa
ref|XP_009133195.1|  PREDICTED: actin-1-like                            397   4e-135   Brassica rapa
ref|XP_010520110.1|  PREDICTED: actin-like                              397   4e-135   Tarenaya hassleriana [spider flower]
ref|NP_001130463.1|  putative actin family protein isoform 1            397   4e-135   Zea mays [maize]
gb|KJB76651.1|  hypothetical protein B456_012G100700                    397   4e-135   Gossypium raimondii
ref|XP_009773019.1|  PREDICTED: actin-97                                397   4e-135   Nicotiana sylvestris
gb|AIH15193.1|  actin 1                                                 392   4e-135   Hedychium coronarium
ref|XP_004236747.1|  PREDICTED: actin-97                                397   5e-135   
gb|ACJ04738.1|  actin                                                   397   5e-135   Sedum alfredii
ref|XP_010557948.1|  PREDICTED: actin-1-like                            397   5e-135   Tarenaya hassleriana [spider flower]
gb|KEH24717.1|  actin-97                                                397   5e-135   Medicago truncatula
ref|XP_009587904.1|  PREDICTED: actin-97-like                           397   5e-135   Nicotiana tomentosiformis
ref|XP_008354115.1|  PREDICTED: actin-1                                 397   5e-135   
gb|ABG49392.1|  actin 2                                                 397   5e-135   Torenia fournieri [bluewings]
ref|XP_003602545.1|  Actin                                              397   5e-135   
ref|XP_004302738.1|  PREDICTED: actin                                   396   5e-135   Fragaria vesca subsp. vesca
ref|NP_001239953.1|  uncharacterized protein LOC100798523               396   5e-135   Glycine max [soybeans]
ref|XP_004960554.1|  PREDICTED: actin-97-like                           396   6e-135   Setaria italica
gb|ADJ95345.1|  actin                                                   396   6e-135   Pogonatherum paniceum
ref|XP_007132070.1|  hypothetical protein PHAVU_011G064500g             396   6e-135   Phaseolus vulgaris [French bean]
ref|XP_010685773.1|  PREDICTED: actin-66                                396   6e-135   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003569118.1|  PREDICTED: actin-97                                396   6e-135   
ref|XP_004249866.1|  PREDICTED: actin-7-like                            396   6e-135   
dbj|BAB63635.1|  putative actin                                         396   6e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971370.1|  PREDICTED: actin-7-like isoform X3                 397   6e-135   
ref|XP_002316289.1|  actin family protein                               396   6e-135   Populus trichocarpa [western balsam poplar]
ref|NP_001054419.1|  Os05g0106600                                       396   6e-135   
gb|EEE62039.1|  hypothetical protein OsJ_16821                          397   6e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009599876.1|  PREDICTED: actin-7-like                            396   6e-135   Nicotiana tomentosiformis
gb|ADN88106.1|  actin 1                                                 396   6e-135   Guzmania wittmackii x Guzmania lingulata
ref|XP_011075140.1|  PREDICTED: actin-97                                396   6e-135   Sesamum indicum [beniseed]
ref|XP_003537995.1|  PREDICTED: actin-like isoform X1                   396   6e-135   Glycine max [soybeans]
gb|AFK40690.1|  unknown                                                 396   6e-135   Lotus japonicus
gb|ABA99628.1|  Actin-1, putative, expressed                            396   6e-135   Oryza sativa Japonica Group [Japonica rice]
gb|AHE41423.1|  actin                                                   396   6e-135   Lycium chinense [Chinese boxthorn]
ref|XP_006424815.1|  hypothetical protein CICLE_v10028665mg             396   7e-135   
ref|XP_006858216.1|  hypothetical protein AMTR_s00062p00184900          396   7e-135   Amborella trichopoda
ref|XP_004489182.1|  PREDICTED: actin-like                              396   7e-135   Cicer arietinum [garbanzo]
ref|XP_003539675.1|  PREDICTED: actin-like isoform X1                   396   7e-135   Glycine max [soybeans]
gb|AFZ78526.1|  actin                                                   396   7e-135   Populus tomentosa [Chinese white poplar]
ref|XP_002449040.1|  hypothetical protein SORBIDRAFT_05g003880          396   7e-135   Sorghum bicolor [broomcorn]
gb|KDO72871.1|  hypothetical protein CISIN_1g017125mg                   396   7e-135   Citrus sinensis [apfelsine]
ref|XP_002530711.1|  actin, putative                                    396   7e-135   Ricinus communis
gb|EAY84058.1|  hypothetical protein OsI_39289                          397   7e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_006846523.1|  hypothetical protein AMTR_s00018p00188200          396   7e-135   Amborella trichopoda
ref|XP_002283590.1|  PREDICTED: actin-1                                 396   7e-135   Vitis vinifera
ref|XP_007016432.1|  Actin-11 isoform 1                                 396   7e-135   Theobroma cacao [chocolate]
ref|XP_004978759.1|  PREDICTED: actin-7-like                            396   8e-135   Setaria italica
ref|XP_004235068.1|  PREDICTED: actin-7                                 396   8e-135   
dbj|BAJ85474.1|  predicted protein                                      396   8e-135   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFZ78528.1|  actin                                                   396   8e-135   Populus tomentosa [Chinese white poplar]
ref|NP_001267747.1|  uncharacterized protein LOC101779009               396   8e-135   Setaria italica
ref|NP_001065830.1|  Os11g0163100                                       396   8e-135   
ref|XP_007150869.1|  hypothetical protein PHAVU_004G001000g             396   8e-135   Phaseolus vulgaris [French bean]
dbj|BAD27408.1|  actin                                                  396   8e-135   Nicotiana tabacum [American tobacco]
ref|XP_004971371.1|  PREDICTED: actin-7-like isoform X4                 396   9e-135   Setaria italica
gb|AEY76080.1|  actin                                                   390   9e-135   Petunia integrifolia subsp. inflata
ref|XP_010265918.1|  PREDICTED: actin                                   396   9e-135   Nelumbo nucifera [Indian lotus]
ref|NP_196543.1|  actin 7                                               396   9e-135   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82991.1|AF285176_1  actin                                         396   9e-135   Musa ABB Group [cooking banana]
ref|XP_007204362.1|  hypothetical protein PRUPE_ppa007228mg             396   9e-135   Prunus persica
ref|XP_008385127.1|  PREDICTED: actin                                   396   9e-135   Malus domestica [apple tree]
ref|XP_010936865.1|  PREDICTED: actin                                   396   9e-135   Elaeis guineensis
ref|XP_009353688.1|  PREDICTED: actin                                   396   9e-135   Pyrus x bretschneideri [bai li]
gb|EYU33199.1|  hypothetical protein MIMGU_mgv1a008335mg                396   9e-135   Erythranthe guttata [common monkey flower]
ref|XP_004497894.1|  PREDICTED: actin-like                              396   9e-135   Cicer arietinum [garbanzo]
ref|XP_010937718.1|  PREDICTED: actin-3                                 396   1e-134   Elaeis guineensis
ref|XP_009125344.1|  PREDICTED: actin-7                                 396   1e-134   Brassica rapa
ref|NP_001150248.1|  LOC100283878                                       396   1e-134   Zea mays [maize]
ref|XP_004294508.1|  PREDICTED: actin-1                                 396   1e-134   Fragaria vesca subsp. vesca
ref|XP_002298982.1|  actin family protein                               396   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_010111359.1|  hypothetical protein L484_028016                   396   1e-134   Morus notabilis
ref|XP_006854536.1|  hypothetical protein AMTR_s00030p00045700          396   1e-134   Amborella trichopoda
ref|XP_008355144.1|  PREDICTED: actin                                   396   1e-134   Malus domestica [apple tree]
gb|AEN25580.1|  actin 7                                                 396   1e-134   Brassica rapa subsp. pekinensis [bai cai]
tpg|DAA51049.1|  TPA: putative actin family protein                     396   1e-134   
gb|AEF58501.1|  actin                                                   395   1e-134   Platycodon grandiflorus [balloon-flower]
gb|AAP73458.1|  actin                                                   395   1e-134   Gossypium hirsutum [American cotton]
gb|ABS11262.1|  actin                                                   395   1e-134   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010036489.1|  PREDICTED: actin                                   395   1e-134   Eucalyptus grandis [rose gum]
ref|XP_002308365.1|  actin family protein                               395   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_010909197.1|  PREDICTED: actin-like                              395   1e-134   Elaeis guineensis
gb|ABW71681.1|  actin                                                   395   1e-134   Glycyrrhiza uralensis [Chinese licorice]
gb|ADK20401.1|  actin                                                   395   1e-134   Citrus maxima [buntan]
ref|XP_006287952.1|  hypothetical protein CARUB_v10001188mg             395   1e-134   Capsella rubella
gb|AAT72934.2|  stem cambial region actin protein                       395   1e-134   Eucommia ulmoides
dbj|BAJ96385.1|  predicted protein                                      395   1e-134   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003560589.1|  PREDICTED: actin-1                                 395   1e-134   Brachypodium distachyon [annual false brome]
ref|XP_008241048.1|  PREDICTED: actin                                   395   1e-134   Prunus mume [ume]
gb|AAP73449.1|  actin                                                   395   1e-134   Gossypium hirsutum [American cotton]
emb|CDY56544.1|  BnaA03g55890D                                          395   1e-134   Brassica napus [oilseed rape]
gb|AGN95065.1|  putative actin-7-like protein                           395   1e-134   Physaria fendleri
ref|XP_006348992.1|  PREDICTED: actin-58-like                           395   1e-134   Solanum tuberosum [potatoes]
sp|P30171.1|ACT11_SOLTU  RecName: Full=Actin-97                         395   1e-134   Solanum tuberosum [potatoes]
gb|AAD41039.1|AF112538_1  actin                                         395   1e-134   Malva pusilla
ref|XP_004142070.1|  PREDICTED: actin-like                              395   1e-134   
ref|XP_009406076.1|  PREDICTED: actin-3                                 395   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007028993.1|  Actin-11                                           395   1e-134   
ref|XP_008458880.1|  PREDICTED: actin-82-like isoform X3                397   1e-134   
gb|ACK87035.1|  actin                                                   395   1e-134   Caragana korshinskii
gb|ACJ84552.1|  unknown                                                 395   1e-134   Medicago truncatula
ref|XP_003625265.1|  Actin                                              395   1e-134   Medicago truncatula
gb|AJG03099.1|  actin                                                   395   1e-134   Brassica juncea [brown mustard]
gb|EMS60494.1|  Actin-3                                                 396   1e-134   Triticum urartu
gb|AAK84080.1|AF326781_1  actin                                         388   1e-134   Triticum monococcum [einkorn wheat]
ref|NP_001051086.1|  Os03g0718100                                       395   1e-134   
ref|XP_004304361.1|  PREDICTED: actin-like                              395   1e-134   Fragaria vesca subsp. vesca
gb|KDO53391.1|  hypothetical protein CISIN_1g037845mg                   393   2e-134   Citrus sinensis [apfelsine]
ref|XP_009416898.1|  PREDICTED: actin-3                                 395   2e-134   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS68331.1|  hypothetical protein M569_06438                         395   2e-134   Genlisea aurea
ref|NP_001150462.1|  LOC100284092                                       395   2e-134   Zea mays [maize]
ref|XP_007145688.1|  hypothetical protein PHAVU_007G260000g             395   2e-134   Phaseolus vulgaris [French bean]
ref|XP_011099798.1|  PREDICTED: actin-1-like                            395   2e-134   Sesamum indicum [beniseed]
gb|AEN70754.1|  actin 1                                                 395   2e-134   Gossypium darwinii
ref|XP_004493592.1|  PREDICTED: actin-3-like                            395   2e-134   Cicer arietinum [garbanzo]
ref|XP_010671358.1|  PREDICTED: actin-7-like                            395   2e-134   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004147692.1|  PREDICTED: actin-97-like                           395   2e-134   Cucumis sativus [cucumbers]
ref|XP_007205365.1|  hypothetical protein PRUPE_ppa007214mg             395   2e-134   Prunus persica
dbj|BAK57343.1|  actin1                                                 395   2e-134   Morella rubra [Chinese arbutus]
gb|AJG03097.1|  beta-actin 1                                            395   2e-134   
sp|P46258.1|ACT3_PEA  RecName: Full=Actin-3                             395   2e-134   
ref|XP_004142758.1|  PREDICTED: actin-1-like                            395   2e-134   
gb|AAB18641.1|  actin                                                   395   2e-134   
gb|ACJ04737.1|  actin                                                   395   2e-134   
gb|AIY25484.1|  actin isoform 3-1                                       395   2e-134   
gb|ADV91594.1|  actin                                                   395   2e-134   
ref|XP_006429073.1|  hypothetical protein CICLE_v10011973mg             395   2e-134   
gb|AFJ04513.1|  actin7a                                                 394   2e-134   
ref|XP_002279672.1|  PREDICTED: actin-66                                395   2e-134   
gb|KDP44962.1|  hypothetical protein JCGZ_01462                         395   2e-134   
ref|XP_006379593.1|  actin family protein                               395   2e-134   
gb|ACZ04921.1|  actin 7-like protein                                    395   2e-134   
ref|XP_009390755.1|  PREDICTED: actin-7                                 395   2e-134   
ref|XP_011029076.1|  PREDICTED: actin-97-like                           395   3e-134   
dbj|BAL27711.1|  actin like 1                                           395   3e-134   
ref|XP_004309498.1|  PREDICTED: actin-7-like                            395   3e-134   
gb|KHN13906.1|  Actin-11                                                395   3e-134   
gb|AFM38980.1|  actin                                                   395   3e-134   
ref|XP_004307518.1|  PREDICTED: actin-97-like                           395   3e-134   
gb|AGZ90151.1|  actin 7                                                 395   3e-134   
ref|XP_007218136.1|  hypothetical protein PRUPE_ppa007236mg             395   3e-134   
emb|CDY08455.1|  BnaA05g26910D                                          394   3e-134   
gb|AAQ74875.1|  actin                                                   394   3e-134   
gb|ADL59374.2|  actin 4                                                 394   3e-134   
ref|NP_001276160.1|  actin-11-like                                      394   3e-134   
ref|XP_003622019.1|  Actin                                              394   3e-134   
ref|XP_004492148.1|  PREDICTED: actin-11-like                           394   3e-134   
ref|XP_003574188.1|  PREDICTED: actin-2                                 394   3e-134   
gb|AFK41203.1|  unknown                                                 394   3e-134   
ref|XP_009407474.1|  PREDICTED: actin-7-like                            394   3e-134   
gb|ADP09679.1|  actin isoform PEAc14-1                                  394   3e-134   
ref|XP_003553313.1|  PREDICTED: actin-like                              394   3e-134   
ref|XP_011074742.1|  PREDICTED: actin-104                               394   3e-134   
ref|XP_007150318.1|  hypothetical protein PHAVU_005G143500g             394   3e-134   
ref|XP_003523242.1|  PREDICTED: actin-7-like isoform X1                 394   3e-134   
gb|AFB83349.1|  actin 2                                                 394   4e-134   
gb|KEH39427.1|  actin-97                                                394   4e-134   
ref|XP_010027698.1|  PREDICTED: actin-7                                 394   4e-134   
ref|XP_009413409.1|  PREDICTED: actin-7                                 394   4e-134   
ref|XP_004487013.1|  PREDICTED: actin-like                              394   4e-134   
ref|XP_007205366.1|  hypothetical protein PRUPE_ppa007219mg             394   4e-134   
ref|XP_008787899.1|  PREDICTED: actin-like                              394   4e-134   
gb|AFK35945.1|  unknown                                                 394   4e-134   
gb|AHE76167.1|  actin                                                   394   4e-134   
dbj|BAA89214.1|  actin isoform B                                        394   4e-134   
ref|XP_008795328.1|  PREDICTED: actin-1                                 394   4e-134   
gb|ACP19072.1|  actin 1                                                 394   4e-134   
ref|XP_009759480.1|  PREDICTED: actin-101                               394   4e-134   
ref|NP_001291342.1|  uncharacterized protein LOC105159390               394   4e-134   
ref|XP_004136568.1|  PREDICTED: actin-like                              394   4e-134   
gb|AAF03692.1|AF172094_1  actin                                         394   4e-134   
sp|P53504.1|ACT1_SORBI  RecName: Full=Actin-1                           394   4e-134   
gb|AAP73457.1|  actin                                                   394   4e-134   
gb|AHB86961.1|  actin-2                                                 394   4e-134   
ref|XP_003578869.1|  PREDICTED: actin-3-like                            394   4e-134   
ref|XP_011089811.1|  PREDICTED: actin-like                              394   4e-134   
ref|XP_009341422.1|  PREDICTED: actin-like                              394   4e-134   
ref|XP_008781400.1|  PREDICTED: actin-101-like                          394   4e-134   
ref|XP_010106464.1|  hypothetical protein L484_025221                   394   4e-134   
gb|AFU06383.1|  actin                                                   394   4e-134   
gb|AEM89276.1|  actin                                                   394   4e-134   
ref|XP_004173826.1|  PREDICTED: actin-7-like                            394   4e-134   
ref|XP_009131124.1|  PREDICTED: actin-7-like                            394   5e-134   
ref|NP_001289215.1|  actin-7                                            394   5e-134   
gb|ADA70361.1|  actin                                                   394   5e-134   
gb|ACB88021.1|  actin                                                   394   5e-134   
ref|XP_010546369.1|  PREDICTED: actin-7                                 394   5e-134   
gb|ADU52547.1|  actin 1                                                 394   5e-134   
ref|XP_011077464.1|  PREDICTED: actin-like                              394   5e-134   
ref|XP_006427855.1|  hypothetical protein CICLE_v10025866mg             394   5e-134   
ref|XP_004147353.1|  PREDICTED: actin-7-like                            394   5e-134   
gb|AFO65511.1|  actin 2                                                 394   5e-134   
ref|XP_010912406.1|  PREDICTED: actin-101-like                          394   5e-134   
gb|ABR45727.1|  ACT1                                                    394   5e-134   
gb|AAR15174.1|  actin                                                   394   5e-134   
ref|XP_010251047.1|  PREDICTED: actin-3                                 394   5e-134   
gb|AEO45961.1|  actin 1                                                 394   5e-134   
gb|ADV17460.1|  actin                                                   394   5e-134   
ref|XP_010520298.1|  PREDICTED: actin-7                                 394   5e-134   
ref|XP_009373687.1|  PREDICTED: actin-7-like                            394   5e-134   
ref|XP_008794560.1|  PREDICTED: actin-101-like                          394   5e-134   
ref|XP_007162325.1|  hypothetical protein PHAVU_001G142500g             394   5e-134   
ref|XP_010260924.1|  PREDICTED: actin-101-like                          394   6e-134   
gb|AEN70759.1|  actin 1                                                 394   6e-134   
gb|AGV75927.1|  actin                                                   394   6e-134   
ref|XP_002298710.1|  actin family protein                               394   6e-134   
ref|XP_002265476.1|  PREDICTED: actin-101                               394   6e-134   
gb|AFW82899.1|  LOW QUALITY PROTEIN: putative actin family protein      396   6e-134   
ref|XP_009412537.1|  PREDICTED: actin-3-like                            394   6e-134   
ref|NP_001265886.1|  uncharacterized protein LOC101509901               394   6e-134   
ref|XP_008776351.1|  PREDICTED: actin-101                               394   6e-134   
ref|NP_001239660.1|  uncharacterized protein LOC100781831               394   6e-134   
gb|AFP44112.1|  actin                                                   394   6e-134   
ref|XP_003547359.1|  PREDICTED: actin-like isoform X1                   394   6e-134   
ref|XP_006595018.1|  PREDICTED: actin-like isoform X1                   394   6e-134   
ref|NP_001241178.1|  uncharacterized protein LOC100807341               394   6e-134   
ref|XP_008809027.1|  PREDICTED: actin-2                                 394   6e-134   
ref|XP_006432485.1|  hypothetical protein CICLE_v10001518mg             394   6e-134   
ref|XP_003521216.1|  PREDICTED: actin-3-like isoform X1                 394   6e-134   
ref|XP_006371012.1|  hypothetical protein POPTR_0019s02630g             394   6e-134   
ref|XP_008788993.1|  PREDICTED: actin-101-like                          394   6e-134   
ref|XP_011075141.1|  PREDICTED: actin-97-like                           394   7e-134   
gb|ACJ38662.1|  actin                                                   394   7e-134   
gb|ADV72541.1|  actin 7b                                                394   7e-134   
gb|ABR17342.1|  unknown                                                 394   7e-134   
ref|XP_008798327.1|  PREDICTED: actin                                   394   7e-134   
gb|ACP19073.1|  actin 2                                                 394   7e-134   
ref|XP_006429882.1|  hypothetical protein CICLE_v10011974mg             394   7e-134   
ref|XP_010671378.1|  PREDICTED: actin-7                                 394   7e-134   
ref|XP_004306592.1|  PREDICTED: actin-7                                 394   7e-134   
gb|AAN40685.1|  actin                                                   394   7e-134   
gb|AAP73459.1|  actin                                                   394   8e-134   
gb|AGK27782.1|  actin 7                                                 389   8e-134   
ref|XP_008785821.1|  PREDICTED: actin-3-like                            393   8e-134   
gb|AFK42711.1|  unknown                                                 393   9e-134   
ref|XP_009409006.1|  PREDICTED: actin-101-like                          393   9e-134   
gb|AFD62269.1|  actin 2                                                 393   9e-134   
ref|XP_008654246.1|  PREDICTED: putative actin family protein iso...    393   9e-134   
gb|AHA84238.1|  actin                                                   393   9e-134   
gb|EYU43487.1|  hypothetical protein MIMGU_mgv1a008318mg                393   9e-134   
ref|XP_009420081.1|  PREDICTED: actin-2                                 393   1e-133   
ref|XP_006349510.1|  PREDICTED: actin-like                              393   1e-133   
emb|CBI37599.3|  unnamed protein product                                394   1e-133   
ref|XP_009631892.1|  PREDICTED: actin-101                               393   1e-133   
gb|ADW83713.1|  actin 1                                                 393   1e-133   
gb|ADQ42773.2|  actin                                                   393   1e-133   
gb|EAY82369.1|  hypothetical protein OsI_37581                          393   1e-133   
ref|XP_009388633.1|  PREDICTED: actin-101                               393   1e-133   
ref|XP_004249597.1|  PREDICTED: actin-75                                393   1e-133   
gb|AEN70747.1|  actin 1                                                 393   1e-133   
gb|AAP73451.1|  actin                                                   393   1e-133   
ref|XP_008239281.1|  PREDICTED: actin-7-like                            393   1e-133   
ref|XP_007209248.1|  hypothetical protein PRUPE_ppa007211mg             393   1e-133   
emb|CDP11386.1|  unnamed protein product                                393   1e-133   
ref|XP_002282516.1|  PREDICTED: actin-7                                 393   1e-133   
gb|AAP73450.1|  actin                                                   393   1e-133   
gb|AEZ51866.1|  actin                                                   393   1e-133   
gb|EPS67367.1|  hypothetical protein M569_07407                         393   1e-133   
gb|AGT96517.1|  actin                                                   389   1e-133   
ref|XP_008346992.1|  PREDICTED: actin-7                                 393   1e-133   
gb|ADU05553.1|  actin                                                   392   1e-133   
ref|XP_008793942.1|  PREDICTED: actin-2-like                            393   2e-133   
gb|KJB75201.1|  hypothetical protein B456_012G030500                    392   2e-133   
ref|XP_010927382.1|  PREDICTED: actin-2                                 393   2e-133   
ref|XP_009594162.1|  PREDICTED: actin-104                               393   2e-133   
ref|NP_001146931.1|  actin-2                                            393   2e-133   
dbj|BAJ85914.1|  predicted protein                                      392   2e-133   
ref|XP_002283939.1|  PREDICTED: actin                                   392   2e-133   
ref|XP_010922415.1|  PREDICTED: actin-101-like isoform X1               392   2e-133   
ref|XP_009787561.1|  PREDICTED: actin-104                               392   2e-133   
emb|CAA33874.1|  actin                                                  392   2e-133   
ref|XP_002466956.1|  hypothetical protein SORBIDRAFT_01g017380          392   2e-133   
ref|NP_001266023.1|  uncharacterized protein LOC101503086               392   2e-133   
gb|ADH82414.1|  actin                                                   392   2e-133   
ref|XP_010932520.1|  PREDICTED: actin-like                              392   2e-133   
gb|AGI15325.1|  actin 1                                                 392   2e-133   
emb|CDP09045.1|  unnamed protein product                                392   2e-133   
ref|XP_009617508.1|  PREDICTED: actin-75                                392   2e-133   
ref|NP_001065034.1|  Os10g0510000                                       392   2e-133   
ref|NP_001167929.1|  putative actin family protein                      392   2e-133   
ref|XP_007041602.1|  Actin 7 isoform 2                                  390   2e-133   
ref|XP_010933731.1|  PREDICTED: actin-101-like                          392   2e-133   
ref|XP_010905701.1|  PREDICTED: actin-101-like                          392   2e-133   
gb|AGV75926.1|  actin                                                   392   2e-133   
gb|ACN54541.1|  actin                                                   392   2e-133   
gb|ADY68784.1|  actin                                                   392   2e-133   
ref|XP_011094851.1|  PREDICTED: actin-4                                 392   2e-133   
gb|AIC33035.1|  actin 1                                                 392   3e-133   
ref|XP_001782688.1|  predicted protein                                  392   3e-133   
gb|AAP73462.1|  actin                                                   392   3e-133   
gb|AAP73454.1|  actin                                                   392   3e-133   
gb|AAF31643.1|AF143208_1  actin                                         392   3e-133   
ref|XP_009417581.1|  PREDICTED: actin-2-like                            392   3e-133   
ref|XP_006661942.1|  PREDICTED: actin-2-like isoform X1                 392   3e-133   
gb|ADX97326.1|  actin 9                                                 392   3e-133   
ref|XP_008788057.1|  PREDICTED: actin-3-like                            392   3e-133   
ref|XP_009768295.1|  PREDICTED: actin-75                                392   3e-133   
gb|KHF99045.1|  Actin-7 -like protein                                   392   3e-133   
gb|AGA17037.1|  actin                                                   392   3e-133   
gb|AAF71265.1|AF246715_1  actin-like protein                            392   3e-133   
gb|AIZ68149.1|  actin-2                                                 392   3e-133   
gb|AGV54465.1|  actin-3-like protein                                    392   4e-133   
gb|AGK63075.1|  actin 1                                                 392   4e-133   
emb|CAN69147.1|  hypothetical protein VITISV_023982                     392   4e-133   
gb|ABG49391.1|  actin 1                                                 391   4e-133   
gb|ACL97684.1|  actin 1                                                 392   4e-133   
gb|AGR45356.1|  actin                                                   392   4e-133   
ref|XP_009383456.1|  PREDICTED: actin-7-like                            392   4e-133   
ref|XP_011004375.1|  PREDICTED: actin-7-like isoform X1                 392   5e-133   
ref|XP_009608442.1|  PREDICTED: actin-71                                391   5e-133   
gb|AAP73460.1|  actin                                                   391   5e-133   
ref|XP_006351818.1|  PREDICTED: actin-101-like                          391   5e-133   
ref|XP_004136855.1|  PREDICTED: actin-like                              391   5e-133   
ref|XP_008455254.1|  PREDICTED: actin-7-like                            391   5e-133   
ref|XP_009360248.1|  PREDICTED: actin-7-like                            391   5e-133   
ref|XP_009772796.1|  PREDICTED: actin-71                                391   5e-133   
ref|XP_004230564.1|  PREDICTED: actin-101                               391   5e-133   
ref|XP_008810321.1|  PREDICTED: actin-2-like                            391   6e-133   
gb|AAD03741.1|  actin                                                   391   6e-133   
ref|XP_002977012.1|  hypothetical protein SELMODRAFT_175956             391   7e-133   
ref|XP_010053990.1|  PREDICTED: actin-7-like                            391   7e-133   
ref|XP_007048253.1|  Actin 7 isoform 1                                  396   7e-133   
gb|AGA63729.1|  actin                                                   391   8e-133   
ref|XP_006341033.1|  PREDICTED: actin-71-like                           391   8e-133   
gb|ACT98686.1|  actin                                                   391   8e-133   
gb|AAF40438.1|AF234528_2  actin 1                                       391   8e-133   
gb|AFK39354.1|  unknown                                                 391   8e-133   
gb|ABG49457.2|  actin 1                                                 391   8e-133   
gb|KHG17291.1|  hypothetical protein F383_20779                         390   1e-132   
ref|XP_001783657.1|  predicted protein                                  390   1e-132   
gb|AIZ68150.1|  Actin 7 isoform 1                                       390   1e-132   
gb|AEB71791.1|  actin                                                   389   1e-132   
gb|AFZ78529.1|  actin                                                   385   1e-132   
gb|ADV04491.1|  beta-actin                                              390   1e-132   
gb|AAP73452.1|  actin                                                   390   1e-132   
gb|ADZ76112.1|  actin                                                   388   1e-132   
gb|ABV59397.1|  actin                                                   390   1e-132   
gb|AAW63030.1|  actin                                                   390   1e-132   
ref|XP_001783901.1|  predicted protein                                  390   2e-132   
gb|AHZ58479.1|  actin                                                   390   2e-132   



>ref|XP_010446199.1| PREDICTED: actin-85C [Camelina sativa]
Length=287

 Score =   401 bits (1030),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009409104.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_010690498.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690505.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   402 bits (1034),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|ABY19575.1| actin [Ipomoea batatas]
Length=241

 Score =   397 bits (1020),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|EYU20691.1| hypothetical protein MIMGU_mgv1a008334mg [Erythranthe guttata]
 gb|EYU20692.1| hypothetical protein MIMGU_mgv1a008334mg [Erythranthe guttata]
Length=377

 Score =   402 bits (1033),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>emb|CDP00088.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   401 bits (1031),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009388742.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009388743.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   401 bits (1031),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>ref|XP_004239790.1| PREDICTED: actin-58 [Solanum lycopersicum]
Length=377

 Score =   401 bits (1031),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_006345961.1| PREDICTED: actin-58-like [Solanum tuberosum]
Length=377

 Score =   401 bits (1031),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KDO67622.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67623.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67624.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
Length=377

 Score =   401 bits (1030),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009621805.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009780859.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009780860.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   401 bits (1030),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009397437.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009397438.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   401 bits (1030),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGED+QPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>ref|XP_010520278.1| PREDICTED: actin-like [Tarenaya hassleriana]
Length=377

 Score =   401 bits (1030),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_006351346.1| PREDICTED: actin-58-like [Solanum tuberosum]
 ref|XP_010312150.1| PREDICTED: actin-66 [Solanum lycopersicum]
 ref|XP_010312151.1| PREDICTED: actin-66 [Solanum lycopersicum]
Length=377

 Score =   401 bits (1030),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|AAO42312.1| putative actin 4 [Arabidopsis thaliana]
Length=377

 Score =   401 bits (1030),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KJB73913.1| hypothetical protein B456_011G260600 [Gossypium raimondii]
Length=358

 Score =   400 bits (1028),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>gb|KHG29096.1| Actin [Gossypium arboreum]
Length=377

 Score =   401 bits (1030),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KJB16973.1| hypothetical protein B456_002G257900 [Gossypium raimondii]
Length=377

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KHF98170.1| Actin [Gossypium arboreum]
 gb|KJB78841.1| hypothetical protein B456_013G022400 [Gossypium raimondii]
 gb|KJB78842.1| hypothetical protein B456_013G022400 [Gossypium raimondii]
 gb|KJB78843.1| hypothetical protein B456_013G022400 [Gossypium raimondii]
Length=377

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR+
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRI  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>ref|XP_006400969.1| hypothetical protein EUTSA_v10013840mg [Eutrema salsugineum]
 gb|ESQ42422.1| hypothetical protein EUTSA_v10013840mg [Eutrema salsugineum]
Length=377

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KJB76087.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=365

 Score =   400 bits (1028),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|NP_200745.1| actin 4 [Arabidopsis thaliana]
 ref|NP_001078769.1| actin 4 [Arabidopsis thaliana]
 sp|P53494.1|ACT4_ARATH RecName: Full=Actin-4 [Arabidopsis thaliana]
 gb|AAB39403.1| actin-4 [Arabidopsis thaliana]
 dbj|BAA97473.1| actin 4 [Arabidopsis thaliana]
 gb|AED97176.1| actin 4 [Arabidopsis thaliana]
 gb|AED97177.1| actin 4 [Arabidopsis thaliana]
Length=377

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_006418890.1| hypothetical protein EUTSA_v10002572mg [Eutrema salsugineum]
 gb|ESQ37326.1| hypothetical protein EUTSA_v10002572mg [Eutrema salsugineum]
Length=377

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_006282193.1| hypothetical protein CARUB_v10028459mg [Capsella rubella]
 gb|EOA15091.1| hypothetical protein CARUB_v10028459mg [Capsella rubella]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009150245.1| PREDICTED: actin-12 [Brassica rapa]
 emb|CDY21777.1| BnaA06g20460D [Brassica napus]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|NP_190236.1| actin-12 [Arabidopsis thaliana]
 ref|XP_002864629.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002875788.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006291307.1| hypothetical protein CARUB_v10017441mg [Capsella rubella]
 ref|XP_010503262.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010514974.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010426084.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010483556.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010483559.1| PREDICTED: actin-12 [Camelina sativa]
 ref|XP_010483560.1| PREDICTED: actin-12 [Camelina sativa]
 sp|P53497.1|ACT12_ARATH RecName: Full=Actin-12 [Arabidopsis thaliana]
 gb|AAB39405.1| actin-12 [Arabidopsis thaliana]
 emb|CAB62322.1| actin 12 [Arabidopsis thaliana]
 gb|AAO41897.1| putative actin 12 [Arabidopsis thaliana]
 gb|AAO50606.1| putative actin 12 [Arabidopsis thaliana]
 gb|EFH40888.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52047.1| actin-12 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE78168.1| actin-12 [Arabidopsis thaliana]
 gb|EOA24205.1| hypothetical protein CARUB_v10017441mg [Capsella rubella]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009150339.1| PREDICTED: actin-12-like [Brassica rapa]
 ref|XP_009150340.1| PREDICTED: actin-12-like [Brassica rapa]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>emb|CDY38066.1| BnaC03g75050D [Brassica napus]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>emb|CDY30846.1| BnaC04g27010D [Brassica napus]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AET50987.1| actin [Lactuca sativa]
Length=288

 Score =   397 bits (1019),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADSEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KHG03218.1| Actin [Gossypium arboreum]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>gb|AAC49652.1| actin [Striga asiatica]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>emb|CDX82985.1| BnaA01g19850D [Brassica napus]
Length=377

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>pir||T45915 actin (ACT3) - Arabidopsis thaliana
 emb|CAB88337.1| actin (ACT3) [Arabidopsis thaliana]
Length=427

 Score =   402 bits (1032),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AIR74902.1| beta-actin [Mentha spicata]
Length=377

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KJB76085.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76086.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76089.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
 gb|KJB76090.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=377

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|KHG21354.1| Actin-7 -like protein [Gossypium arboreum]
Length=277

 Score =   396 bits (1017),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KHF99778.1| Actin [Gossypium arboreum]
 gb|KJB83781.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
 gb|KJB83782.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
 gb|KJB83783.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
 gb|KJB83784.1| hypothetical protein B456_013G264100 [Gossypium raimondii]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_009802880.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009802881.1| PREDICTED: actin-like [Nicotiana sylvestris]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009625006.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009625007.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>emb|CDY53444.1| BnaA02g07080D [Brassica napus]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|EPS69959.1| actin [Genlisea aurea]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE +DIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEADDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>sp|Q05214.1|ACT1_TOBAC RecName: Full=Actin [Nicotiana tabacum]
 emb|CAA45149.1| actin [Nicotiana tabacum]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|AAC49651.1| actin [Striga asiatica]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KHG18648.1| Actin-58 [Gossypium arboreum]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_009773924.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009773925.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>sp|O81221.1|ACT_GOSHI RecName: Full=Actin [Gossypium hirsutum]
 gb|AAC31886.1| actin [Gossypium hirsutum]
 gb|KHG26781.1| Actin [Gossypium arboreum]
 gb|KJB21624.1| hypothetical protein B456_004G004900 [Gossypium raimondii]
Length=377

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_009618901.1| PREDICTED: actin [Nicotiana tomentosiformis]
 ref|XP_009618902.1| PREDICTED: actin [Nicotiana tomentosiformis]
Length=377

 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KJB73912.1| hypothetical protein B456_011G260600 [Gossypium raimondii]
 gb|KJB73914.1| hypothetical protein B456_011G260600 [Gossypium raimondii]
Length=377

 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>gb|ACH69153.1| actin [Nicotiana tabacum]
Length=377

 Score =   399 bits (1026),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_007009347.1| Actin-11 isoform 2 [Theobroma cacao]
 gb|EOY18157.1| Actin-11 isoform 2 [Theobroma cacao]
Length=380

 Score =   400 bits (1027),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>dbj|BAK06400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KJB36724.1| hypothetical protein B456_006G173100 [Gossypium raimondii]
Length=377

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KHG29811.1| Actin [Gossypium arboreum]
 gb|KJB07135.1| hypothetical protein B456_001G110400 [Gossypium raimondii]
Length=377

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KHG15514.1| Actin [Gossypium arboreum]
Length=377

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_002876223.1| hypothetical protein ARALYDRAFT_323914 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52482.1| hypothetical protein ARALYDRAFT_323914 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   401 bits (1030),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KDP24628.1| hypothetical protein JCGZ_25544 [Jatropha curcas]
Length=377

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010257475.1| PREDICTED: actin [Nelumbo nucifera]
 ref|XP_010257476.1| PREDICTED: actin [Nelumbo nucifera]
Length=377

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/192 (99%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>sp|P30167.1|ACT3_SOLTU RecName: Full=Actin-58 [Solanum tuberosum]
 emb|CAA39278.1| actin [Solanum tuberosum]
Length=377

 Score =   399 bits (1026),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFP IVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPRIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009787806.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009787807.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009787808.1| PREDICTED: actin-like [Nicotiana sylvestris]
Length=377

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_008382817.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_007009346.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY18156.1| Actin-11 isoform 1 [Theobroma cacao]
Length=377

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_004250955.1| PREDICTED: actin-97-like [Solanum lycopersicum]
Length=377

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGIL+LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILSLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009381010.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTF+NELRV PEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFFNELRVVPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>emb|CAJ44725.1| actin [Capsicum chinense]
Length=291

 Score =   396 bits (1017),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            +A+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    LADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_010030965.1| PREDICTED: actin [Eucalyptus grandis]
 gb|KCW50207.1| hypothetical protein EUGRSUZ_J00015 [Eucalyptus grandis]
 gb|KCW50208.1| hypothetical protein EUGRSUZ_J00015 [Eucalyptus grandis]
Length=377

 Score =   399 bits (1025),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009600120.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
Length=377

 Score =   399 bits (1025),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_002879687.1| hypothetical protein ARALYDRAFT_321465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55946.1| hypothetical protein ARALYDRAFT_321465 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   399 bits (1024),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|EPS69960.1| actin-97 [Genlisea aurea]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|AAM65657.1| actin 4 [Arabidopsis thaliana]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGI LDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIFLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_010534357.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
 ref|XP_010534358.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|NP_566988.1| actin 3 [Arabidopsis thaliana]
 ref|NP_850284.1| actin 1 [Arabidopsis thaliana]
 ref|NP_001031504.1| actin 1 [Arabidopsis thaliana]
 ref|XP_004253296.1| PREDICTED: actin-1 [Solanum lycopersicum]
 sp|P0CJ46.1|ACT1_ARATH RecName: Full=Actin-1 [Arabidopsis thaliana]
 sp|P0CJ47.1|ACT3_ARATH RecName: Full=Actin-3 [Arabidopsis thaliana]
 gb|AAA98562.1| actin 3 [Arabidopsis thaliana]
 gb|AAK83635.1| AT3g53750/F5K20_50 [Arabidopsis thaliana]
 gb|AAL75893.1| At2g37620/F13M22.12 [Arabidopsis thaliana]
 gb|AAM10400.1| At2g37620/F13M22.12 [Arabidopsis thaliana]
 gb|AAM63620.1| actin (ACT3) [Arabidopsis thaliana]
 gb|AAN72268.1| At3g53750/F5K20_50 [Arabidopsis thaliana]
 gb|AEC09426.1| actin 1 [Arabidopsis thaliana]
 gb|AEC09427.1| actin 1 [Arabidopsis thaliana]
 gb|AEE79138.1| actin 3 [Arabidopsis thaliana]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_006350765.1| PREDICTED: actin-like [Solanum tuberosum]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_002879684.1| hypothetical protein ARALYDRAFT_321462 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006291303.1| hypothetical protein CARUB_v10017439mg [Capsella rubella]
 ref|XP_006294425.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 ref|XP_006294426.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 ref|XP_006403657.1| hypothetical protein EUTSA_v10010455mg [Eutrema salsugineum]
 ref|XP_006410952.1| hypothetical protein EUTSA_v10016809mg [Eutrema salsugineum]
 ref|XP_010504145.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010505356.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010509299.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010515877.1| PREDICTED: actin-1 [Camelina sativa]
 ref|XP_010517034.1| PREDICTED: actin-1 [Camelina sativa]
 gb|EFH55943.1| hypothetical protein ARALYDRAFT_321462 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA24201.1| hypothetical protein CARUB_v10017439mg [Capsella rubella]
 gb|EOA27323.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 gb|EOA27324.1| hypothetical protein CARUB_v10023442mg [Capsella rubella]
 gb|ESQ45110.1| hypothetical protein EUTSA_v10010455mg [Eutrema salsugineum]
 gb|ESQ52405.1| hypothetical protein EUTSA_v10016809mg [Eutrema salsugineum]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010454923.1| PREDICTED: actin-12-like [Camelina sativa]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_004241231.1| PREDICTED: actin-82 [Solanum lycopersicum]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|AAA32727.1| actin-1 [Arabidopsis thaliana]
 gb|AAA98561.1| actin 1 [Arabidopsis thaliana]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_006435988.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 ref|XP_006435989.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 ref|XP_006486101.1| PREDICTED: actin-like isoform X1 [Citrus sinensis]
 ref|XP_006486102.1| PREDICTED: actin-like isoform X2 [Citrus sinensis]
 gb|ESR49228.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
 gb|ESR49229.1| hypothetical protein CICLE_v10031847mg [Citrus clementina]
Length=377

 Score =   399 bits (1024),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>gb|KHG20063.1| Actin-7 -like protein [Gossypium arboreum]
Length=222

 Score =   392 bits (1008),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010541399.1| PREDICTED: actin-12-like [Tarenaya hassleriana]
 ref|XP_010541400.1| PREDICTED: actin-12-like [Tarenaya hassleriana]
Length=377

 Score =   399 bits (1024),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_011078821.1| PREDICTED: actin [Sesamum indicum]
 ref|XP_011078822.1| PREDICTED: actin [Sesamum indicum]
Length=377

 Score =   399 bits (1024),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009139296.1| PREDICTED: actin-1 [Brassica rapa]
 ref|XP_009139297.1| PREDICTED: actin-1 [Brassica rapa]
 emb|CDX76191.1| BnaA04g04550D [Brassica napus]
Length=377

 Score =   399 bits (1024),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|EEC78366.1| hypothetical protein OsI_18129 [Oryza sativa Indica Group]
Length=372

 Score =   398 bits (1023),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 189/197 (96%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = +3

Query  87   KAH*KMAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAY  266
            K + +MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAY
Sbjct  53   KNYKEMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAY  112

Query  267  VGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK  446
            VGDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK
Sbjct  113  VGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK  172

Query  447  ANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH  626
            ANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH
Sbjct  173  ANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH  232

Query  627  AILRLDLAGRDLTDHLM  677
            AILRLDLAGRDLTD LM
Sbjct  233  AILRLDLAGRDLTDSLM  249



>ref|XP_009131999.1| PREDICTED: actin-12-like [Brassica rapa]
 ref|XP_009149973.1| PREDICTED: actin-12-like [Brassica rapa]
 ref|XP_009120445.1| PREDICTED: actin-12 [Brassica rapa]
 emb|CDX99111.1| BnaA06g18020D [Brassica napus]
 emb|CDX88698.1| BnaA03g09510D [Brassica napus]
 emb|CDX86081.1| BnaC03g55960D [Brassica napus]
 emb|CDX71119.1| BnaC03g12030D [Brassica napus]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_011091473.1| PREDICTED: actin-11 [Sesamum indicum]
 ref|XP_011091474.1| PREDICTED: actin-11 [Sesamum indicum]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY+LPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYSLPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_009801998.1| PREDICTED: actin-97-like [Nicotiana sylvestris]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|KJB20092.1| hypothetical protein B456_003G132400 [Gossypium raimondii]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010535499.1| PREDICTED: actin-11 [Tarenaya hassleriana]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_009591335.1| PREDICTED: actin-97 [Nicotiana tomentosiformis]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|EPS60057.1| hypothetical protein M569_14747 [Genlisea aurea]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY+LPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYSLPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>emb|CDP10143.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009116071.1| PREDICTED: actin-1-like [Brassica rapa]
 ref|XP_009116072.1| PREDICTED: actin-1-like [Brassica rapa]
 ref|XP_009116073.1| PREDICTED: actin-1-like [Brassica rapa]
 emb|CDX78202.1| BnaA09g33970D [Brassica napus]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_002463566.1| hypothetical protein SORBIDRAFT_01g002170 [Sorghum bicolor]
 gb|EER90564.1| hypothetical protein SORBIDRAFT_01g002170 [Sorghum bicolor]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDCLM  192



>gb|ADY38689.1| actin [Camellia sinensis]
Length=377

 Score =   398 bits (1023),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>emb|CDP06619.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   398 bits (1022),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|ADU52545.1| actin 2 [Morus alba]
Length=377

 Score =   398 bits (1022),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_011080749.1| PREDICTED: actin-1-like [Sesamum indicum]
 ref|XP_011101608.1| PREDICTED: actin-1-like [Sesamum indicum]
Length=377

 Score =   398 bits (1022),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY+LPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYSLPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|AEO45960.1| actin 4 [Mangifera indica]
Length=377

 Score =   398 bits (1022),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|NP_001141313.1| uncharacterized protein LOC100273404 [Zea mays]
 gb|ACF86054.1| unknown [Zea mays]
 tpg|DAA52366.1| TPA: putative actin family protein [Zea mays]
Length=377

 Score =   398 bits (1022),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDCLM  192



>gb|KJB76088.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=434

 Score =   400 bits (1027),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|ADX97327.1| actin 7 [Mangifera indica]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|ADU52548.1| actin 2 [Morus alba]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_003533915.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006587210.1| PREDICTED: actin-like isoform X2 [Glycine max]
 ref|XP_006587211.1| PREDICTED: actin-like isoform X3 [Glycine max]
 gb|KHN31754.1| Actin [Glycine soja]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_009381444.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010111138.1| hypothetical protein L484_010751 [Morus notabilis]
 gb|AGT97389.1| actin [Morus alba]
 gb|EXC30503.1| hypothetical protein L484_010751 [Morus notabilis]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|EMT00396.1| Actin-3 [Aegilops tauschii]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|ABI14668.1| actin [Aegiceras corniculatum]
Length=292

 Score =   394 bits (1013),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFE FNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFEAFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|NP_001159156.1| putative actin family protein [Zea mays]
 gb|ACN25249.1| unknown [Zea mays]
 tpg|DAA39086.1| TPA: putative actin family protein [Zea mays]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_009403146.1| PREDICTED: actin [Musa acuminata subsp. malaccensis]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KGN54250.1| hypothetical protein Csa_4G296030 [Cucumis sativus]
Length=321

 Score =   395 bits (1016),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADNEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_009410069.1| PREDICTED: actin [Musa acuminata subsp. malaccensis]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010682856.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010682857.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD++M
Sbjct  181  DLAGRDLTDYMM  192



>ref|XP_007027035.1| Actin 3 [Theobroma cacao]
 gb|EOY07537.1| Actin 3 [Theobroma cacao]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KJB76649.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=372

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAENEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_003519037.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006575208.1| PREDICTED: actin-like isoform X2 [Glycine max]
 ref|XP_006575209.1| PREDICTED: actin-like isoform X3 [Glycine max]
 gb|KHN02619.1| Actin [Glycine soja]
Length=377

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_004981971.1| PREDICTED: actin-1-like isoform X2 [Setaria italica]
Length=382

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 191/193 (99%), Gaps = 0/193 (0%)
 Frame = +3

Query  99   KMAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  278
            KMA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE
Sbjct  5    KMADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  64

Query  279  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  458
            AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct  65   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  124

Query  459  KMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  638
            KMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR
Sbjct  125  KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  184

Query  639  LDLAGRDLTDHLM  677
            LDLAGRDLTD+LM
Sbjct  185  LDLAGRDLTDYLM  197



>gb|AGZ90152.1| actin 11, partial [Litsea cubeba]
Length=377

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AFN53639.1| putative actin-97 protein [Linum usitatissimum]
Length=377

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AFW82911.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW82912.1| putative actin family protein isoform 2 [Zea mays]
Length=378

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|AIS84126.1| actin, partial [Fraxinus mandshurica]
Length=201

 Score =   391 bits (1004),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>dbj|BAL14664.1| actin [Chrysanthemum seticuspe f. boreale]
Length=377

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_003562930.1| PREDICTED: actin-3 [Brachypodium distachyon]
Length=377

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|ACJ83287.1| unknown [Medicago truncatula]
Length=213

 Score =   391 bits (1005),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_010067406.1| PREDICTED: actin-1-like [Eucalyptus grandis]
 gb|KCW65532.1| hypothetical protein EUGRSUZ_G02932 [Eucalyptus grandis]
Length=377

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|AFZ78525.1| actin [Populus tomentosa]
Length=269

 Score =   393 bits (1010),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_004156708.1| PREDICTED: actin-97-like [Cucumis sativus]
Length=382

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/193 (97%), Positives = 191/193 (99%), Gaps = 0/193 (0%)
 Frame = +3

Query  99   KMAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  278
            KMA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE
Sbjct  5    KMADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  64

Query  279  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  458
            AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct  65   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  124

Query  459  KMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  638
            KMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAILR
Sbjct  125  KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILR  184

Query  639  LDLAGRDLTDHLM  677
            LDLAGRDLTD+LM
Sbjct  185  LDLAGRDLTDNLM  197



>ref|XP_009143470.1| PREDICTED: LOW QUALITY PROTEIN: actin-1 [Brassica rapa]
Length=373

 Score =   397 bits (1020),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD  M
Sbjct  181  DLAGRDLTDAFM  192



>gb|AFW75038.1| putative actin family protein [Zea mays]
Length=372

 Score =   397 bits (1020),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_006855625.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
 gb|ERN17092.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
Length=398

 Score =   398 bits (1023),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/193 (98%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = +3

Query  99   KMAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  278
            KMAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE
Sbjct  21   KMAETEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  80

Query  279  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  458
            AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct  81   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  140

Query  459  KMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  638
            KMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR
Sbjct  141  KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  200

Query  639  LDLAGRDLTDHLM  677
            LDLAGRDLTD LM
Sbjct  201  LDLAGRDLTDALM  213



>ref|XP_006650864.1| PREDICTED: actin-3-like [Oryza brachyantha]
Length=377

 Score =   397 bits (1021),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDCLM  192



>gb|AAF71264.1|AF246714_1 actin-like protein [Phalaenopsis hybrid cultivar]
Length=377

 Score =   397 bits (1021),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_002530852.1| actin, putative [Ricinus communis]
 gb|EEF31526.1| actin, putative [Ricinus communis]
Length=309

 Score =   395 bits (1014),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>emb|CDX91373.1| BnaC04g07770D [Brassica napus]
 emb|CDX74944.1| BnaA05g06900D [Brassica napus]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD  M
Sbjct  181  DLAGRDLTDAFM  192



>gb|AFW75045.1| putative actin family protein [Zea mays]
Length=368

 Score =   397 bits (1019),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|KJB76652.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=395

 Score =   398 bits (1022),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAENEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_006297921.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
 gb|EOA30819.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|NP_001051822.1| Os03g0836000 [Oryza sativa Japonica Group]
 sp|Q10AZ4.1|ACT3_ORYSJ RecName: Full=Actin-3 [Oryza sativa Japonica Group]
 sp|A2XNS1.2|ACT3_ORYSI RecName: Full=Actin-3 [Oryza sativa Indica Group]
 gb|AAR88568.1| actin [Oryza sativa Japonica Group]
 gb|ABF99754.1| Actin-3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13736.1| Os03g0836000 [Oryza sativa Japonica Group]
 dbj|BAG88787.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76479.1| hypothetical protein OsI_14218 [Oryza sativa Indica Group]
 gb|EEE60254.1| hypothetical protein OsJ_13270 [Oryza sativa Japonica Group]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDCLM  192



>gb|AAN08622.1| actin [Phalaenopsis hybrid cultivar]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010554872.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010554874.1| PREDICTED: actin-1 [Tarenaya hassleriana]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_010553283.1| PREDICTED: actin [Tarenaya hassleriana]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AHY94895.1| actin [Prunella vulgaris]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_003525105.1| PREDICTED: actin-7-like [Glycine max]
 ref|XP_003531402.1| PREDICTED: actin-7-like [Glycine max]
 gb|KHN29151.1| Actin-7 [Glycine soja]
 gb|KHN34050.1| Actin-7 [Glycine soja]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_010520033.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_009141678.1| PREDICTED: actin-1-like [Brassica rapa]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD  M
Sbjct  181  DLAGRDLTDAFM  192



>ref|XP_002882767.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59026.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>emb|CDP12785.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|KJB76650.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76653.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76654.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76655.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76656.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAENEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010528400.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010528408.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529829.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529830.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529831.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529832.1| PREDICTED: actin-1 [Tarenaya hassleriana]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010524532.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
 ref|XP_010524540.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_008363858.1| PREDICTED: LOW QUALITY PROTEIN: actin-like [Malus domestica]
 ref|XP_009338750.1| PREDICTED: actin-like [Pyrus x bretschneideri]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AFZ78523.1| actin [Populus tomentosa]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|KHG27347.1| Actin [Gossypium arboreum]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAENEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_006407369.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 ref|XP_006407370.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 gb|ESQ48822.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
 gb|ESQ48823.1| hypothetical protein EUTSA_v10020950mg [Eutrema salsugineum]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>emb|CDY01102.1| BnaC05g40980D [Brassica napus]
Length=377

 Score =   397 bits (1020),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_009393674.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385539.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385540.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   397 bits (1020),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|NP_187818.1| actin-11 [Arabidopsis thaliana]
 sp|P53496.1|ACT11_ARATH RecName: Full=Actin-11 [Arabidopsis thaliana]
 gb|AAG51045.1|AC069473_7 actin 11 (ACT11); 24016-22523 [Arabidopsis thaliana]
 gb|AAB39404.1| actin-11 [Arabidopsis thaliana]
 dbj|BAB01959.1| actin 11 [Arabidopsis thaliana]
 gb|AAM65277.1| actin 11 (ACT11) [Arabidopsis thaliana]
 dbj|BAC42968.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64013.1| putative actin 11 (ACT11) [Arabidopsis thaliana]
 gb|AEE75151.1| actin-11 [Arabidopsis thaliana]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_010498525.1| PREDICTED: actin-11 [Camelina sativa]
 ref|XP_010464961.1| PREDICTED: actin-11 [Camelina sativa]
 ref|XP_010486900.1| PREDICTED: actin-11 [Camelina sativa]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|ADK11998.1| putative actin protein [Salvia miltiorrhiza]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPL CDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLGCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>gb|ACJ85292.1| unknown [Medicago truncatula]
Length=210

 Score =   390 bits (1003),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHH FYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHAFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_003575839.1| PREDICTED: actin-1-like [Brachypodium distachyon]
 gb|ACO87663.1| actin [Brachypodium sylvaticum]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD++M
Sbjct  181  DLAGRDLTDYMM  192



>ref|XP_009146643.1| PREDICTED: actin-11 [Brassica rapa]
 ref|XP_009146646.1| PREDICTED: actin-11 [Brassica rapa]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_009133195.1| PREDICTED: actin-1-like [Brassica rapa]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD  M
Sbjct  181  DLAGRDLTDAFM  192



>ref|XP_010520110.1| PREDICTED: actin-like [Tarenaya hassleriana]
 ref|XP_010520111.1| PREDICTED: actin-like [Tarenaya hassleriana]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ +DIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADTDDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|NP_001130463.1| putative actin family protein isoform 1 [Zea mays]
 ref|XP_002440422.1| hypothetical protein SORBIDRAFT_09g000750 [Sorghum bicolor]
 ref|XP_008648673.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008648674.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008648675.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008656564.1| PREDICTED: actin-97-like [Zea mays]
 ref|XP_008656565.1| PREDICTED: actin-97-like [Zea mays]
 gb|AAU93346.1| actin [Saccharum officinarum]
 gb|ACF78682.1| unknown [Zea mays]
 gb|ACF84243.1| unknown [Zea mays]
 gb|ACG33152.1| actin-97 [Zea mays]
 gb|ACG41639.1| actin-97 [Zea mays]
 gb|ACL53150.1| unknown [Zea mays]
 gb|ACN29086.1| unknown [Zea mays]
 gb|ACN33687.1| unknown [Zea mays]
 gb|EES18852.1| hypothetical protein SORBIDRAFT_09g000750 [Sorghum bicolor]
 gb|AFW75039.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW75040.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW75041.1| putative actin family protein isoform 3 [Zea mays]
 gb|AFW75046.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW75047.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW75048.1| putative actin family protein isoform 3 [Zea mays]
 gb|AFW75049.1| putative actin family protein isoform 4 [Zea mays]
 gb|AFW82907.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW82908.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW82909.1| putative actin family protein isoform 3 [Zea mays]
 gb|AFW82910.1| putative actin family protein isoform 4 [Zea mays]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|KJB76651.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=382

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 189/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAENEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_009773019.1| PREDICTED: actin-97 [Nicotiana sylvestris]
Length=377

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|AIH15193.1| actin 1, partial [Hedychium coronarium]
Length=260

 Score =   392 bits (1007),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 186/192 (97%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDCLM  192



>ref|XP_004236747.1| PREDICTED: actin-97 [Solanum lycopersicum]
Length=377

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|ACJ04738.1| actin [Sedum alfredii]
Length=377

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_010557948.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|KEH24717.1| actin-97 [Medicago truncatula]
Length=377

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD++M
Sbjct  181  DLAGRDLTDYMM  192



>ref|XP_009587904.1| PREDICTED: actin-97-like [Nicotiana tomentosiformis]
Length=377

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_008354115.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_008354116.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_009343424.1| PREDICTED: actin-1 [Pyrus x bretschneideri]
Length=377

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|ABG49392.1| actin 2 [Torenia fournieri]
Length=377

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_003602545.1| Actin [Medicago truncatula]
Length=382

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = +3

Query  99   KMAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  278
            KMA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE
Sbjct  5    KMADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  64

Query  279  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  458
            AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct  65   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  124

Query  459  KMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  638
            KMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR
Sbjct  125  KMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  184

Query  639  LDLAGRDLTDHLM  677
            LDLAGRDLTD LM
Sbjct  185  LDLAGRDLTDSLM  197



>ref|XP_004302738.1| PREDICTED: actin [Fragaria vesca subsp. vesca]
Length=377

 Score =   396 bits (1018),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAETEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|NP_001239953.1| uncharacterized protein LOC100798523 [Glycine max]
 ref|XP_006579420.1| PREDICTED: uncharacterized protein LOC100798523 isoform X1 [Glycine 
max]
 ref|XP_006579421.1| PREDICTED: uncharacterized protein LOC100798523 isoform X2 [Glycine 
max]
 gb|ACU18758.1| unknown [Glycine max]
 gb|KHN19706.1| Actin [Glycine soja]
Length=377

 Score =   396 bits (1018),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDFLM  192



>ref|XP_004960554.1| PREDICTED: actin-97-like [Setaria italica]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|ADJ95345.1| actin [Pogonatherum paniceum]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_007132070.1| hypothetical protein PHAVU_011G064500g [Phaseolus vulgaris]
 gb|AGV54653.1| actin [Phaseolus vulgaris]
 gb|ESW04064.1| hypothetical protein PHAVU_011G064500g [Phaseolus vulgaris]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010685773.1| PREDICTED: actin-66 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ ED+QPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADVEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTDHLM
Sbjct  181  DLAGRDLTDHLM  192



>ref|XP_003569118.1| PREDICTED: actin-97 [Brachypodium distachyon]
 gb|AAN59956.1| actin [Hordeum vulgare]
 gb|AAW78911.1| actin [Triticum turgidum]
 gb|AAW78915.1| actin [Triticum aestivum]
 dbj|BAJ88055.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS61172.1| Actin-97 [Triticum urartu]
 gb|EMT15038.1| Actin-97 [Aegilops tauschii]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_004249866.1| PREDICTED: actin-7-like [Solanum lycopersicum]
 ref|XP_006351025.1| PREDICTED: actin-7-like [Solanum tuberosum]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>dbj|BAB63635.1| putative actin [Oryza sativa Japonica Group]
 gb|EAY77344.1| hypothetical protein OsI_05327 [Oryza sativa Indica Group]
 gb|EAZ14938.1| hypothetical protein OsJ_04870 [Oryza sativa Japonica Group]
 dbj|BAH01694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_004971370.1| PREDICTED: actin-7-like isoform X3 [Setaria italica]
Length=390

 Score =   397 bits (1019),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_002316289.1| actin family protein [Populus trichocarpa]
 ref|XP_011027194.1| PREDICTED: actin-97-like [Populus euphratica]
 ref|XP_011027195.1| PREDICTED: actin-97-like [Populus euphratica]
 gb|ABK92513.1| unknown [Populus trichocarpa]
 gb|EEF02460.1| actin family protein [Populus trichocarpa]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|NP_001054419.1| Os05g0106600 [Oryza sativa Japonica Group]
 gb|AAU44177.1| putative actin [Oryza sativa Japonica Group]
 dbj|BAF16333.1| Os05g0106600 [Oryza sativa Japonica Group]
 dbj|BAG88048.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|EEE62039.1| hypothetical protein OsJ_16821 [Oryza sativa Japonica Group]
Length=389

 Score =   397 bits (1019),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/193 (97%), Positives = 191/193 (99%), Gaps = 0/193 (0%)
 Frame = +3

Query  99   KMAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  278
            +MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE
Sbjct  12   EMADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDE  71

Query  279  AQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  458
            AQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct  72   AQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE  131

Query  459  KMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  638
            KMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR
Sbjct  132  KMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR  191

Query  639  LDLAGRDLTDHLM  677
            LDLAGRDLTD LM
Sbjct  192  LDLAGRDLTDSLM  204



>ref|XP_009599876.1| PREDICTED: actin-7-like [Nicotiana tomentosiformis]
 ref|XP_009795801.1| PREDICTED: actin-7 [Nicotiana sylvestris]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>gb|ADN88106.1| actin 1 [Guzmania wittmackii x Guzmania lingulata]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_011075140.1| PREDICTED: actin-97 [Sesamum indicum]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDNLM  192



>ref|XP_003537995.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006590987.1| PREDICTED: actin-like isoform X2 [Glycine max]
 gb|KHN21957.1| Actin-97 [Glycine soja]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AFK40690.1| unknown [Lotus japonicus]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDFLM  192



>gb|ABA99628.1| Actin-1, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ21374.1| hypothetical protein OsJ_37031 [Oryza sativa Japonica Group]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ +DIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADADDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|AHE41423.1| actin [Lycium chinense]
Length=377

 Score =   396 bits (1018),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_006424815.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
 ref|XP_006424816.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
 ref|XP_006488313.1| PREDICTED: actin-like [Citrus sinensis]
 gb|ESR38055.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
 gb|ESR38056.1| hypothetical protein CICLE_v10028665mg [Citrus clementina]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_006858216.1| hypothetical protein AMTR_s00062p00184900 [Amborella trichopoda]
 gb|ERN19683.1| hypothetical protein AMTR_s00062p00184900 [Amborella trichopoda]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_004489182.1| PREDICTED: actin-like [Cicer arietinum]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDFLM  192



>ref|XP_003539675.1| PREDICTED: actin-like isoform X1 [Glycine max]
 ref|XP_006592200.1| PREDICTED: actin-like isoform X2 [Glycine max]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AFZ78526.1| actin [Populus tomentosa]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_002449040.1| hypothetical protein SORBIDRAFT_05g003880 [Sorghum bicolor]
 gb|EES08028.1| hypothetical protein SORBIDRAFT_05g003880 [Sorghum bicolor]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|KDO72871.1| hypothetical protein CISIN_1g017125mg [Citrus sinensis]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_002530711.1| actin, putative [Ricinus communis]
 gb|EEF31665.1| actin, putative [Ricinus communis]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|EAY84058.1| hypothetical protein OsI_39289 [Oryza sativa Indica Group]
Length=390

 Score =   397 bits (1019),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ +DIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADADDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_006846523.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
 gb|ERN08198.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_002283590.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658578.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658579.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658580.1| PREDICTED: actin-1 [Vitis vinifera]
 emb|CAN83697.1| hypothetical protein VITISV_027542 [Vitis vinifera]
 emb|CBI31677.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   396 bits (1018),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 186/192 (97%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GED+QPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD++M
Sbjct  181  DLAGRDLTDYMM  192



>ref|XP_007016432.1| Actin-11 isoform 1 [Theobroma cacao]
 ref|XP_007016433.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34051.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34052.1| Actin-11 isoform 1 [Theobroma cacao]
Length=377

 Score =   396 bits (1017),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_004978759.1| PREDICTED: actin-7-like [Setaria italica]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_004235068.1| PREDICTED: actin-7 [Solanum lycopersicum]
 ref|XP_006355138.1| PREDICTED: actin-7-like [Solanum tuberosum]
 ref|XP_009614631.1| PREDICTED: actin-7 [Nicotiana tomentosiformis]
 ref|XP_009760363.1| PREDICTED: actin-7 [Nicotiana sylvestris]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>dbj|BAJ85474.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|AFZ78528.1| actin [Populus tomentosa]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|NP_001267747.1| uncharacterized protein LOC101779009 [Setaria italica]
 gb|AAG10041.1|AF288226_1 actin [Setaria italica]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|NP_001065830.1| Os11g0163100 [Oryza sativa Japonica Group]
 ref|XP_006662759.1| PREDICTED: actin-7-like [Oryza brachyantha]
 gb|AAO62546.1| actin [Oryza sativa Japonica Group]
 gb|AAX95098.1| actin [Oryza sativa Japonica Group]
 gb|AAX95099.1| actin [Oryza sativa Japonica Group]
 gb|AAX95100.1| actin [Oryza sativa Japonica Group]
 gb|ABA91666.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABA91667.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABA91668.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22379.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22380.1| Actin-7, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27675.1| Os11g0163100 [Oryza sativa Japonica Group]
 dbj|BAG87600.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67736.1| hypothetical protein OsI_35242 [Oryza sativa Indica Group]
 gb|EEE51698.1| hypothetical protein OsJ_33069 [Oryza sativa Japonica Group]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_007150869.1| hypothetical protein PHAVU_004G001000g [Phaseolus vulgaris]
 gb|ESW22863.1| hypothetical protein PHAVU_004G001000g [Phaseolus vulgaris]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDFLM  192



>dbj|BAD27408.1| actin [Nicotiana tabacum]
Length=377

 Score =   396 bits (1017),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDCLM  192



>ref|XP_004971371.1| PREDICTED: actin-7-like isoform X4 [Setaria italica]
 gb|ADB80031.1| beta-actin [Zoysia japonica]
 gb|ADB80032.1| beta-actin [Zoysia japonica]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|AEY76080.1| actin, partial [Petunia integrifolia subsp. inflata]
Length=215

 Score =   390 bits (1001),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEVEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTD  668
            DLAGRDLTD
Sbjct  181  DLAGRDLTD  189



>ref|XP_010265918.1| PREDICTED: actin [Nelumbo nucifera]
 ref|XP_010265919.1| PREDICTED: actin [Nelumbo nucifera]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADNEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|NP_196543.1| actin 7 [Arabidopsis thaliana]
 ref|XP_002871386.1| hypothetical protein ARALYDRAFT_487803 [Arabidopsis lyrata subsp. 
lyrata]
 sp|P53492.1|ACT7_ARATH RecName: Full=Actin-7; AltName: Full=Actin-2 [Arabidopsis thaliana]
 gb|AAA80356.1| actin-2 [Arabidopsis thaliana]
 gb|AAB52506.1| actin7 [Arabidopsis thaliana]
 dbj|BAB09402.1| ACTIN 2/7 [Arabidopsis thaliana]
 gb|AAL32780.1| ACTIN 2/7 [Arabidopsis thaliana]
 gb|AAL36336.1| putative ACTIN 2/7 protein [Arabidopsis thaliana]
 gb|AAM20037.1| putative actin 2/7 protein [Arabidopsis thaliana]
 gb|AAM47998.1| ACTIN 2/7 [Arabidopsis thaliana]
 gb|AAM53337.1| actin 2/7 [Arabidopsis thaliana]
 gb|EFH47645.1| hypothetical protein ARALYDRAFT_487803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED91450.1| actin 7 [Arabidopsis thaliana]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|AAK82991.1|AF285176_1 actin [Musa ABB Group]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_007204362.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
 ref|XP_008240928.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008240929.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008392069.1| PREDICTED: actin-like [Malus domestica]
 ref|XP_008360627.1| PREDICTED: actin [Malus domestica]
 gb|EMJ05561.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_008385127.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010936865.1| PREDICTED: actin [Elaeis guineensis]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_009353688.1| PREDICTED: actin [Pyrus x bretschneideri]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|EYU33199.1| hypothetical protein MIMGU_mgv1a008335mg [Erythranthe guttata]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAETEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY+LPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYSLPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_004497894.1| PREDICTED: actin-like [Cicer arietinum]
Length=377

 Score =   396 bits (1017),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010937718.1| PREDICTED: actin-3 [Elaeis guineensis]
 ref|XP_010937719.1| PREDICTED: actin-3 [Elaeis guineensis]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_009125344.1| PREDICTED: actin-7 [Brassica rapa]
 ref|XP_009125345.1| PREDICTED: actin-7 [Brassica rapa]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|NP_001150248.1| LOC100283878 [Zea mays]
 ref|XP_008677313.1| PREDICTED: LOC100283878 isoform X1 [Zea mays]
 gb|ACF84721.1| unknown [Zea mays]
 gb|ACG38362.1| actin-7 [Zea mays]
 gb|ACG41397.1| actin-7 [Zea mays]
 gb|AFW65614.1| putative actin family protein isoform 1 [Zea mays]
 gb|AFW65615.1| putative actin family protein isoform 2 [Zea mays]
 gb|AFW65616.1| putative actin family protein isoform 3 [Zea mays]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>ref|XP_004294508.1| PREDICTED: actin-1 [Fragaria vesca subsp. vesca]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_002298982.1| actin family protein [Populus trichocarpa]
 ref|XP_011038044.1| PREDICTED: actin-7-like [Populus euphratica]
 ref|XP_011038045.1| PREDICTED: actin-7-like [Populus euphratica]
 gb|EEE83787.1| actin family protein [Populus trichocarpa]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAEGE+IQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEGEEIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010111359.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|EXC30837.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|AID16085.1| actin [Morus alba]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_006854536.1| hypothetical protein AMTR_s00030p00045700 [Amborella trichopoda]
 gb|ERN16003.1| hypothetical protein AMTR_s00030p00045700 [Amborella trichopoda]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_008355144.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AEN25580.1| actin 7 [Brassica rapa subsp. pekinensis]
 emb|CDY21607.1| BnaC09g46850D [Brassica napus]
 emb|CDX69885.1| BnaA10g22340D [Brassica napus]
Length=377

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>tpg|DAA51049.1| TPA: putative actin family protein [Zea mays]
Length=394

 Score =   396 bits (1018),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>gb|AEF58501.1| actin [Platycodon grandiflorus]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AAP73458.1| actin [Gossypium hirsutum]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|ABS11262.1| actin [Musa acuminata AAA Group]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010036489.1| PREDICTED: actin [Eucalyptus grandis]
 gb|KCW48106.1| hypothetical protein EUGRSUZ_K01841 [Eucalyptus grandis]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_002308365.1| actin family protein [Populus trichocarpa]
 ref|XP_002322664.1| actin family protein [Populus trichocarpa]
 ref|XP_011033209.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011004840.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011013244.1| PREDICTED: actin [Populus euphratica]
 gb|ABK92789.1| unknown [Populus trichocarpa]
 gb|ABK93722.1| unknown [Populus trichocarpa]
 gb|ABK95521.1| unknown [Populus trichocarpa]
 gb|EEE91888.1| actin family protein [Populus trichocarpa]
 gb|EEF04425.1| actin family protein [Populus trichocarpa]
 gb|ADK70741.1| actin [Populus tomentosa]
 gb|ADK70742.1| actin [Populus tomentosa]
 gb|ADK70743.1| actin [Populus tomentosa]
 gb|ADK70744.1| actin [Populus tomentosa]
 gb|ADK70745.1| actin [Populus tomentosa]
 gb|ADK70746.1| actin [Populus tomentosa]
 gb|ADK70747.1| actin [Populus tomentosa]
 gb|ADK70748.1| actin [Populus tomentosa]
 gb|ADK70749.1| actin [Populus tomentosa]
 gb|ADK70750.1| actin [Populus tomentosa]
 gb|ADK70751.1| actin [Populus tomentosa]
 gb|ADK70752.1| actin [Populus tomentosa]
 gb|ADK70753.1| actin [Populus tomentosa]
 gb|ADK70754.1| actin [Populus tomentosa]
 gb|ADK70755.1| actin [Populus tomentosa]
 gb|ADK70756.1| actin [Populus tomentosa]
 gb|ADK70757.1| actin [Populus tomentosa]
 gb|ADK70758.1| actin [Populus tomentosa]
 gb|ADK70759.1| actin [Populus tomentosa]
 gb|ADK70760.1| actin [Populus tomentosa]
 gb|ADK70761.1| actin [Populus tomentosa]
 gb|ADK70762.1| actin [Populus tomentosa]
 gb|ADK70763.1| actin [Populus tomentosa]
 gb|ADK70764.1| actin [Populus tomentosa]
 gb|ADK70765.1| actin [Populus tomentosa]
 gb|ADK70766.1| actin [Populus tomentosa]
 gb|ADK70767.1| actin [Populus tomentosa]
 gb|ADK70768.1| actin [Populus tomentosa]
 gb|ADK70769.1| actin [Populus tomentosa]
 gb|ADK70770.1| actin [Populus tomentosa]
 gb|ADK70771.1| actin [Populus tomentosa]
 gb|ADK70772.1| actin [Populus tomentosa]
 gb|ADK70773.1| actin [Populus tomentosa]
 gb|ADK70774.1| actin [Populus tomentosa]
 gb|ADK70775.1| actin [Populus tomentosa]
 gb|ADK70776.1| actin [Populus tomentosa]
 gb|ADK70777.1| actin [Populus tomentosa]
 gb|ADK70778.1| actin [Populus tomentosa]
 gb|ADK70779.1| actin [Populus tomentosa]
 gb|ADK70780.1| actin [Populus tomentosa]
 gb|ADK70781.1| actin [Populus tomentosa]
 gb|AFZ78524.1| actin [Populus tomentosa]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_010909197.1| PREDICTED: actin-like [Elaeis guineensis]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|ABW71681.1| actin [Glycyrrhiza uralensis]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GED+QPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDVQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|ADK20401.1| actin [Citrus maxima]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAEAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>ref|XP_006287952.1| hypothetical protein CARUB_v10001188mg [Capsella rubella]
 ref|XP_006399463.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 ref|XP_006399464.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 ref|XP_010422938.1| PREDICTED: actin-7 [Camelina sativa]
 ref|XP_010452982.1| PREDICTED: actin-7 [Camelina sativa]
 ref|XP_010491624.1| PREDICTED: actin-7 [Camelina sativa]
 dbj|BAJ34498.1| unnamed protein product [Thellungiella halophila]
 gb|EOA20850.1| hypothetical protein CARUB_v10001188mg [Capsella rubella]
 gb|ESQ40916.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 gb|ESQ40917.1| hypothetical protein EUTSA_v10013834mg [Eutrema salsugineum]
 gb|AJG03098.1| actin [Orychophragmus violaceus]
 gb|AJG03100.1| actin [Brassica napus]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDSLM  192



>gb|AAT72934.2| stem cambial region actin protein [Eucommia ulmoides]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MAE +DIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MAESDDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>dbj|BAJ96385.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDCLM  192



>ref|XP_003560589.1| PREDICTED: actin-1 [Brachypodium distachyon]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD+LM
Sbjct  181  DLAGRDLTDYLM  192



>ref|XP_008241048.1| PREDICTED: actin [Prunus mume]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+ EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



>gb|AAP73449.1| actin [Gossypium hirsutum]
 gb|ADY68785.1| actin [Gossypium raimondii]
 gb|ADY68786.1| actin [Gossypium barbadense]
 gb|ADY68787.1| actin [Gossypium barbadense]
 gb|ADY68788.1| actin [Gossypium hirsutum]
 gb|ADY68789.1| actin [Gossypium hirsutum]
 gb|AEN70748.1| actin 1 [Gossypium laxum]
 gb|AEN70749.1| actin 1 [Gossypium schwendimanii]
 gb|AEN70750.1| actin 1 [Gossypium turneri]
 gb|AEN70751.1| actin 1 [Gossypium mustelinum]
 gb|AEN70752.1| actin 1 [Gossypium mustelinum]
 gb|AEN70755.1| actin 1 [Gossypium tomentosum]
 gb|AEN70756.1| actin 1 [Gossypium tomentosum]
 gb|AEN70760.1| actin 1 [Gossypium barbadense var. peruvianum]
 gb|AEN70761.1| actin 1 [Gossypium hirsutum subsp. latifolium]
 gb|AEN70762.1| actin 1 [Gossypium hirsutum subsp. latifolium]
 gb|AEN70763.1| actin 1 [Gossypium armourianum]
 gb|AEN70764.1| actin 1 [Gossypium harknessii]
 gb|AEN70765.1| actin 1 [Gossypium davidsonii]
 gb|AEN70766.1| actin 1 [Gossypium klotzschianum]
 gb|AEN70767.1| actin 1 [Gossypium aridum]
 gb|AEN70768.1| actin 1 [Gossypium gossypioides]
 gb|AEN70769.1| actin 1 [Gossypium lobatum]
 gb|AEN70770.1| actin 1 [Gossypium trilobum]
 gb|KJB40442.1| hypothetical protein B456_007G063600 [Gossypium raimondii]
 gb|KJB40443.1| hypothetical protein B456_007G063600 [Gossypium raimondii]
 gb|KJB40444.1| hypothetical protein B456_007G063600 [Gossypium raimondii]
Length=377

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +3

Query  102  MAEGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  281
            MA+GEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
Sbjct  1    MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA  60

Query  282  QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  461
            QSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct  61   QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK  120

Query  462  MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  641
            MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
Sbjct  121  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL  180

Query  642  DLAGRDLTDHLM  677
            DLAGRDLTD LM
Sbjct  181  DLAGRDLTDALM  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060