BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040M24

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               181   2e-52   Solanum lycopersicum
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             181   2e-52   Citrus clementina [clementine]
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          180   3e-52   Citrus sinensis [apfelsine]
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          177   5e-51   Solanum tuberosum [potatoes]
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         176   2e-50   Jatropha curcas
ref|XP_002511930.1|  conserved hypothetical protein                     175   3e-50   Ricinus communis
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   174   9e-50   Citrus sinensis [apfelsine]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               174   1e-49   Nicotiana sylvestris
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             173   1e-49   Citrus clementina [clementine]
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   174   3e-49   Citrus sinensis [apfelsine]
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             173   3e-49   
gb|ABC69764.1|  unknown                                                 170   6e-49   Vitis pseudoreticulata
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               172   6e-49   Vitis vinifera
emb|CDP12094.1|  unnamed protein product                                171   1e-48   Coffea canephora [robusta coffee]
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               171   1e-48   Vitis vinifera
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               167   2e-47   Nelumbo nucifera [Indian lotus]
ref|NP_001239711.1|  uncharacterized protein LOC100811024               167   2e-47   Glycine max [soybeans]
ref|XP_002509881.1|  conserved hypothetical protein                     167   3e-47   Ricinus communis
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               168   3e-47   Tarenaya hassleriana [spider flower]
gb|KJB06452.1|  hypothetical protein B456_001G157900                    165   3e-47   Gossypium raimondii
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               166   6e-47   Nicotiana sylvestris
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               167   6e-47   Tarenaya hassleriana [spider flower]
gb|KJB24635.1|  hypothetical protein B456_004G154600                    164   6e-47   Gossypium raimondii
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               166   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               166   6e-47   Phoenix dactylifera
gb|KHG24129.1|  Reticulon-like protein B3                               166   7e-47   Gossypium arboreum [tree cotton]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               166   9e-47   Elaeis guineensis
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    166   1e-46   Nicotiana tomentosiformis
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                166   1e-46   Erythranthe guttata [common monkey flower]
gb|KJB06451.1|  hypothetical protein B456_001G157900                    166   1e-46   Gossypium raimondii
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               166   1e-46   Sesamum indicum [beniseed]
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               166   2e-46   Tarenaya hassleriana [spider flower]
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 165   2e-46   Elaeis guineensis
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               165   2e-46   Elaeis guineensis
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               165   3e-46   Nicotiana sylvestris
gb|KJB06453.1|  hypothetical protein B456_001G157900                    165   4e-46   Gossypium raimondii
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    164   4e-46   Nicotiana sylvestris
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    164   5e-46   Nicotiana sylvestris
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             164   5e-46   Phaseolus vulgaris [French bean]
gb|KHG04885.1|  Reticulon-like protein B5                               164   6e-46   Gossypium arboreum [tree cotton]
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               164   7e-46   
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               164   7e-46   Nicotiana tomentosiformis
gb|KJB24634.1|  hypothetical protein B456_004G154600                    164   8e-46   Gossypium raimondii
ref|NP_001056102.1|  Os05g0526400                                       163   1e-45   
ref|XP_007051689.1|  Reticulon family protein                           163   1e-45   
gb|KHG29253.1|  Reticulon-like protein B5                               163   1e-45   Gossypium arboreum [tree cotton]
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    163   1e-45   Glycine max [soybeans]
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               164   1e-45   Elaeis guineensis
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          163   2e-45   Solanum tuberosum [potatoes]
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               163   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_007038874.1|  VIRB2-interacting protein 2                        162   2e-45   Theobroma cacao [chocolate]
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               163   2e-45   Sesamum indicum [beniseed]
gb|ACU23452.1|  unknown                                                 162   2e-45   Glycine max [soybeans]
ref|XP_006374287.1|  hypothetical protein POPTR_0015s05710g             160   2e-45   
ref|XP_010439153.1|  PREDICTED: reticulon-like protein B1 isoform X2    160   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g             160   2e-45   
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               162   3e-45   Phoenix dactylifera
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               162   4e-45   Prunus mume [ume]
emb|CDY57657.1|  BnaC01g15350D                                          162   5e-45   Brassica napus [oilseed rape]
ref|XP_011073415.1|  PREDICTED: reticulon-like protein B1 isoform X2    159   5e-45   
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         161   5e-45   Jatropha curcas
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             161   6e-45   
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             161   7e-45   
emb|CDY44123.1|  BnaA01g13310D                                          162   8e-45   Brassica napus [oilseed rape]
gb|EAY98759.1|  hypothetical protein OsI_20691                          160   1e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               161   1e-44   Nicotiana tomentosiformis
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    160   1e-44   
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          160   1e-44   Cicer arietinum [garbanzo]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               160   2e-44   Solanum lycopersicum
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               160   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               160   2e-44   Brassica rapa
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               160   2e-44   Brassica rapa
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             160   2e-44   Prunus persica
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          160   2e-44   Solanum tuberosum [potatoes]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               160   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    160   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    159   2e-44   Sesamum indicum [beniseed]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          159   2e-44   Oryza brachyantha
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    160   3e-44   
gb|AFK41983.1|  unknown                                                 159   4e-44   Medicago truncatula
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               159   4e-44   Phoenix dactylifera
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               159   4e-44   Cucumis melo [Oriental melon]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         159   5e-44   Jatropha curcas
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             158   5e-44   
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          160   6e-44   Glycine max [soybeans]
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               158   7e-44   Pyrus x bretschneideri [bai li]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             159   7e-44   
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             159   7e-44   Eutrema salsugineum [saltwater cress]
gb|EAY75742.1|  hypothetical protein OsI_03655                          158   7e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               159   8e-44   Malus domestica [apple tree]
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               158   9e-44   Elaeis guineensis
ref|XP_010112604.1|  Reticulon-like protein                             158   9e-44   Morus notabilis
gb|ACJ84486.1|  unknown                                                 158   1e-43   Medicago truncatula
gb|KJB37517.1|  hypothetical protein B456_006G208500                    157   1e-43   Gossypium raimondii
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               158   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               158   1e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG15548.1|  Reticulon-like protein B3                               158   1e-43   Gossypium arboreum [tree cotton]
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    157   1e-43   Solanum tuberosum [potatoes]
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               157   2e-43   Populus euphratica
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               157   2e-43   Populus euphratica
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             157   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               158   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               157   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               157   2e-43   Tarenaya hassleriana [spider flower]
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     156   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               157   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010105716.1|  Reticulon-like protein                             157   3e-43   
dbj|BAJ33905.1|  unnamed protein product                                157   3e-43   Eutrema halophilum
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             157   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          157   3e-43   Cucumis sativus [cucumbers]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               157   3e-43   Prunus mume [ume]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               157   3e-43   Eucalyptus grandis [rose gum]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     157   3e-43   Eucalyptus grandis [rose gum]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        157   4e-43   Arabidopsis lyrata subsp. lyrata
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     155   4e-43   Eucalyptus grandis [rose gum]
ref|NP_001130478.1|  Seed maturation protein                            157   4e-43   Zea mays [maize]
emb|CDY10954.1|  BnaA03g46130D                                          157   4e-43   Brassica napus [oilseed rape]
ref|NP_194094.1|  VIRB2-interacting protein 1                           157   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             156   5e-43   Eutrema salsugineum [saltwater cress]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             156   5e-43   Capsella rubella
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               156   5e-43   Solanum lycopersicum
ref|XP_002299504.1|  reticulon family protein                           156   7e-43   Populus trichocarpa [western balsam poplar]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     157   7e-43   Eucalyptus grandis [rose gum]
ref|NP_001149653.1|  LOC100283279                                       156   8e-43   Zea mays [maize]
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               155   8e-43   Brachypodium distachyon [annual false brome]
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               156   8e-43   Pyrus x bretschneideri [bai li]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               155   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               155   9e-43   
ref|NP_176592.1|  reticulon-like protein B3                             155   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    155   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             155   1e-42   Capsella rubella
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               155   1e-42   Solanum lycopersicum
ref|XP_007218267.1|  hypothetical protein PRUPE_ppa008259mg             156   1e-42   
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                155   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          155   2e-42   Oryza brachyantha
emb|CDY42012.1|  BnaC04g00900D                                          155   2e-42   Brassica napus [oilseed rape]
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               155   2e-42   Brassica rapa
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               155   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002320163.1|  reticulon family protein                           154   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               154   3e-42   Pyrus x bretschneideri [bai li]
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     153   3e-42   Eucalyptus grandis [rose gum]
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    158   3e-42   
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                154   3e-42   Erythranthe guttata [common monkey flower]
tpg|DAA52789.1|  TPA: seed maturation protein                           155   3e-42   
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               154   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             156   3e-42   
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               154   3e-42   Malus domestica [apple tree]
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               154   4e-42   Camelina sativa [gold-of-pleasure]
gb|ACF87936.1|  unknown                                                 152   4e-42   Zea mays [maize]
gb|ABK94480.1|  unknown                                                 154   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002880222.1|  reticulon family protein                           154   4e-42   Arabidopsis lyrata subsp. lyrata
dbj|BAJ89699.1|  predicted protein                                      154   4e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             154   4e-42   Capsella rubella
gb|EMS62606.1|  Reticulon-like protein B1                               154   4e-42   Triticum urartu
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               154   4e-42   Pyrus x bretschneideri [bai li]
gb|EPS71452.1|  hypothetical protein M569_03311                         154   4e-42   Genlisea aurea
gb|KJB24287.1|  hypothetical protein B456_004G137000                    152   4e-42   Gossypium raimondii
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          154   5e-42   Solanum tuberosum [potatoes]
ref|NP_001150474.1|  seed maturation protein                            154   5e-42   
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               154   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               154   5e-42   Camelina sativa [gold-of-pleasure]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               154   6e-42   Glycine max [soybeans]
gb|KHN15986.1|  Reticulon-like protein B5                               153   7e-42   Glycine soja [wild soybean]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    153   7e-42   Gossypium raimondii
emb|CDY24806.1|  BnaA08g15040D                                          154   8e-42   Brassica napus [oilseed rape]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               154   8e-42   
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               153   8e-42   Eucalyptus grandis [rose gum]
emb|CDY25557.1|  BnaC09g11820D                                          153   9e-42   Brassica napus [oilseed rape]
ref|XP_002874678.1|  VIRB2-interacting protein 2                        153   1e-41   Arabidopsis lyrata subsp. lyrata
emb|CDY52012.1|  BnaC06g42920D                                          153   1e-41   Brassica napus [oilseed rape]
gb|AFK42129.1|  unknown                                                 151   1e-41   Medicago truncatula
ref|NP_192861.1|  reticulon-like protein B2                             153   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             152   1e-41   
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               153   1e-41   Brachypodium distachyon [annual false brome]
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               153   1e-41   Brassica rapa
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               152   2e-41   Populus euphratica
gb|EAY73097.1|  hypothetical protein OsI_00974                          153   2e-41   Oryza sativa Indica Group [Indian rice]
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    152   2e-41   Arabis alpina [alpine rockcress]
emb|CDY41666.1|  BnaC03g62180D                                          153   2e-41   Brassica napus [oilseed rape]
dbj|BAB32723.1|  unknown protein                                        153   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001118533.1|  reticulon-like protein B5                          150   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               152   3e-41   Brassica rapa
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   151   3e-41   Citrus sinensis [apfelsine]
emb|CDY05135.1|  BnaC03g29330D                                          153   3e-41   
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             151   3e-41   Citrus clementina [clementine]
gb|KHG20258.1|  Reticulon-like protein B3                               151   3e-41   Gossypium arboreum [tree cotton]
ref|NP_001044177.1|  Os01g0736900                                       151   4e-41   
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          152   4e-41   Setaria italica
gb|KDO86332.1|  hypothetical protein CISIN_1g025719mg                   150   4e-41   Citrus sinensis [apfelsine]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          151   4e-41   Oryza brachyantha
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               151   4e-41   Eucalyptus grandis [rose gum]
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               151   5e-41   Nicotiana sylvestris
ref|XP_010092876.1|  Reticulon-like protein                             151   5e-41   Morus notabilis
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               151   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             150   7e-41   Eutrema salsugineum [saltwater cress]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               150   8e-41   Populus euphratica
gb|AFK48295.1|  unknown                                                 149   9e-41   Lotus japonicus
ref|NP_566065.1|  reticulon-like protein B5                             150   9e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34557.1|  unknown                                                 150   1e-40   Medicago truncatula
gb|KJB19086.1|  hypothetical protein B456_003G084400                    149   1e-40   Gossypium raimondii
ref|XP_002887921.1|  reticulon family protein                           150   1e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               150   1e-40   Malus domestica [apple tree]
ref|NP_198975.1|  reticulon-like protein B4                             150   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               150   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               150   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    150   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               150   2e-40   Tarenaya hassleriana [spider flower]
emb|CDP08746.1|  unnamed protein product                                150   2e-40   Coffea canephora [robusta coffee]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               150   2e-40   
dbj|BAJ98297.1|  predicted protein                                      149   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY34396.1|  BnaA09g11380D                                          149   3e-40   Brassica napus [oilseed rape]
ref|XP_002303615.1|  reticulon family protein                           149   3e-40   Populus trichocarpa [western balsam poplar]
gb|KJB19087.1|  hypothetical protein B456_003G084400                    149   3e-40   Gossypium raimondii
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               149   3e-40   Tarenaya hassleriana [spider flower]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          149   3e-40   Oryza sativa Japonica Group [Japonica rice]
gb|KJB19089.1|  hypothetical protein B456_003G084400                    148   3e-40   Gossypium raimondii
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    149   5e-40   Arabis alpina [alpine rockcress]
gb|EPS69502.1|  hypothetical protein M569_05265                         148   5e-40   Genlisea aurea
dbj|BAH57206.1|  AT1G64090                                              148   5e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19091.1|  hypothetical protein B456_003G084400                    148   6e-40   Gossypium raimondii
ref|XP_002870630.1|  VIRB2-interacting protein 3                        148   6e-40   
gb|KJB19088.1|  hypothetical protein B456_003G084400                    148   7e-40   Gossypium raimondii
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               148   8e-40   Fragaria vesca subsp. vesca
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          147   1e-39   Cucumis sativus [cucumbers]
gb|KJB52211.1|  hypothetical protein B456_008G250900                    145   1e-39   Gossypium raimondii
emb|CDY08353.1|  BnaC09g12430D                                          147   1e-39   Brassica napus [oilseed rape]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                147   1e-39   Erythranthe guttata [common monkey flower]
gb|KJB52210.1|  hypothetical protein B456_008G250900                    147   2e-39   Gossypium raimondii
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               147   2e-39   Brassica rapa
ref|NP_191715.2|  reticulon-like protein B6                             146   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               147   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               147   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               146   4e-39   Brachypodium distachyon [annual false brome]
gb|KJB52212.1|  hypothetical protein B456_008G250900                    145   4e-39   Gossypium raimondii
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               146   4e-39   Pyrus x bretschneideri [bai li]
gb|EMT19773.1|  Reticulon-like protein B1                               147   6e-39   
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             145   7e-39   Capsella rubella
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               145   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             145   8e-39   Prunus persica
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               145   9e-39   Camelina sativa [gold-of-pleasure]
gb|KJB52682.1|  hypothetical protein B456_008G272900                    143   9e-39   Gossypium raimondii
gb|EMS62854.1|  Reticulon-like protein B1                               144   1e-38   Triticum urartu
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               145   1e-38   Camelina sativa [gold-of-pleasure]
emb|CDJ26559.1|  unnamed protein product                                146   1e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               145   1e-38   Malus domestica [apple tree]
gb|KHG09260.1|  Reticulon-like protein B3                               145   1e-38   Gossypium arboreum [tree cotton]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               144   1e-38   Fragaria vesca subsp. vesca
ref|NP_001185307.1|  reticulon-like protein B3                          145   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    144   2e-38   Arabis alpina [alpine rockcress]
gb|KHF99856.1|  Reticulon-like protein B1                               142   2e-38   Gossypium arboreum [tree cotton]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          144   2e-38   Setaria italica
gb|AFK42059.1|  unknown                                                 144   2e-38   Lotus japonicus
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               144   2e-38   Malus domestica [apple tree]
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               144   2e-38   Sesamum indicum [beniseed]
gb|KJB52679.1|  hypothetical protein B456_008G272900                    144   2e-38   Gossypium raimondii
gb|KHN40449.1|  Reticulon-like protein B5                               144   2e-38   Glycine soja [wild soybean]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               144   2e-38   Glycine max [soybeans]
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    144   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               144   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               144   4e-38   Brassica rapa
ref|XP_009626481.1|  PREDICTED: reticulon-like protein B5 isoform X2    141   5e-38   
emb|CDY38194.1|  BnaA09g11950D                                          142   8e-38   Brassica napus [oilseed rape]
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               141   1e-37   
emb|CDP05124.1|  unnamed protein product                                142   1e-37   Coffea canephora [robusta coffee]
emb|CAN77759.1|  hypothetical protein VITISV_034907                     142   1e-37   Vitis vinifera
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               142   2e-37   Vitis vinifera
gb|KJB24636.1|  hypothetical protein B456_004G154600                    137   4e-37   Gossypium raimondii
gb|EPS73616.1|  hypothetical protein M569_01145                         140   6e-37   Genlisea aurea
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               141   6e-37   Fragaria vesca subsp. vesca
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          141   7e-37   
ref|XP_004980276.1|  PREDICTED: uncharacterized protein LOC101782657    142   7e-37   Setaria italica
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               140   8e-37   Brassica rapa
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             139   9e-37   Phaseolus vulgaris [French bean]
gb|AFW80460.1|  hypothetical protein ZEAMMB73_353444                    137   1e-36   
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               139   1e-36   Populus euphratica
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             139   1e-36   Phaseolus vulgaris [French bean]
ref|XP_002876621.1|  reticulon family protein                           139   2e-36   
gb|EMT06999.1|  Reticulon-like protein B1                               139   2e-36   
emb|CDM81762.1|  unnamed protein product                                139   3e-36   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001239653.1|  uncharacterized protein LOC100793862               137   8e-36   
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               137   1e-35   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             136   2e-35   
gb|ABR17571.1|  unknown                                                 136   3e-35   
ref|XP_003592173.1|  Reticulon family protein                           136   3e-35   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          136   3e-35   
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             135   4e-35   
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               135   4e-35   
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               135   5e-35   
gb|EMS49910.1|  Reticulon-like protein B3                               137   5e-35   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               136   6e-35   
gb|KHN21799.1|  Reticulon-like protein B1                               135   6e-35   
emb|CDX90792.1|  BnaA03g24720D                                          135   6e-35   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               135   7e-35   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          135   7e-35   
gb|KHN29299.1|  Reticulon-like protein B5                               134   1e-34   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          134   1e-34   
gb|ACN40158.1|  unknown                                                 134   1e-34   
ref|XP_010462752.1|  PREDICTED: reticulon-like protein B5 isoform X2    130   1e-34   
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               134   2e-34   
gb|KJB24286.1|  hypothetical protein B456_004G137000                    131   2e-34   
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          134   2e-34   
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             134   2e-34   
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          134   3e-34   
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               133   3e-34   
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    133   4e-34   
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             133   4e-34   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               133   4e-34   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               132   4e-34   
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          133   4e-34   
gb|AFK39432.1|  unknown                                                 129   7e-34   
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      132   1e-33   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      132   1e-33   
gb|KJB52681.1|  hypothetical protein B456_008G272900                    128   1e-33   
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               131   2e-33   
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      132   2e-33   
gb|KHN12926.1|  Reticulon-like protein B1                               131   2e-33   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          131   2e-33   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          131   2e-33   
ref|XP_010462746.1|  PREDICTED: reticulon-like protein B5 isoform X1    128   2e-33   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          131   3e-33   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               130   3e-33   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          130   3e-33   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               130   4e-33   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    129   8e-33   
gb|KJB52680.1|  hypothetical protein B456_008G272900                    125   1e-32   
ref|XP_008782788.1|  PREDICTED: reticulon-like protein B1               127   1e-32   
gb|ACG32549.1|  seed maturation protein                                 129   2e-32   
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          128   3e-32   
gb|ACG36034.1|  reticulon                                               127   7e-32   
ref|NP_001130603.1|  uncharacterized protein LOC100191702               126   8e-32   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               126   1e-31   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          127   1e-31   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               126   1e-31   
gb|EPS64109.1|  hypothetical protein M569_10676                         126   1e-31   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               126   2e-31   
ref|NP_001130268.1|  uncharacterized protein LOC100191362               126   2e-31   
ref|NP_001057713.1|  Os06g0503400                                       126   2e-31   
gb|EAY97489.1|  hypothetical protein OsI_19418                          125   4e-31   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               125   4e-31   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          125   5e-31   
dbj|BAJ94514.1|  predicted protein                                      125   6e-31   
ref|XP_002521590.1|  conserved hypothetical protein                     124   6e-31   
gb|KCW89794.1|  hypothetical protein EUGRSUZ_A02040                     123   9e-31   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    124   9e-31   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    124   1e-30   
ref|NP_001055164.1|  Os05g0312500                                       124   1e-30   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               124   1e-30   
ref|NP_001130091.1|  uncharacterized protein LOC100191184               124   1e-30   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             124   1e-30   
gb|EPS67049.1|  hypothetical protein M569_07727                         123   1e-30   
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          124   2e-30   
ref|XP_002302126.2|  reticulon family protein                           123   2e-30   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               123   2e-30   
gb|EAY85291.1|  hypothetical protein OsI_06662                          122   2e-30   
ref|NP_001030913.1|  reticulon-like protein B6                          123   2e-30   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    123   2e-30   
ref|XP_008809740.1|  PREDICTED: reticulon-like protein B8 isoform X2    121   2e-30   
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               123   3e-30   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               123   3e-30   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    123   3e-30   
ref|XP_008809739.1|  PREDICTED: reticulon-like protein B8 isoform X1    121   3e-30   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               123   3e-30   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   122   3e-30   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               122   3e-30   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     123   4e-30   
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          122   4e-30   
ref|NP_001046501.1|  Os02g0265900                                       122   5e-30   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    123   6e-30   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               122   6e-30   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               122   6e-30   
gb|EEC80692.1|  hypothetical protein OsI_23118                          128   6e-30   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          122   6e-30   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                121   6e-30   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               122   7e-30   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               121   8e-30   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               121   1e-29   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          121   1e-29   
emb|CDP18758.1|  unnamed protein product                                121   1e-29   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          120   1e-29   
ref|XP_004147776.1|  PREDICTED: reticulon-like protein B8-like          120   1e-29   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          120   2e-29   
gb|ABB51093.1|  reticulon                                               119   2e-29   
dbj|BAK06264.1|  predicted protein                                      120   2e-29   
ref|XP_002306759.1|  reticulon family protein                           120   2e-29   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               120   2e-29   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    120   2e-29   
gb|EEE63204.1|  hypothetical protein OsJ_18014                          123   2e-29   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               120   2e-29   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               120   3e-29   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               119   4e-29   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    120   4e-29   
gb|AFW82132.1|  hypothetical protein ZEAMMB73_565764                    118   6e-29   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               119   8e-29   
ref|XP_007048924.1|  Reticulon family protein                           119   8e-29   
ref|NP_001150935.1|  seed maturation protein                            119   8e-29   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 119   1e-28   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    118   1e-28   
ref|NP_001149072.1|  LOC100282693                                       118   2e-28   
gb|EMT25698.1|  Reticulon-like protein B2                               118   2e-28   
gb|EMT18983.1|  Reticulon-like protein B1                               117   2e-28   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          118   2e-28   
gb|ABK26525.1|  unknown                                                 117   2e-28   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               117   3e-28   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    118   3e-28   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               117   4e-28   
gb|EMS52545.1|  Reticulon-like protein B1                               117   4e-28   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    117   4e-28   
gb|ABK22748.1|  unknown                                                 117   4e-28   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               117   5e-28   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    117   5e-28   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               117   5e-28   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    117   5e-28   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         116   6e-28   
dbj|BAK05980.1|  predicted protein                                      115   8e-28   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             116   8e-28   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    116   1e-27   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               116   1e-27   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               115   1e-27   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               115   1e-27   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    115   2e-27   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             115   3e-27   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    115   3e-27   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    114   3e-27   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               114   3e-27   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               114   4e-27   
ref|XP_009421445.1|  PREDICTED: reticulon-like protein B1               112   4e-27   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    114   5e-27   
ref|NP_566371.1|  reticulon-like protein B8                             114   5e-27   
gb|KHN28537.1|  Reticulon-like protein B8                               114   5e-27   
emb|CDY41331.1|  BnaA01g31880D                                          114   6e-27   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               114   6e-27   
ref|NP_850552.1|  reticulon-like protein B8                             114   7e-27   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             113   8e-27   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               113   8e-27   
gb|KHG24796.1|  Reticulon-like protein B5                               112   8e-27   
ref|XP_006602273.1|  PREDICTED: reticulon-like protein B8-like is...    114   1e-26   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    113   1e-26   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    112   2e-26   
emb|CDY56712.1|  BnaC01g38700D                                          114   2e-26   
gb|KEH33647.1|  reticulon-like protein B2                               112   3e-26   
gb|KJB24288.1|  hypothetical protein B456_004G137000                    112   3e-26   
gb|EAY98925.1|  hypothetical protein OsI_20880                          111   3e-26   
ref|NP_001051461.1|  Os03g0781700                                       112   3e-26   
ref|XP_009416753.1|  PREDICTED: reticulon-like protein B8 isoform X2    110   4e-26   
gb|AFW78798.1|  hypothetical protein ZEAMMB73_677867                    108   5e-26   
gb|EAY92056.1|  hypothetical protein OsI_13754                          112   5e-26   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    111   5e-26   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    111   6e-26   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             111   6e-26   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    111   7e-26   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               111   7e-26   
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             110   7e-26   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    110   8e-26   
gb|KHG28741.1|  Reticulon-like protein B8                               110   8e-26   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    110   1e-25   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             110   1e-25   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    110   2e-25   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               110   2e-25   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          109   2e-25   
emb|CDY00916.1|  BnaC05g42840D                                          109   2e-25   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               110   2e-25   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    110   2e-25   
emb|CDY07184.1|  BnaCnng01990D                                          109   3e-25   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             110   3e-25   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               108   3e-25   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    110   3e-25   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          108   4e-25   
ref|NP_001058867.1|  Os07g0142000                                       108   4e-25   
ref|XP_006643730.1|  PREDICTED: reticulon-like protein B9-like          108   5e-25   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          108   5e-25   
gb|EMT10142.1|  Reticulon-like protein B1                               109   6e-25   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    110   6e-25   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    110   7e-25   
ref|XP_010543528.1|  PREDICTED: reticulon-like protein B8               107   1e-24   
gb|KJB71178.1|  hypothetical protein B456_011G126300                    106   1e-24   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               107   1e-24   
gb|KJB71177.1|  hypothetical protein B456_011G126300                    106   1e-24   
gb|KHN11998.1|  Reticulon-like protein B8                               107   2e-24   
gb|KJB71176.1|  hypothetical protein B456_011G126300                    106   2e-24   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               107   2e-24   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    107   2e-24   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    107   3e-24   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          107   3e-24   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    107   3e-24   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9               106   3e-24   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    106   5e-24   
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9               105   6e-24   
ref|XP_010906868.1|  PREDICTED: reticulon-like protein B8 isoform X2    105   6e-24   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    105   6e-24   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg             105   7e-24   
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               105   7e-24   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          105   7e-24   
ref|XP_009385406.1|  PREDICTED: reticulon-like protein B2 isoform X1    104   9e-24   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               105   9e-24   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    106   1e-23   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               105   1e-23   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    105   1e-23   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               105   1e-23   
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               104   1e-23   
ref|NP_001042463.1|  Os01g0226300                                       103   1e-23   



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +KVRRLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +C
Sbjct  63   SKVRRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLC  122

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            HGL++ALA LFLW NAS+FI KSAPHIPEVHIPE+PVL+FASAL+N++N  LA LR+IAS
Sbjct  123  HGLMIALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLEFASALRNEINRALAVLREIAS  182

Query  630  GRDLXM  647
            GRDL M
Sbjct  183  GRDLKM  188



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES+ E I +KIH HDSSSSS S   +++KK + SS+  KV RLFGR++PVHKVLGGGK A
Sbjct  13   ESVKEKITEKIHGHDSSSSSSSSDSDDDKKSSASSLKTKVFRLFGREKPVHKVLGGGKPA  72

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LI+ALAVLFLW NAS+FI KS
Sbjct  73   DVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLFLWSNASTFINKS  132

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEV+IPEEPVLQ ASAL+ ++N     LR+IASGRDL
Sbjct  133  PPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDL  173



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E I +KIH HDSSSSS S   +++KK +TSS+  KV RLFGR++PVHKVLGGGK A
Sbjct  13   ESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREKPVHKVLGGGKPA  72

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATAIW+LF++LEYHLLT VCH LI+ALAVLFLW NAS+FI KS
Sbjct  73   DVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFINKS  132

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEV+IPEEPVLQ ASAL+ ++N     LR+IASGRDL
Sbjct  133  PPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDL  173



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +KVRRLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +C
Sbjct  63   SKVRRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLC  122

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            HGL++ALA LFLW NAS+FI KSAPHIPEVHIPE+PVL FASAL+N++N  LA LR+IAS
Sbjct  123  HGLMVALAGLFLWSNASTFIHKSAPHIPEVHIPEKPVLAFASALRNEINRALAVLREIAS  182

Query  630  GRDL  641
            GRDL
Sbjct  183  GRDL  186



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 143/173 (83%), Gaps = 3/173 (2%)
 Frame = +3

Query  132  MAXXDRKEX--ESLVEXIADKIHRHdsssssdsek-eeeekkkttssMDAKVRRLFGRQQ  302
            MA   ++E   ES++E I++KIH HDSSSSSDS+  E+ +   + SSM +K+ R+FGR++
Sbjct  1    MAEHHKEESVIESVMEKISEKIHGHDSSSSSDSDNDEKSKSSSSPSSMKSKIYRIFGREK  60

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CHGLIL+LAVLF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLF  120

Query  483  LWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LW NAS+FI KS P IPEV+IPEEPVLQ A AL++++N   A LRDIASGRDL
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGRDL  173



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MA       ES++E I++KIH HDSSSSSDSE + E+K  + SS+ AK+ RLFGR++PVH
Sbjct  1    MAEHPESPIESVMEKISEKIHAHDSSSSSDSESDSEKKPTSPSSVKAKIFRLFGRERPVH  60

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
             VLGGGK ADVFLWRNKKIS  VLG ATAIWILFE++EYHLLT VCH  IL LA+LFLW 
Sbjct  61   HVLGGGKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWS  120

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA +FI K+ P IP+VHIPEEPVLQ ASAL  ++NH  A LR IASG+DL
Sbjct  121  NAHTFINKTPPRIPQVHIPEEPVLQVASALTMEINHGFAVLRSIASGKDL  170



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 4/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            +SLVE I DKIH HDSSSS   + +            +KV RLFGR++P+H VLG GK A
Sbjct  13   KSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHHVLGAGKPA  68

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLW NAS+FI KS
Sbjct  69   DIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKS  128

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP V +PE+ VL+FASAL+ ++N  LA LR+IASGRDL
Sbjct  129  PPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDL  169



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +KVRRLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +C
Sbjct  61   SKVRRLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLC  120

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            HGLI+ALA LFLW NAS+FI KSAPHIPEVHIPE+PVL+FA+ L+N++N   A LR+IA+
Sbjct  121  HGLIVALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAA  180

Query  630  GRDL  641
            GRDL
Sbjct  181  GRDL  184



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 4/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            +SLVE I DKIH HDSSSS   + +            +KV RLFGR++P+H VLG GK A
Sbjct  13   KSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHHVLGAGKPA  68

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLW NAS+FI KS
Sbjct  69   DIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKS  128

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP V +PE+ VL+FASAL+ ++N  LA LR+IASGRDL
Sbjct  129  PPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDL  169



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 4/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            +SLVE I DKIH HDSSSS   + +            +KV RLFGR++P+H VLG GK A
Sbjct  13   KSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHHVLGAGKPA  68

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLW NAS+FI KS
Sbjct  69   DIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKS  128

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP V +PE+ VL+FASAL+ ++N  LA LR+IASGRDL
Sbjct  129  PPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDL  169



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 4/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            +SLVE I DKIH HDSSSS   + +            +KV RLFGR++P+H VLG GK A
Sbjct  13   KSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHHVLGAGKPA  68

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLW NAS+FI KS
Sbjct  69   DIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKS  128

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP V +PE+ VL+FASAL+ ++N  LA LR+IASGRDL
Sbjct  129  PPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDL  169



>gb|ABC69764.1| unknown [Vitis pseudoreticulata]
Length=211

 Score =   170 bits (431),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I DK+  HDSSSS      ++    +   + AKV RLFGR++PVH VLGGGK A
Sbjct  13   ESLLEKITDKLQGHDSSSSDSDSDSDKAASPSP--IKAKVFRLFGREKPVHTVLGGGKHA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLW NA++FI KS
Sbjct  71   DVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSNATTFINKS  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP+VHIPE+P LQ  +AL+ ++NH  A LR+IASGRDL
Sbjct  131  PPRIPDVHIPEDPFLQAVNALRIEINHGFAVLREIASGRDL  171



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 127/161 (79%), Gaps = 5/161 (3%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E I++KIH HDSSSS    ++            AKV R+FGR++PVHKVLGGGK A
Sbjct  13   ESMMEKISEKIHGHDSSSSDSDNEKSSPSA-----FKAKVYRIFGREKPVHKVLGGGKPA  67

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWRNKKIS GVLGGATA+WILFE+LEYHLLT VCH  ILALA+LFLW NA++FI K+
Sbjct  68   DVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTFINKA  127

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIPEVHIPE+PVLQFASAL+ ++N     LR++ASG+DL
Sbjct  128  PPHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVASGKDL  168



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 124/163 (76%), Gaps = 5/163 (3%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            + ESL+E   DK+H      + DS     + +  TSS+ AKV RLFGR++PVHK+LGGGK
Sbjct  11   KAESLIEKTRDKVH-----GADDSSSSSSDDEGKTSSLKAKVFRLFGREKPVHKLLGGGK  65

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             ADVF+WRNK+IS GVLG ATAIW+LFE+LEYHLLT VCHGLI+ LAVLFLW NAS+FI 
Sbjct  66   PADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNASTFIN  125

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS P IPEV +PE+PVLQFAS  +  +N   A LRD+ASGR+L
Sbjct  126  KSPPRIPEVSVPEKPVLQFASDARVAINQTFALLRDVASGRNL  168



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I DK+  HDSSSS      ++    +   + AKV RLFGR++PVH VLGGGK A
Sbjct  13   ESLLEKITDKLQGHDSSSSGSDSDSDKPASPSP--IKAKVFRLFGREKPVHTVLGGGKHA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLW NA++FI KS
Sbjct  71   DVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSNATTFINKS  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEVHIPE+P LQ  +AL+ ++N   A LRDIASGRDL
Sbjct  131  PPRIPEVHIPEDPFLQAVNALRIEINCGFAVLRDIASGRDL  171



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + A V RLFGRQ+PVHKV GGGK ADVFLWRNKKIS GVLGGATA W+LFE+LEYHLLT 
Sbjct  45   VTAAVYRLFGRQKPVHKVFGGGKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTL  104

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI++LAVLFL+ NA +F+ K+ P IPEV+IPE+PVLQFASAL+ ++N   A LRDI
Sbjct  105  VCHCLIVSLAVLFLYSNAIAFMHKTPPRIPEVYIPEDPVLQFASALRIEINRAFAVLRDI  164

Query  624  ASGRDL  641
            ASGRDL
Sbjct  165  ASGRDL  170



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT 
Sbjct  45   LKSKVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTL  104

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL LAVLFLW NAS+FI KS P IP+VHIPE+PVL+FASAL+ ++N   A LRDI
Sbjct  105  VCHFLILGLAVLFLWSNASTFINKSPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDI  164

Query  624  ASGRDL  641
            ASGRDL
Sbjct  165  ASGRDL  170



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssds---ekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            +  + ESL++ I++KIH HDSSSSSDS   EK + +   + SS+ +K+ RLFGR++PVH 
Sbjct  8    EESKGESLMDKISEKIHGHDSSSSSDSDNDEKLKPKSPSSPSSIKSKIYRLFGREKPVHH  67

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXN  494
            VLGGGK AD+FLWRNKK+S GVLG ATA+W+LFE++EYHLLT +CHG ILALA+LFLW N
Sbjct  68   VLGGGKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALAILFLWSN  127

Query  495  ASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            AS+FI KS PHIPEVHIPEEPVLQ A+AL+ ++N+  A LRDIASGRDL
Sbjct  128  ASTFINKSPPHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDL  176



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E ESL++ I++KIH H   SSS S+ E+E+K  + SS+ AKV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLLDKISEKIH-HGGDSSSSSDDEDEKKASSLSSLQAKVYRLFGREKPVHKVLGGGK  80

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             AD+F+WRNKK+S GVLGG TA+W+LFE+++YHLLT  CH LI+ LAVLFLW NAS FI 
Sbjct  81   PADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFCHILIVVLAVLFLWSNASIFIN  140

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS P IPEVHIPEE +LQ AS L+ ++N     LRDIASGRDL
Sbjct  141  KSPPKIPEVHIPEEHILQLASGLRIEINRAFTCLRDIASGRDL  183



>gb|KJB06452.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=186

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  335
            ES++E I++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR++P+H VLGGGK 
Sbjct  13   ESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRERPLHHVLGGGKP  72

Query  336  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKK  515
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLW N  +FI K
Sbjct  73   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTFIHK  132

Query  516  SAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            + P IP+VH+PEEP LQ ASAL  ++N  L  LRDIASGR+L
Sbjct  133  TPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNL  174



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  EXESLVEXIADKIH-RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
            E ES+VE + DKI+ +    SSS   ++E+EK     ++ AK+ RLFGR++PVHKVLGGG
Sbjct  7    EHESVVESVMDKINDKLHHDSSSSDSEDEKEKISPVEAVKAKIYRLFGREKPVHKVLGGG  66

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFI  509
            K ADVFLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLW NAS+FI
Sbjct  67   KPADVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFI  126

Query  510  KKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             KS P IPEV +PE+ VL  ASAL+ ++N  L  LRDIASG++L
Sbjct  127  NKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKEL  170



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 135/176 (77%), Gaps = 4/176 (2%)
 Frame = +3

Query  123  ESAMAXX---DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  293
            ESA+A     +  E ESL++ I++KIH H S SSS S+ E+E+K  + SS+ AKV RLFG
Sbjct  9    ESALATEPAVEVVERESLLDKISEKIH-HGSDSSSSSDDEDEKKASSPSSLKAKVYRLFG  67

Query  294  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  473
            R++PVHKVLGGGK AD+F+WRNKK+S  VLGG TA+W+LFE+ EYHLLT +CH LI  +A
Sbjct  68   REKPVHKVLGGGKPADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIA  127

Query  474  VLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            VLFLW NAS FI KS P IPEVHIPEEP+LQ AS L+ ++N     LRDIASGRDL
Sbjct  128  VLFLWSNASMFIHKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDL  183



>gb|KJB24635.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=179

 Score =   164 bits (415),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E I+ KIH HDSSSSSDS+ + E+    +S + AK+ RLFGR++PVH VLGGGK A
Sbjct  13   ESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRERPVHHVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LFLW NA +FI KS
Sbjct  72   DVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLFLWSNAHTFIHKS  131

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+H+PEEP LQ ASAL  ++N  L  LRDIASGR+L
Sbjct  132  PPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNL  172



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekee----eekkkttssMDAKVRRLFGRQ  299
            MA  +    ESL+E I +K H  DSSSS    ++              + AK+ RLFGR+
Sbjct  1    MAEHEESVAESLLEKITEKFHGGDSSSSDSDGEKSSVVDSSAPSAAEVVKAKIYRLFGRE  60

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKK+S   LGGATAIW+LFE++EYHLLT VCH LIL+LA++
Sbjct  61   KPVHKVLGGGKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIM  120

Query  480  FLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FLW NAS+FI KS P IPEV IPE+  +  A +L+ ++N   A LRDIA GRDL
Sbjct  121  FLWSNASTFINKSPPRIPEVSIPEDMAVNIALSLRYEINWAFAALRDIALGRDL  174



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +3

Query  165  LVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQADV  344
            L+E IADK+H HDSSSSSDS+ E+ E   ++  + AK+ RLFGR++PVHKVLGGGK ADV
Sbjct  15   LMEKIADKLHGHDSSSSSDSDNEKSEPSASS--VKAKIYRLFGREKPVHKVLGGGKPADV  72

Query  345  FLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKSAp  524
             LWRNKKIS GVLGGATA+W+LFE+LEYHLLT V H LIL+LA+LFLW NAS+FI K+ P
Sbjct  73   LLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFISKTPP  132

Query  525  hipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            HIPEV IPE+  +  A +L+ ++N   A LRDIASGRDL
Sbjct  133  HIPEVSIPEDLAVNVALSLRYEINRAFAILRDIASGRDL  171



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   166 bits (421),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AKV RLFGR++PVH VLGGGK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT 
Sbjct  41   IKAKVFRLFGREKPVHHVLGGGKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTL  100

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LILALAVLFLW NA++FI KS P IPEV IP++PV++FA AL+ ++N   A LRDI
Sbjct  101  VCHLLILALAVLFLWSNAATFINKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDI  160

Query  624  ASGRDL  641
            ASGR+L
Sbjct  161  ASGREL  166



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 120/160 (75%), Gaps = 3/160 (2%)
 Frame = +3

Query  162  SLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL+E I DK+H HD SSS    ++ E    +   + A + RLFGR++PVHKVLGGGK AD
Sbjct  14   SLMEKIVDKLHGHDDSSSDSDNEKSEPSASS---IKANIYRLFGRERPVHKVLGGGKPAD  70

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKSA  521
            VFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLW NAS FI K+ 
Sbjct  71   VFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSNASIFINKAP  130

Query  522  phipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            P I EV IP++  +  A +L+ ++N  +A LR+I SG+DL
Sbjct  131  PRILEVSIPKDLAVNVALSLRYEINRAIAVLREITSGQDL  170



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  EXESLVEXIADKIH-RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
            E ES+VE + DKI+ +    SSS   ++E+EK     ++ AK+ RLFGR++PVHKVLGGG
Sbjct  7    EHESVVESVMDKINDKLHHDSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHKVLGGG  66

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFI  509
            K AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLW NAS+FI
Sbjct  67   KPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFI  126

Query  510  KKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             KS P IPEV +PE+ VL  ASAL+ ++N  L  LRDIASG++L
Sbjct  127  NKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKEL  170



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 127/166 (77%), Gaps = 3/166 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES +E IA+KIH H SSSSS S   ++EK  +   + +KV RLFGR++PVHKVLG
Sbjct  8    EEKHGESFMEKIAEKIHGHGSSSSSSSSDSDDEKTAS---LKSKVYRLFGREKPVHKVLG  64

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GG+ AD+ LW++KK+S GVLGG TAIW+LF++LEYHLL  VCHGLIL L  LFL+ NAS+
Sbjct  65   GGQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLYSNAST  124

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FIKKS P IP V IPEEPVL FASAL+  +N   A LRDIASG+DL
Sbjct  125  FIKKSPPKIPVVSIPEEPVLNFASALRIGINEGFATLRDIASGKDL  170



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  335
            ES++E I++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR++P+H VLGGGK 
Sbjct  13   ESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRERPLHHVLGGGKP  72

Query  336  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKK  515
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLW N  +FI K
Sbjct  73   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTFIHK  132

Query  516  SAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            + P IP+VH+PEEP LQ ASAL  ++N  L  LRDIASGR+L
Sbjct  133  TPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNL  174



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            +  + ESL++ + DK+H HDSSSSS S    +      + +  KV RLFGR++PVHK+LG
Sbjct  8    EENKGESLIDKVTDKMHAHDSSSSSSSSSSSDSDDDRKARLKTKVYRLFGREKPVHKILG  67

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GG+ ADV LWR+KK+S GVLGGA A+W LF+VLEYH LT +CHGLIL L  +FL  NAS+
Sbjct  68   GGQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMFLLSNAST  127

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            F+KK+ P IPEV +PEEPVL+FASAL+ ++N   A LRDIASG+DL
Sbjct  128  FVKKAPPRIPEVVLPEEPVLKFASALRIEINRVFADLRDIASGKDL  173



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E IA+KI R     SS S   ++EKK + SS+ AK+ RLFGR+ PVH VLGGGK A
Sbjct  13   ESIIEKIAEKI-RGYDDGSSSSSDSDDEKKASLSSLKAKIYRLFGRENPVHNVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+ LWRNKK+S GVLG ATA W+LFE+LEYHLL+ VCH  ILALAVLFLW NAS+FI K+
Sbjct  72   DIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLFLWSNASTFIHKT  131

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEVHIPEE VLQ AS L+ ++N   A LRDIASGRDL
Sbjct  132  PPRIPEVHIPEEHVLQLASGLRTEINRGFAALRDIASGRDL  172



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I +K H  DSSSSSDS+ E+     ++  + +K+ RLFGR++PVH VLGGGK A
Sbjct  11   ESLMEKITEKFHHEDSSSSSDSDNEKSLPSSSS--VQSKIYRLFGREKPVHTVLGGGKPA  68

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW NA++FI KS
Sbjct  69   DIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFINKS  128

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIPEV IPE+  +  A +L+ D+N   A LRDIASGRDL
Sbjct  129  PPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDL  169



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+K+H     SSS S+ + E+ + + SS+ AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESLMEKIAEKLH--GDDSSSSSDSDNEKSESSASSVKAKIYRLFGREEPVHKVLGGGKPA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATA+W+LFE+L+YHLLT V H L+L+LA+LFLW NAS+FI K 
Sbjct  71   DVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSNASTFINKI  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIPEV IPE+  +  A +L+ ++N   A LRDIASGRDL
Sbjct  131  PPHIPEVSIPEDVAINVALSLRYEINRAFAVLRDIASGRDL  171



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 126/170 (74%), Gaps = 9/170 (5%)
 Frame = +3

Query  159  ESLVEXIADKIH---------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            ESL+E IADK H           D+ +   + KEE       SS+  KV RLFGR++PVH
Sbjct  13   ESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEPSSVKDKVWRLFGREKPVH  72

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
            KV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++LAVLFLW 
Sbjct  73   KVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWS  132

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA++FI K  PHIPE+H+P++P LQ ASAL+ ++N  LA LR+IASGR+L
Sbjct  133  NATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGREL  182



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  335
            ES++E I++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR++P+H VLGGGK 
Sbjct  13   ESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRERPLHHVLGGGKP  72

Query  336  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKK  515
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLW N  +FI K
Sbjct  73   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTFIHK  132

Query  516  SAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            + P IP+VH+PEEP LQ ASAL  ++N  L  LRDIASGR+L
Sbjct  133  TPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNL  174



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 124/171 (73%), Gaps = 5/171 (3%)
 Frame = +3

Query  144  DRKEXESLVEXIADKI-----HRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            + KE ESL+E I DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  489  XNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             NA++FI K  PHIPE H+ EEP+L+ ASAL+ ++NH L  LR+IASGRDL
Sbjct  129  SNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDL  179



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 124/171 (73%), Gaps = 5/171 (3%)
 Frame = +3

Query  144  DRKEXESLVEXIADKI-----HRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            + KE ESL+E I DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  489  XNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             NA++FI K  PHIPE H+ EEP+L+ ASAL+ ++NH L  LR+IASGRDL
Sbjct  129  SNATTFINKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDL  179



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +KV RLFGR++P+H VLGGGKQADVFLWRNKKIS   LG AT IWILFE+LEYHLLT 
Sbjct  45   LKSKVFRLFGREKPIHHVLGGGKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTL  104

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH +ILALA LFLW NAS+FI K  P IP+VHIPE+P+LQFASAL+ ++N   + LRDI
Sbjct  105  VCHFVILALAGLFLWSNASTFINKRPPKIPQVHIPEDPILQFASALRIEINRAFSVLRDI  164

Query  624  ASGRDL  641
            ASGRDL
Sbjct  165  ASGRDL  170



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   164 bits (414),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E I++KIH +DSSSSSDS+ + E+    +S + AK+ RLFGR++PVH VLGGGK A
Sbjct  13   ESMMEKISEKIHGNDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRERPVHHVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LA+LFLW NA +FI KS
Sbjct  72   DVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLFLWSNAHTFIHKS  131

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+H+PEEP LQ ASAL  ++N  L  LRDIASGR+L
Sbjct  132  PPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNL  172



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 124/167 (74%), Gaps = 6/167 (4%)
 Frame = +3

Query  159  ESLVEXIADKIH------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            ESL+E IADK H        +S + +     + E +  T ++  KV RLFGR++PVHKV 
Sbjct  13   ESLLEKIADKFHGDDSSSSSESDTETKKPAVKSEVEPETETLKNKVWRLFGREKPVHKVF  72

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK ADVFLWRNKKIS  V+GGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLW NA+
Sbjct  73   GGGKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNAT  132

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI K  PHIPEVH+PE P+LQ ASAL+ ++N  L  LR+IASGR+L
Sbjct  133  TFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGREL  179



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            KV RLFGR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH
Sbjct  62   KVWRLFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICH  121

Query  453  GLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASG  632
             LI++LAVLFLW NA++FI K  PHIPE+H+P++P LQ ASAL+ ++N  LA LR+IASG
Sbjct  122  ILIISLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASG  181

Query  633  RDL  641
            R+L
Sbjct  182  REL  184



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E I+ KIH HDSSSSSDS+ + E+    +S + AK+ RLFGR++PVH VLGGGK A
Sbjct  13   ESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRERPVHHVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LFLW NA +FI KS
Sbjct  72   DVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLFLWSNAHTFIHKS  131

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+H+PEEP LQ ASAL  ++N  L  LRDIASGR+L
Sbjct  132  PPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNL  172



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + KE ESLVE + DKI          S    +   + T+ + AK+ RLFGR++PVH VLG
Sbjct  3    EHKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVHSVLG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLW NAS+
Sbjct  63   GGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNAST  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P+IPEV IPE+  +  A +L+ ++N   A LR+I  G DL
Sbjct  123  FINKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDL  168



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E I+ KIH HDSSSSSDS+ + E+    +  + AK+ RLFGR++PVH VLGGGK A
Sbjct  13   ESVMEKISGKIHGHDSSSSSDSDSDHEKPASPSP-VKAKIYRLFGRERPVHHVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS GVLGGATAIW+LFE++EY+LLT VCH  IL+LA++FLW NA +FI KS
Sbjct  72   DVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMFLWSNAHTFIHKS  131

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEVH+PEEP LQ A+AL  ++N  L  LRDIASGR+L
Sbjct  132  PPRIPEVHLPEEPFLQVAAALTFELNQALKLLRDIASGRNL  172



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + +  +S VE + +KIH HDSSSSSDS+ + E+     S + AK+ RLFGR++P+H VLG
Sbjct  4    ETESKQSAVESVMEKIHGHDSSSSSDSDSDHEKPASPIS-VKAKIYRLFGRERPLHHVLG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LAVLFLW N  +
Sbjct  63   GGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWSNVHT  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ P IP+VH+PEEP LQ ASAL  ++N  L  LRDIASGR+L
Sbjct  123  FIHKTPPRIPQVHLPEEPFLQIASALTIELNQALKLLRDIASGRNL  168



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            + V RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VC
Sbjct  47   SNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVC  106

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            H LILALA LFLW NAS+FI KS P IP+VHIPEEPVL+FASAL+ ++N   A LRDIAS
Sbjct  107  HFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIAS  166

Query  630  GRDL  641
            GRDL
Sbjct  167  GRDL  170



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I +K H  DSSSSSDS+ E+ +   ++  + +K+ RLFGR++PVH VLGGGK A
Sbjct  11   ESLMEKITEKFHHEDSSSSSDSDNEKSQPSSSS--VQSKIYRLFGREKPVHTVLGGGKPA  68

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW NA++FI KS
Sbjct  69   DIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFINKS  128

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIPEV IPE+  +  A +L+ D+N   A LRDIASGRDL
Sbjct  129  PPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDL  169



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 8/169 (5%)
 Frame = +3

Query  159  ESLVEXIADKIH--------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            ESL+E IADK H          D+ +     K E E +    ++  KV RLFGR++PVHK
Sbjct  13   ESLMEKIADKFHGDDSSSSSESDTETKKPVVKSEVEAEPEPETLKNKVWRLFGREKPVHK  72

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXN  494
            V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLW N
Sbjct  73   VFGGGKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSN  132

Query  495  ASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            A++FI K  PHIPEVH+PE P+LQ ASAL+ ++N  L  LR+IASGR+L
Sbjct  133  ATTFINKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGREL  181



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            +    ES++E IA+KI  HD  SSS S+ ++E+K   +S + AK+ RLFGR++PVH VLG
Sbjct  8    EESTAESIMEKIAEKIRGHDDGSSSSSDSDDEKKSSPSS-LKAKIYRLFGREKPVHSVLG  66

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S G LG ATA W+LFE+LEYHLLT VCH  I ALAVLFLW NAS+
Sbjct  67   GGKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLFLWSNAST  126

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ P IP VHIPEEPV+Q AS L+ +VN     LRDIASGRDL
Sbjct  127  FIHKTPPRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDIASGRDL  172



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +KV RLFGR++P+H VLG GK ADVFLWR+KKIS GVLGGATA+WILFE+LEYHL+T 
Sbjct  38   LKSKVYRLFGREKPIHHVLGAGKPADVFLWRDKKISAGVLGGATALWILFEMLEYHLITL  97

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH LIL+LA+LFLW NAS+FI KS P+IPEV +PE+ VL+ ASAL+ +VN  L  +RDI
Sbjct  98   LCHTLILSLAILFLWSNASTFINKSPPNIPEVVLPEKCVLEVASALRIEVNRALDVVRDI  157

Query  624  ASGRDL  641
            ASG DL
Sbjct  158  ASGNDL  163



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHR-HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  335
            +SLV+ I++KIH   D+SSSSDS+ + +E     +S+ AK+ RLFGR++PVHKV GGGK 
Sbjct  13   DSLVDRISEKIHGGDDTSSSSDSDSQVKEAASPPASVKAKIYRLFGREKPVHKVFGGGKP  72

Query  336  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKK  515
            AD+FLWRNKKIS  VLGGATA+W+LFE+LEYHLLT VCH  ILAL++LFLW NA++FI K
Sbjct  73   ADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLLFLWSNATTFINK  132

Query  516  SAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
              PHIPEV +PE+P L+ AS L+ ++N   A LR+IASGRDL
Sbjct  133  RPPHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIASGRDL  174



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            + V RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VC
Sbjct  46   SNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVC  105

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            H LILALA LFLW NAS+FI KS P IP+VHIPEEPVL+FASAL+ ++N   A LRDIAS
Sbjct  106  HFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIAS  165

Query  630  GRDL  641
            GRDL
Sbjct  166  GRDL  169



>ref|XP_006374287.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52084.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=193

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  ESAMAXXD-RKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            E  MA  +  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  480  FLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FLW NAS+F+ KS P IPEV +PE+ V + AS L+ ++N   A L DIASGRDL
Sbjct  126  FLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDL  179



>ref|XP_010439153.1| PREDICTED: reticulon-like protein B1 isoform X2 [Camelina sativa]
Length=199

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+I
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  186

Query  624  ASGRDL  641
            ASGR+L
Sbjct  187  ASGREL  192



>ref|XP_006374288.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52085.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=199

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  ESAMAXXD-RKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            E  MA  +  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  480  FLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FLW NAS+F+ KS P IPEV +PE+ V + AS L+ ++N   A L DIASGRDL
Sbjct  126  FLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDL  179



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLG ATAIW+LFE++EYHLLT 
Sbjct  44   VKAKIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTL  103

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LA+LFLW NAS+FI KS+PHIPEV IPE+  +  A +L+ ++N   A LRDI
Sbjct  104  VCHCLILSLAILFLWSNASTFINKSSPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDI  163

Query  624  ASGRDL  641
            ASGR+L
Sbjct  164  ASGREL  169



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T 
Sbjct  50   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITL  109

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LAV FLW NAS+FI KS P IP+V + E  VL  ASAL+ ++N     LRDI
Sbjct  110  VCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDI  169

Query  624  ASGRDLXM  647
            ASGRDL M
Sbjct  170  ASGRDLKM  177



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 132/170 (78%), Gaps = 7/170 (4%)
 Frame = +3

Query  153  EXESLVEXIADKIHR-------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            E ESL++ I++KIH          SS   + ++++ +K ++ SSM +KV RLFGR++PVH
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEYKEKKTKKPESPSSMKSKVYRLFGREKPVH  81

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
            KVLGGGK AD+F+W++KKIS GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW 
Sbjct  82   KVLGGGKPADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWS  141

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N  L+ LR+IASGRDL
Sbjct  142  NATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDL  191



>ref|XP_011073415.1| PREDICTED: reticulon-like protein B1 isoform X2 [Sesamum indicum]
Length=172

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 9/166 (5%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K+ ESL+E IADK+H HDSSSSS S   +++K  +   + AKV RLFGR++PVH+VLG
Sbjct  8    EEKKDESLIEKIADKVHGHDSSSSSSSSDSDDDKTSS---LKAKVYRLFGREKPVHRVLG  64

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLW +  +
Sbjct  65   GGKPADIFLWXXXX------GGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSIMT  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P IPEV IPEEP L+FASAL+ ++NH  A LRDIASGRDL
Sbjct  119  FINKSPPRIPEVSIPEEPALKFASALRVEINHGFAVLRDIASGRDL  164



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekee-eekkkttssMDAKVRRLFGRQQPV  308
            MA       ES++E I++ IH HDSSSSS     + E+K  + SS+ AK+ RLFGR++PV
Sbjct  1    MAEHHENPIESVMEKISETIHAHDSSSSSSDSDSDSEKKPTSPSSVKAKIFRLFGRERPV  60

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H VLGGGK ADV LWRNKKIS  VLG ATAIW+LFE++EYHLLT  CH LIL+LAVLFLW
Sbjct  61   HHVLGGGKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLW  120

Query  489  XNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             NA +FI K+ P IP++H+PEEP L  ASAL  ++N  LA LRDIASG+DL
Sbjct  121  SNAHTFINKTPPRIPQIHLPEEPFLLVASALTLEINRGLAVLRDIASGKDL  171



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  ESAMAXXD-RKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            E  MA  +  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  480  FLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FLW NAS+F+ KS P IPEV +PE+ V + AS L+ ++N   A L DIASGRDL
Sbjct  126  FLWSNASNFLNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDL  179



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +3

Query  147  RKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGG  326
             +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR++PVHKVLGG
Sbjct  7    EREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKPVHKVLGG  65

Query  327  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSF  506
            GK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLW NAS+F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNF  125

Query  507  IKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            + KS P IPEV +PE+ V + AS L+ ++N   A L DIASGRDL
Sbjct  126  LNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDL  170



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   162 bits (409),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 131/171 (77%), Gaps = 8/171 (5%)
 Frame = +3

Query  153  EXESLVEXIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            E ESL++ I++KIH           S    D ++++ +K ++ SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDDDDDKKEKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  489  XNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N  L+ LR+IASGRDL
Sbjct  142  SNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDL  192



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + KE ESLVE + DKI          S    +   + T+ + AK+ RLFGR++PVH VLG
Sbjct  3    EHKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVHSVLG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLW NAS+
Sbjct  63   GGKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNAST  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P+IPEV IPE+  +  A +++ ++N   A LR+I  G DL
Sbjct  123  FINKSPPNIPEVKIPEDLAVNVARSVRFEINRGFATLREIGLGHDL  168



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 125/171 (73%), Gaps = 5/171 (3%)
 Frame = +3

Query  144  DRKEXESLVEXIADKI-----HRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            +  E ESL+E I DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYNEEESLIEKIEDKIHFDHFSSSSSDSDTEKKPASAPEAASPSSVKAAIWRLFGREKPV  68

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            H+V GGGK ADVFLWRNKK+S  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  489  XNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             NA++FI K  PHIPEVH+PEEP+L+ ASAL+ ++N+ L  LR+IASGRDL
Sbjct  129  SNATTFINKKRPHIPEVHLPEEPILEIASALRIEINYTLRVLREIASGRDL  179



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  462  LALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            L+LA+LFLW NA++FI KS P IPEV IPE+  + FA +L+ ++N   A LRDIASGRDL
Sbjct  109  LSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDL  168



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +KV RLFGR++P+H VLGGGK ADVFLWRNKKIS  VLG ATA WILFE+LEYHLLT 
Sbjct  46   LKSKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTL  105

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH  ILALAVLFLW NAS+FI K+ P IP+VHIPEEPVLQ A+AL+ ++N   A LRDI
Sbjct  106  VCHLAILALAVLFLWSNASTFINKAPPKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDI  165

Query  624  ASGRDL  641
            ASG+DL
Sbjct  166  ASGKDL  171



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES++E I +K+H H+SSSS   +++E+        + AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESVMEKINEKLHDHNSSSSDSEDEKEKISSVDA--VKAKIYRLFGRERPVHKVLGGGKPA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLW NAS+FI KS
Sbjct  71   DIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTFINKS  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP+V +PE+ VL  A+AL+ ++N  L   RDIASG++L
Sbjct  131  PPQIPDVILPEDIVLGVAAALRIEINRALEVFRDIASGKEL  171



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+I
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREI  186

Query  624  ASGRDL  641
            ASGR+L
Sbjct  187  ASGREL  192



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 8/171 (5%)
 Frame = +3

Query  153  EXESLVEXIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  308
            E ESL++ I++KIH           S    D +K++ +K ++ SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEDKKKKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  309  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  488
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  489  XNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N  L+ LR+IASGRDL
Sbjct  142  SNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDL  192



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E ESL++ I++K+H    SSSSD ++++++  ++ SSM +KV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDEKKKKSSESPSSMKSKVYRLFGREKPVHKVLGGGK  81

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW NA+ FI 
Sbjct  82   PADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIN  141

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+IASGRDL
Sbjct  142  KSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDL  184



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T 
Sbjct  56   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITL  115

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LAV FLW NAS+FI KS P IP+V + E  VL  ASAL+ ++N     LRDI
Sbjct  116  VCHLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDI  175

Query  624  ASGRDL  641
            ASGRDL
Sbjct  176  ASGRDL  181



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IADKIH     SSS   + +       SS+ AK+ RLFGR++PVH V GGGK A
Sbjct  13   ESLMEKIADKIH--FDRSSSSDSEVKPAAAPEASSVKAKIWRLFGREKPVHHVFGGGKPA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLW NA++FI K 
Sbjct  71   DVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATTFINKK  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIPEV +PEEP+L+ ASAL  ++N  L+ LR+IA+G+DL
Sbjct  131  RPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDL  171



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  125

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +I+ LAVLFLW NA+ FI KS P IPE+HIPEEP+LQ AS L+ ++N   + LR+I
Sbjct  126  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEIHIPEEPILQLASGLRIEINRGFSSLREI  185

Query  624  ASGRDL  641
            ASGR+L
Sbjct  186  ASGREL  191



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT 
Sbjct  67   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTL  126

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+I
Sbjct  127  ICHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  186

Query  624  ASGRDL  641
            ASGR+L
Sbjct  187  ASGREL  192



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 9/166 (5%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K+ ESL+E IADK+H HDSSSSS S   +++K  +   + AKV RLFGR++PVH+VLG
Sbjct  8    EEKKDESLIEKIADKVHGHDSSSSSSSSDSDDDKTSS---LKAKVYRLFGREKPVHRVLG  64

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLW +  +
Sbjct  65   GGKPADIFLWXX------XXGGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSIMT  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P IPEV IPEEP L+FASAL+ ++NH  A LRDIASGRDL
Sbjct  119  FINKSPPRIPEVSIPEEPALKFASALRVEINHGFAVLRDIASGRDL  164



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 121/166 (73%), Gaps = 4/166 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + KE ES+++ I+DK+H         S    +   + T+++ AK+ RLFGR++PVH VLG
Sbjct  3    EHKEEESVMDTISDKLHG----RGGSSSSSLDSDGERTAAVKAKIYRLFGREKPVHSVLG  58

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLW NAS+
Sbjct  59   GGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWSNAST  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P+IPEV IPE+  +  A +L+ ++N   A LR+I  G DL
Sbjct  119  FINKSPPNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQGHDL  164



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  462  LALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            L+LA+LFLW NA++FI KS P IPEV IPE+  + FA +L+ ++N   A LRDIASGRDL
Sbjct  109  LSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDL  168



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT 
Sbjct  28   LKNKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTL  87

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            + H  ILALAVLFLW NAS+FI KS P IP+VHIPEEPVLQ ASA++ ++N   A LRDI
Sbjct  88   ISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDI  147

Query  624  ASGRDL  641
            ASGRDL
Sbjct  148  ASGRDL  153



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++ VH VLGGGK ADVFLWRNKKIS GV+GGATA+W+LFE+LEYHLL+ 
Sbjct  45   IKAKIYRLFGRERSVHNVLGGGKPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSL  104

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LA+LFLW NAS+FI K+ P IPE  IPE+  +  A +L+ ++N   A LR+I
Sbjct  105  VCHCLILSLAILFLWSNASTFINKAPPRIPEASIPEDLAVNVALSLRYEINRAFAVLREI  164

Query  624  ASGRDL  641
            ASGRDL
Sbjct  165  ASGRDL  170



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 124/161 (77%), Gaps = 4/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ I +KIH HDSSSS   + + +        + +K+ RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDTSAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLW NAS FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIP+VHIPE+PV++ ASAL+ ++N  +A LRDIASGRDL
Sbjct  133  LPHIPQVHIPEDPVIEIASALRVEINRAIAVLRDIASGRDL  173



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ I +KI  HDSSSSSDS+ ++  K      + +K+ RLFGR++PVHKVLGGGK A
Sbjct  7    ESLMDKITEKIRGHDSSSSSDSDDDKPSKVDA---VKSKIFRLFGREKPVHKVLGGGKPA  63

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWRNK++S  VLGGAT +W+LFE+LEYHL+T VCH  IL LA+LFLW NAS+F+ KS
Sbjct  64   DVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTFVNKS  123

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP++ +PE+ VL+ ASAL+ ++N  LA L DIA+GRD+
Sbjct  124  PPEIPQIVLPEKYVLEIASALRIEINRALAVLHDIAAGRDV  164



>ref|XP_006413534.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54987.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=222

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT 
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+I
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  185

Query  624  ASGRDL  641
            ASGRDL
Sbjct  186  ASGRDL  191



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 121/161 (75%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ IA+KIH HD SSSS     ++++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  73   ESLLDKIAEKIHGHDDSSSSSDSDSDKKESSS---IKEKVFRLFGREKPVHSVLGGGKPA  129

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWRNKKIS GVLG ATAIWI FE+LEYHLLT VCH  IL LAVLFLW NA +FI K+
Sbjct  130  DVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFIHKA  189

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP VHIPEEP+LQFASAL  ++N   A LR I SGRDL
Sbjct  190  PPRIPVVHIPEEPILQFASALTIEINRGFAALRAIGSGRDL  230



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   158 bits (400),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T 
Sbjct  41   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITL  100

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LAV FLW  AS+FI KS P IP+V IPE+ VL+ ASAL+ ++N     LRDI
Sbjct  101  VCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDI  160

Query  624  ASGRDL  641
            ASGRDL
Sbjct  161  ASGRDL  166



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 130/169 (77%), Gaps = 6/169 (4%)
 Frame = +3

Query  153  EXESLVEXIADKIH------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            E ESL++ I++KIH         SS   D +K++++K  + SSM +KV RLFGR++PVHK
Sbjct  22   ERESLMDKISEKIHGGDSSSSSSSSDDDDDKKKKKKKPSSPSSMQSKVYRLFGREKPVHK  81

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXN  494
            VLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLW N
Sbjct  82   VLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSN  141

Query  495  ASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            A+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+IASGRDL
Sbjct  142  ATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDL  190



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +KV RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT 
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+I
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  185

Query  624  ASGRDL  641
            ASGRDL
Sbjct  186  ASGRDL  191



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   158 bits (400),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkt--tssMDAKVRRLFGRQQPVHKV  317
            + KE +S++E +++K+H   SSSSSDS+ +++    +   ++M AK+ RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSSAAAMKAKIYRLFGRERPVHSV  62

Query  318  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNA  497
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLW NA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  498  SSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            S+FI KS P+IPEV IPE+  +  A +L+ ++N   A LR+I  GRDL
Sbjct  123  STFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDL  170



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T 
Sbjct  52   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITL  111

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LAV FLW  AS+FI KS P IP+V IPE+ VL+ ASAL+ ++N     LRDI
Sbjct  112  VCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDI  171

Query  624  ASGRDL  641
            ASGRDL
Sbjct  172  ASGRDL  177



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            ++ RLFGR++PVH VLGGG  ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  VCH
Sbjct  46   QIYRLFGREKPVHTVLGGGTPADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCH  105

Query  453  GLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASG  632
             LIL+LA+LFLW NAS+FI KS P IPEV IPE+  +  A +L+ ++N     LRDIASG
Sbjct  106  CLILSLAILFLWSNASTFIHKSPPRIPEVSIPEDVAVNVALSLRYEINRGFTVLRDIASG  165

Query  633  RDL  641
            RDL
Sbjct  166  RDL  168



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeee---kkkttssMDAKVRRLFGRQQ  302
            MA       ESL+E I DKIH HDSSSSS S   +++   + +++SS+ +K+ RLFGR++
Sbjct  1    MAETQHHHEESLLEKITDKIHGHDSSSSSSSSDSDDDKKSEAQSSSSLKSKIYRLFGREK  60

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVHKVLGGGK AD+FLWRNKK+S GVLG AT IWILFE++EYHLLT VCH LILALA+LF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALALLF  120

Query  483  LWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LW NAS+FI KS P +P+V+IPE+PVLQ A+AL+ ++N  LA LR+IASGRDL
Sbjct  121  LWSNASTFINKSPPRLPDVYIPEDPVLQVAAALRIEINRGLAILREIASGRDL  173



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H
Sbjct  54   KVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISH  113

Query  453  GLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASG  632
              ILALAVLFLW NAS+FI KS P IP+VHIPEEPVLQ ASA++ ++N   A LRDIASG
Sbjct  114  LAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASG  173

Query  633  RDL  641
            RDL
Sbjct  174  RDL  176



>gb|KJB37517.1| hypothetical protein B456_006G208500 [Gossypium raimondii]
Length=210

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 120/170 (71%), Gaps = 6/170 (4%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M   + K  ESL+  +A+KIH HDSSS SD +K  E        + AKV RLFGR++ VH
Sbjct  1    MGEHEEKHEESLMVKLAEKIHGHDSSSDSDIDKPSESS------IKAKVFRLFGRERSVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
             V GGGK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLW 
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA +FI KS   IPEVHIP++PV++FA AL+ + N      RDIASGR+L
Sbjct  115  NAYAFINKSPLCIPEVHIPKDPVIEFAEALRFETNLAFTVFRDIASGREL  164



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  159  ESLVEXIADKIH-RHdsssssdsekeeee-kkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            ESL+E I +K H RH SS     +++          ++ AK+ RLFGR++PVHKVLGGGK
Sbjct  7    ESLLEKITEKFHGRHSSSVVDSDDEKSSRGPSAAAEAVKAKIYRLFGREKPVHKVLGGGK  66

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             ADVFLWRNKK+S    G  TAIW+ FE++EYHL+T VCHGLIL+LA++FLW NA++FI 
Sbjct  67   PADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAIIFLWCNATTFIS  126

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS PH+PEV I E+  L    +L+  +N  L  LRDIASGRDL
Sbjct  127  KSRPHVPEVSISEDLALNVVLSLRYVINRGLVALRDIASGRDL  169



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MA  +  + ES++E IADKIH HDSSS SD +K           + +K+ RLFGR +PVH
Sbjct  1    MAEHEAPKAESIMEKIADKIHHHDSSSDSDDDKPAPSS------LKSKIYRLFGRDKPVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
            KVLGGGK AD+ LWR+KKIS  VLG  TA+W LFE+ EYHLL+ +CH L+L + VLFLW 
Sbjct  55   KVLGGGKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NAS+FI K+ P IP+V IPE PVL+ ASALK ++N  LA LR+IASG+DL
Sbjct  115  NASTFINKAPPKIPDVRIPEGPVLEIASALKYEINRGLASLREIASGKDL  164



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 121/170 (71%), Gaps = 6/170 (4%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M   + K   SL+E +A+KIH HDSSS SD++K  E        + AKV RLFGR++ VH
Sbjct  1    MGEHEEKHEGSLMEKLAEKIHGHDSSSDSDNDKPSESS------IKAKVFRLFGRERSVH  54

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
             V GGGK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLW 
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWS  114

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA +FI KS   IPEVHIP++PV++FA AL+ + N     LRDIA GRDL
Sbjct  115  NAYAFINKSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVLRDIAPGRDL  164



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT 
Sbjct  46   VKAKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTL  105

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LILALAVLFLW NAS+FI KS P IP+V +PE+ VL  A+AL+ ++N  L   RDI
Sbjct  106  VCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDI  165

Query  624  ASGRDL  641
            ASG++L
Sbjct  166  ASGKEL  171



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT 
Sbjct  45   LKSKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTL  104

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LILALA+LFLW NAS+FI KS P IPEVHIPEEPVLQ A+AL+ ++N   A LRDI
Sbjct  105  VCHCLILALALLFLWSNASTFINKSPPRIPEVHIPEEPVLQIAAALRIEINQGFAVLRDI  164

Query  624  ASGRDL  641
            ASGRDL
Sbjct  165  ASGRDL  170



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 116/165 (70%), Gaps = 1/165 (1%)
 Frame = +3

Query  147  RKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGG  326
             +E E +VE + DKI          S    +       ++ +K+ RLFGR++PVHKVLGG
Sbjct  7    EREREPVVESMVDKI-TEKIHDHHSSSSSSDSDDDKLDAVKSKIFRLFGREKPVHKVLGG  65

Query  327  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSF  506
            GK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VC+  I +LAVLFLW NAS+F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLWSNASNF  125

Query  507  IKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            + KS P IPEV +PE+ V + AS L+ ++N  +A L DIASGRDL
Sbjct  126  LNKSPPKIPEVLLPEKCVREVASGLRIEINRGVAVLHDIASGRDL  170



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 120/163 (74%), Gaps = 3/163 (2%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E ESL+E I++K+H       S S     + +    S+ +KV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMEKISEKVHH---KGDSSSSSSSSDDENEKKSLKSKVYRLFGRERPVHKVLGGGK  78

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ LAVLFLW NA+ FI 
Sbjct  79   PADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMFIH  138

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS P IPEVHIPEEP+LQ AS L+ ++N   + LR IASGRDL
Sbjct  139  KSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLRQIASGRDL  181



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL  ATAIWILFE+LEYHLLT 
Sbjct  76   VQAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTL  135

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH LI +LAVLFLW NAS+FI KS PHIPEV +PE+P+L+  + L++++N  LA L DI
Sbjct  136  ICHSLIFSLAVLFLWANASTFINKSPPHIPEVILPEKPILEAVAGLRHELNRGLAMLHDI  195

Query  624  ASGRDL  641
            A G+DL
Sbjct  196  AMGKDL  201



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH H  SSSS S   +++KK ++  +  KV RLFGR+QPVHKV G
Sbjct  4    EHKHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTKVYRLFGREQPVHKVFG  61

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLW +AS+
Sbjct  62   GGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSAST  121

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ PHIPEVHIPEE VLQ AS L+ ++N     LRDIASGRDL
Sbjct  122  FIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDL  167



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+KI       SS S   + EK ++  ++  K+ RLFGR++PVHKV GGGK A
Sbjct  13   ESLLEKIAEKI---HDHDSSSSSDSDNEKMESPMAVKDKIYRLFGREKPVHKVFGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LILAL+VLFLW NA SFI KS
Sbjct  70   DVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLFLWSNAHSFINKS  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+H+ EE  L  ASAL+N+VN     LRDIA GRDL
Sbjct  130  PPQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALGRDL  170



>gb|KCW72350.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=232

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeee------kkkttssMDAKVRRLFGRQQPVHKVL  320
            ESL+E  A+KIH H    SS S   ++E                K+ RLFGR++PVHKVL
Sbjct  12   ESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRERPVHKVL  71

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLW NA+
Sbjct  72   GGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNAT  131

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  132  TFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH H  SSSS S  + ++ KK++S +  KV RLFGR+QPVHKV G
Sbjct  4    EHKHEESIMEKIAEKIHGHGDSSSSSSSSDSDDDKKSSS-LKTKVYRLFGREQPVHKVFG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLW +AS+
Sbjct  63   GGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSAST  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ PHIPEVHIPEE VLQ AS L+ ++N     LRDIASGRDL
Sbjct  123  FIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDL  168



>ref|XP_010105716.1| Reticulon-like protein [Morus notabilis]
 gb|EXC05936.1| Reticulon-like protein [Morus notabilis]
Length=264

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 133/163 (82%), Gaps = 3/163 (2%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E ESL+E IADKIH HDSSSSSDS+ ++  K +    + AK+ RLFGR++P+HKVLGGGK
Sbjct  7    EPESLIEKIADKIHGHDSSSSSDSDDDKPSKVEE---VQAKIFRLFGREKPIHKVLGGGK  63

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             ADVFLWRNKK+S GVLGGAT +W+LFE+LEYHL+T VCH LIL+LA+LFLW NAS+ I 
Sbjct  64   PADVFLWRNKKLSAGVLGGATILWVLFELLEYHLITLVCHILILSLALLFLWSNASTLIN  123

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS P IPEV IPE+ VL+ AS L+ +VN+ LA LR+IASG++L
Sbjct  124  KSPPQIPEVRIPEKIVLEVASVLRAEVNYALAVLRNIASGKEL  166



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +KV RLFGR++PVHKVLGGGK A++F+W+NKK+S GVLG ATA W+LFE++EYHLLT 
Sbjct  66   MQSKVYRLFGREKPVHKVLGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTL  125

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+I
Sbjct  126  LCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREI  185

Query  624  ASGRDL  641
            ASGRDL
Sbjct  186  ASGRDL  191



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+KIH HDSSSSS+SE E+ +       + AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREKPVHKVLGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA +FI K+
Sbjct  70   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKT  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEVH+PEE  L  AS+L+N++N     LR IA GRDL
Sbjct  130  PPQIPEVHVPEEAFLTIASSLRNELNQAFVILRSIALGRDL  170



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%), Gaps = 4/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ I +KIH HDSSSS   + + +        + +K+ RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDASAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLW NAS FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIP+VHIPE PV++ ASAL+ ++N  +A LR+IASGRDL
Sbjct  133  LPHIPQVHIPEGPVVEIASALRVEINRAIAVLREIASGRDL  173



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  123  ESAMAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            +S  A    +  +SL+E I++KIH H+SSSSS S+ + E+ +   S    KV R+FGR++
Sbjct  4    QSESAGSTVEHDKSLMEKISEKIHDHESSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  62

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLF
Sbjct  63   PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLF  122

Query  483  LWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LW NA SFI K+ P IPEVH+PEEP LQ AS L+  +N   A L DIASGR+L
Sbjct  123  LWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGREL  175



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeee------kkkttssMDAKVRRLFGRQQPVHKVL  320
            ESL+E  A+KIH H    SS S   ++E                K+ RLFGR++PVHKVL
Sbjct  12   ESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRERPVHKVL  71

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLW NA+
Sbjct  72   GGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNAT  131

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  132  TFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeee------kkkttssMDAKVRRLFGRQQPVHKVL  320
            ESL+E  A+KIH H    SS S   ++E                K+ RLFGR++PVHKVL
Sbjct  12   ESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRERPVHKVL  71

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLW NA+
Sbjct  72   GGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNAT  131

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  132  TFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH 
Sbjct  67   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  126

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+IASGR
Sbjct  127  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGR  186

Query  636  DL  641
            DL
Sbjct  187  DL  188



>gb|KCW72351.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=224

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeee------kkkttssMDAKVRRLFGRQQPVHKVL  320
            ESL+E  A+KIH H    SS S   ++E                K+ RLFGR++PVHKVL
Sbjct  12   ESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRERPVHKVL  71

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLW NA+
Sbjct  72   GGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNAT  131

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  132  TFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  314
            D KE +S+++ I++K H      SS S D +K+       T +M AK+ RLFGR++PVH 
Sbjct  3    DHKEEQSVMDKISEKFHGGDSSSSSDSDDEKKKGSSSASATEAMKAKIYRLFGRERPVHS  62

Query  315  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXN  494
            VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLW N
Sbjct  63   VLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSN  122

Query  495  ASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            ASSFI KS P+IPEV IPE+  +  A  L+ ++N   A LR+I  G DL
Sbjct  123  ASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDL  171



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH 
Sbjct  65   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  124

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+IASGR
Sbjct  125  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGR  184

Query  636  DL  641
            DL
Sbjct  185  DL  186



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH 
Sbjct  70   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  129

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +I+ LAVLFLW NA+ FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+IASGR
Sbjct  130  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGR  189

Query  636  DL  641
            DL
Sbjct  190  DL  191



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH HD SSSS S+ ++E+K  + SSM  K+ RLFGR++PVHKV G
Sbjct  4    EHKHEESIMEKIAEKIHGHDGSSSSSSDSDDEKKSASPSSMKKKIYRLFGREKPVHKVFG  63

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  W+LFE+LEY+LLT   H  ILALA LFLW +A +
Sbjct  64   GGKPADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAIT  123

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ PHIPE+HIPEE VLQ AS L+ ++N     LRDIASGRDL
Sbjct  124  FIHKTPPHIPEIHIPEEVVLQLASGLRIEINRGFTTLRDIASGRDL  169



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH HD SSSS    ++++       +  K+ RLFGR+QPVHK+ G
Sbjct  4    EHKHEESIMEKIAEKIHGHDDSSSSSDSDDDKKSST----LKTKIYRLFGREQPVHKIFG  59

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLW +A++
Sbjct  60   GGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSATT  119

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ PHIPEVHIPEE VLQ AS L+ ++N     LRDIASGRDL
Sbjct  120  FIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTALRDIASGRDL  165



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  K+ RLFGR++PVHKVLGGGK ADVFLWR+KK++ GVLG AT IW LFE+LEYHLLT 
Sbjct  45   VKTKIYRLFGREKPVHKVLGGGKPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTL  104

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI+A+AVLFLW NAS+FI  + PHIPEV +P++ VL  ASAL+ ++N  L  LRDI
Sbjct  105  VCHILIVAVAVLFLWSNASAFINTAPPHIPEVVLPKDIVLSVASALRIEINRALEILRDI  164

Query  624  ASGRDL  641
            ASG+DL
Sbjct  165  ASGKDL  170



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +3

Query  132  MAXXDRKEX--ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  305
            MA  D+ +   ES+ E I++K H HDSSS SDS+ E+ +    +  + +K+ RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKTHGHDSSSVSDSDHEKSKSNPDS--LKSKIYRLFGREKP  58

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEY+L+T VCH LILALA+LFL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFL  118

Query  486  WXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            W NAS+FI KS P IPEV IPEEPVLQ A+AL+ ++N   + LRDIASGRDL
Sbjct  119  WSNASTFINKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDIASGRDL  170



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeee------kkkttssMDAKVRRLFGRQQPVHKVL  320
            ESL+E  A+KIH H    SS S   ++E                K+ RLFGR++PVHKVL
Sbjct  12   ESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRERPVHKVL  71

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLW NA+
Sbjct  72   GGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNAT  131

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDL
Sbjct  132  TFIHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDL  178



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M AK+ RLFGR++PVH VLGGGK AD+ LWRN+KIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  49   MKAKIYRLFGRERPVHSVLGGGKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTL  108

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LA+LFLW NAS+FI KS P+IPEV IPE+  +  A +L+ ++N   A LR+I
Sbjct  109  VCHCLILSLAILFLWSNASTFINKSPPNIPEVKIPEDVAVNVALSLRYEINRGFATLREI  168

Query  624  ASGRDL  641
              GRDL
Sbjct  169  GHGRDL  174



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVH VLGGGK AD+FLWRNKKIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  36   VKAKIYRLFGREKPVHSVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  95

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH  IL L +LFLW NAS+FI KS P+IPEV IPE+  +  A +L+ ++N   A LRDI
Sbjct  96   LCHCFILTLGILFLWSNASAFINKSPPNIPEVRIPEDLAVNVARSLRYEINRGFASLRDI  155

Query  624  ASGRDL  641
              GRDL
Sbjct  156  GQGRDL  161



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  55   VKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITL  114

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI  LAV +LW NAS+FI KS P IP+V IPE+ VL+ ASAL+ ++N     LRDI
Sbjct  115  VCHLLITFLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRDI  174

Query  624  ASGRDL  641
            ASGRDL
Sbjct  175  ASGRDL  180



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            E+L+E I +KIH    SSSSDS+ E+ +  +   ++ +K+ RLFGR++PVH++LGGGK A
Sbjct  8    ETLIEKIKEKIH-GGDSSSSDSDDEKSKASEVAEAVKSKIFRLFGREKPVHRILGGGKPA  66

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLW+NKK S  VLGGATAIW+LFE++EYHLLT VCH LIL+LA+LFLW NA++FI KS
Sbjct  67   DVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFINKS  126

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIPEV IPE+  +  A +L+ ++N   A LR+IA+GRD+
Sbjct  127  PPHIPEVIIPEDLSVNIALSLRYEINRGFAVLREIAAGRDV  167



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LAV +LW NAS+FI KS P IP V IPE+ VL+ ASAL+ ++N     LR+I
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPXVQIPEKTVLELASALRIELNKGFYVLRBI  161

Query  624  ASGRDL  641
            ASGRDL
Sbjct  162  ASGRDL  167



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 125/166 (75%), Gaps = 3/166 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E I++KIH HD SSSS S+ ++++   +   +  K+ RLFGR+QP+HK+ G
Sbjct  4    EHKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLHKLFG  60

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLW +AS+
Sbjct  61   GGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSAST  120

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS  HIPEVHIPE+ VLQ AS L+ ++N     LRDIASGRDL
Sbjct  121  FIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDL  166



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +3

Query  123  ESAMAXXDRK-EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  299
            ES M     K   ES++E IA+KIH H  SSSS S   +++KK ++  +  KV RLFGR+
Sbjct  9    ESIMEKIAEKIHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTKVYRLFGRE  66

Query  300  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  479
            QPVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVL
Sbjct  67   QPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVL  126

Query  480  FLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FLW +AS+FI K+ PHIPEVHIPEE VLQ AS L+ ++N     LRDIASGRDL
Sbjct  127  FLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDL  180



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +3

Query  153  EXESLVEXIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            E ESL+E +++KIH      SSSSS  ++ E++   +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGGDSSSSSSSDDENEKKSSSSPRSLKSKVYRLFGRERPVHKVLG  81

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLW NA+ 
Sbjct  82   GGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P IPEVHIPEEP+LQ AS L+ ++N   + LR+IASGRDL
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLREIASGRDL  187



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  159  ESLVEXIADKIH-----RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            ES +E IADKIH        SS S    K     + + SS+ AK+ RLFGR++PVH V G
Sbjct  14   ESFMEKIADKIHFDRSSSSSSSDSDSEVKPAAAPEASPSSVKAKIWRLFGREKPVHHVFG  73

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLW NA++
Sbjct  74   GGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATT  133

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRD  638
            FI K  PHIPEV +PEEP+L+ ASAL  ++N  L+ LR+IA+G+D
Sbjct  134  FINKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKD  178



>ref|XP_007218267.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19466.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=280

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  123  ESAMAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            +S  A    +  +SL+E I++KIH H+SSSSS S+ + E+ +   S    KV R+FGR++
Sbjct  86   QSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  144

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLF
Sbjct  145  PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLF  204

Query  483  LWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LW NA SFI K+ P IPEVH+PEEP LQ AS L+  +N   A L DIASGR+L
Sbjct  205  LWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGREL  257



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            + RLFGR+QPVHKVLGGGK AD+FLWR+KK+S GVLG ATAIW+LFE++EYHLL+ VCH 
Sbjct  54   IYRLFGREQPVHKVLGGGKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHI  113

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LIL LA++FLW NASSFI KS P IPEV + E+ V+  A+AL+ + N   A LRDI SG+
Sbjct  114  LILGLAIIFLWSNASSFINKSPPKIPEVVVREDIVIGVANALRIEFNRAFAILRDIVSGK  173

Query  636  DL  641
            DL
Sbjct  174  DL  175



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            A+V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VC
Sbjct  43   ARVFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVC  102

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            HGLI +L +LFLW NASSFI KS+P IPEV IPE+ V+  A + + ++N   A LR IA 
Sbjct  103  HGLIFSLGLLFLWSNASSFINKSSPRIPEVVIPEDLVVNIALSTRYEINRAFANLRQIAL  162

Query  630  GRDL  641
            GRD+
Sbjct  163  GRDI  166



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 5/161 (3%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            +SL++ I++KIH HDSSS S+ EK +         + AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   QSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREKPVHKVLGGGKPA  67

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA +FIKKS
Sbjct  68   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFIKKS  127

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+H+PEEP L  AS+L+N++N     LR IA GRDL
Sbjct  128  PPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDL  168



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 5/161 (3%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            +SL++ I++KIH HDSSS S+ EK +         + AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   QSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREKPVHKVLGGGKPA  67

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA +FIKKS
Sbjct  68   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFIKKS  127

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+H+PEEP L  AS+L+N++N     LR IA GRDL
Sbjct  128  PPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDL  168



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I++KIH HDSSSSS+SE E+ +       + AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREKPVHKVLGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA +FI K+
Sbjct  70   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKT  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEVH+PE+  L  AS+L+N++N     LR IA GRDL
Sbjct  130  PPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDL  170



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MA       ES++  I++KIH H+SSSS      E++   + S  D K+ RLFGR++PVH
Sbjct  1    MAEQSENPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLW 
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA SFI KS P IP+VH+PEEPVLQ ASAL  ++N     LR IA+G+DL
Sbjct  119  NAHSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDL  168



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = +3

Query  123  ESAMAXXDRKEXESLVEXIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  296
            E   A    ++  SL+E I DKIH   HDSSSSS S+ + E+ +K T S+ AKV R+FGR
Sbjct  4    EKEHAGSSVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  477  LFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LFLW NA +FI K+ PHIP+VH+PEEP LQ AS L+  +N   A L DIASGRDL
Sbjct  124  LFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDL  178



>gb|KCW46474.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=218

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            +KV RLFGR++PVHKVLGGGK AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VC
Sbjct  48   SKVYRLFGREKPVHKVLGGGKPADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVC  107

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            H LI  LA++FLW +AS+ I KS P+IPEV +PE+ VL+ AS L+ + N  LA LR+IAS
Sbjct  108  HILIATLAIIFLWASASTHITKSPPNIPEVQLPEKCVLEVASVLRFEANRGLALLREIAS  167

Query  630  GRDL  641
            GR+L
Sbjct  168  GREL  171



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT 
Sbjct  194  VKAKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTL  253

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LILALAVLFLW NAS+FI KS P IP+V +PE+ VL  A+AL+ ++N  L   RDI
Sbjct  254  VCHILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDI  313

Query  624  ASGRDL  641
            ASG++L
Sbjct  314  ASGKEL  319



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + ++ ES+ E + DKI      S S S   + + K + S++ AK+ RLFGR+ PVHKVLG
Sbjct  7    EHEKHESVAESVMDKITEKFHGSDSSSSDSDNDIKSSASAVKAKIYRLFGRETPVHKVLG  66

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWR+KK +  VLG ATAIW+LFE+LEYHLL+ VCH LIL LA+LFLW NAS+
Sbjct  67   GGKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAILFLWSNAST  126

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P  PEV I E  V+  ASAL  + N   A LR++ASG+DL
Sbjct  127  FISKSRPKFPEVIISENVVVSVASALTIEFNRAFAILREVASGKDL  172



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHG  138

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LI AL VLFLW NASSFI K+ P IPEV IPE+ V+  A + + ++N   A LR IA GR
Sbjct  139  LIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  198

Query  636  DL  641
            DL
Sbjct  199  DL  200



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            E+L+E I +KIH    SSSSDS+ E+ +      ++ +K+  LFGR++PVH++LGGGK A
Sbjct  7    ETLIEQINEKIHGDGDSSSSDSDDEKSKASVVAEAVKSKIYHLFGREKPVHQILGGGKPA  66

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLW+NKK S  VLGGATAIWILFE++EYHLLT VCH LIL+LA+LFLW NA++ I KS
Sbjct  67   DVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWSNATTLINKS  126

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             PHIP V IPE+  +  + +L  ++N   + LR+IA+GR+L
Sbjct  127  PPHIPVVSIPEDLAVNISRSLTYEINRGFSVLREIATGREL  167



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  123  ESAMAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  302
            +S  A    +  +SL+E I++KIH H+SSSSS S+ + E+ +   S    KV R+FGR++
Sbjct  86   QSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  144

Query  303  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  482
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLF
Sbjct  145  PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLF  204

Query  483  LWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LW NA SFI K+ P IPEVH+PEEP LQ AS L+  +N   A L DIASGR+L
Sbjct  205  LWSNAHSFIHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGREL  257



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LAV +LW NAS+FI KS P IP+V IPE+ VL+ ASAL+ ++N     LR+I
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRNI  161

Query  624  ASGRDL  641
            ASGRDL
Sbjct  162  ASGRDL  167



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++PVHKVLGGGK A
Sbjct  13   ESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREKPVHKVLGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA +FI K+
Sbjct  70   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKT  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEVH+PE+  L  AS+L+N++N     LR IA GRDL
Sbjct  130  PPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDL  170



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M AK+ RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  1    MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  60

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI++LA+LFLW NASSFI KS P+IPEV IPE+  +  A  L+ ++N   A LR+I
Sbjct  61   VCHCLIVSLAILFLWSNASSFINKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREI  120

Query  624  ASGRDL  641
              G DL
Sbjct  121  GHGHDL  126



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MA       ES++  I++KIH H+SSSS      E++   + S  D K+ RLFGR++PVH
Sbjct  1    MAEQSEDPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLW 
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA SFI KS P IP+VH+PEEPVLQ ASAL  ++N     LR IA+G+DL
Sbjct  119  NAHSFINKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDL  168



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+KIH HDSSSSS+SE E+ +       + AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREKPVHKVLGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW N  +FI K+
Sbjct  70   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNVHTFINKA  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +P IPE+H+PEE  L  AS+L+N++N     LR IA GRDL
Sbjct  130  SPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDL  170



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ I +K H   SSSSS  ++       ++SS+ AK+ RLFGR++PVH VLGGGK A
Sbjct  13   ESLMDKITEKFHGSSSSSSSSDDEAGRAAGSSSSSVKAKIYRLFGREKPVHSVLGGGKPA  72

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+ LWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLW NAS+F+ K 
Sbjct  73   DLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKC  132

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P+IPEV IPE+  +  A +L+ ++N   A LR I  GRDL
Sbjct  133  PPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDL  173



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+KIH HDSSSSS+SE E+ +       + AK+ R+FGR++PVHKVLGGGK A
Sbjct  13   ESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREKPVHKVLGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG AT IW+LFE++EYHLL+ +CH  ILAL  LFLW NA +FI K+
Sbjct  70   DVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINKT  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +P IPE+H+PEE  L  AS+L+N++N     LR IA GRDL
Sbjct  130  SPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDL  170



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            +RKE ES+++ I +K H     SSS S  ++E +  ++SS+ AK+ RLFGR++PVH VLG
Sbjct  3    ERKE-ESVMDKITEKFH---GGSSSSSSSDDEGRSGSSSSVKAKIYRLFGREKPVHSVLG  58

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLW NAS+
Sbjct  59   GGKPADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASA  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            F+ K  P+IPEV IPE+  +  A +L+ ++N   A LR I  GRDL
Sbjct  119  FVNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDL  164



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 130/175 (74%), Gaps = 2/175 (1%)
 Frame = +3

Query  123  ESAMAXXDRKEXESLVEXIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  296
            E   A    ++  SL+E I DKIH   HDSSSSS S+ + E+ +K T S+ AKV R+FGR
Sbjct  4    EKEHAGSPVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  477  LFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LFLW NA +FI K+ PHIP+VH+PEEP LQ AS L+  +N   A L DIASGRDL
Sbjct  124  LFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDL  178



>gb|EPS71452.1| hypothetical protein M569_03311 [Genlisea aurea]
Length=242

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 5/161 (3%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESLV+ I +KIH HDSSSSS    ++         + AK+ RLFGR++ VH +LGGGK A
Sbjct  3    ESLVDKIVEKIHAHDSSSSSSDSDDDRRSS-----LKAKINRLFGRERSVHGLLGGGKAA  57

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWRNK +S+GV+GGATAIWILF+VLEYH LT V H LIL L + F+W N S+F+KKS
Sbjct  58   DVLLWRNKNVSLGVIGGATAIWILFDVLEYHFLTLVSHALILGLVIFFVWSNGSTFLKKS  117

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP+V IPE+PVL+F S  + ++N   + LRDIASG+DL
Sbjct  118  PPRIPQVIIPEKPVLEFVSDARIEINRAFSSLRDIASGKDL  158



>gb|KJB24287.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=208

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M+  + K  ESL+E I++K+  HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW 
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA++FI KS P IPEV IP++PVL+FA AL+ ++N   A LRDIASGRDL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDL  167



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
             K+ RLFGR++P+HKVLGGGK AD+FLWR+KK++ GVLG AT IW LFE+LEYHLLT VC
Sbjct  47   TKIYRLFGREKPLHKVLGGGKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVC  106

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            H LI+A+AVLFLW NAS+FI  + P IPEV +P++ VL  ASAL+ ++N  L  LRDIAS
Sbjct  107  HILIVAVAVLFLWSNASAFINTAPPQIPEVVLPKDIVLGVASALRIEINRALEILRDIAS  166

Query  630  GRDL  641
            G+DL
Sbjct  167  GKDL  170



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS G+LGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHG  138

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LI AL VLFLW NASSFI K+ P IPEV IPE+ V+  A + + ++N   A LR IA GR
Sbjct  139  LIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  198

Query  636  DL  641
            DL
Sbjct  199  DL  200



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  EXESLVEXIADKIH-RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
            E ESL+E +++KIH + DSSSS D  +++     +  S+ +KV RLFGR++PVHKVLGGG
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVLGGG  77

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFI  509
            K AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLW NA+ FI
Sbjct  78   KPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFI  137

Query  510  KKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             KS P IPEVHIPEEP+LQ AS L+ ++N   + L +IASGRD+
Sbjct  138  HKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDI  181



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E  SL+E I++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++PVHKVLGGGK
Sbjct  12   EEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREKPVHKVLGGGK  68

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA +FI 
Sbjct  69   PADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFIN  128

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            K+ P IPEVH+PE+  L  AS+L+N++N     LR IA GRDL
Sbjct  129  KTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDL  171



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 117/161 (73%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ IA+KIH H  SSSS     E+++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  15   ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLW NA +FI K+
Sbjct  72   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  131

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDL
Sbjct  132  PPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDL  172



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 117/161 (73%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ IA+KIH H  SSSS     E+++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  1    ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  57

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLW NA +FI K+
Sbjct  58   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  117

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDL
Sbjct  118  PPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDL  158



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M+  + K  ESL+E I++K+  HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW 
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA++FI KS P IPEV IP++PVL+FA AL+ ++N   A LRDIASGRDL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDL  167



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH 
Sbjct  69   VYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  128

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +I+ LAVLFLW NA+ FI KS P IPEVHIPEEPVLQ AS L+ ++N     LR+IASGR
Sbjct  129  MIVVLAVLFLWSNATMFIHKSPPKIPEVHIPEEPVLQLASGLRIEINRGFYSLREIASGR  188

Query  636  DL  641
            DL
Sbjct  189  DL  190



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LI +L VLFLW NASSFI KS P IPEV IPE+ V+  A + + ++N   A LR IA GR
Sbjct  135  LIFSLGVLFLWSNASSFIHKSPPKIPEVVIPEDLVVNIAVSTRYEINRAFANLRRIALGR  194

Query  636  DL  641
            D+
Sbjct  195  DI  196



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  162  SLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL+E   +KIH  D  S+S S   +++K     S  +KV RLFGR++PVHKVLGGGK AD
Sbjct  12   SLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKPAD  71

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKSA  521
            +FLWR+KK+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW +AS+ I KS 
Sbjct  72   IFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTHITKSP  131

Query  522  phipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            P+IPEV +PE+ VL+ AS L+ + N  LA LR+IASGR+L
Sbjct  132  PNIPEVQLPEKCVLEVASVLRFEANRGLALLREIASGREL  171



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 126/166 (76%), Gaps = 5/166 (3%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVHKV G
Sbjct  4    EHKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVHKVFG  58

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLW +A++
Sbjct  59   GGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWSSATT  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ PHIPEVHIPE+ VLQ AS L+N++N     LR+IA GRDL
Sbjct  119  FIHKTPPHIPEVHIPEDVVLQLASGLRNEINRGFTLLRNIALGRDL  164



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +3

Query  153  EXESLVEXIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            E ESL+E I++KIH      SSSSSD ++ E++   +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKISEKIHHKGDSSSSSSSDDDENEKKSSPSPKSLKSKVYRLFGRERPVHKVLG  81

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLW NA+ 
Sbjct  82   GGKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P IPEVHIPEEP+LQ  S L+ ++N   + LR+IASGRDL
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLVSGLRIEINCGFSSLREIASGRDL  187



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+KIH      SS S   + EK ++ S++ AK+ RLFGR++PVHKVLGGG  A
Sbjct  13   ESLMEKIAEKIHD--HHDSSSSSDSDHEKPESPSALKAKIYRLFGREKPVHKVLGGGLPA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LI +LA +FLW NA +F+KKS
Sbjct  71   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMFLWSNAHAFMKKS  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEVH+ EE  L  ASAL+N++N     LR IA GRDL
Sbjct  131  PPKIPEVHVKEEHFLLIASALRNELNQAFVILRSIALGRDL  171



>gb|AFK42129.1| unknown [Medicago truncatula]
Length=199

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  KV RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT 
Sbjct  51   LKNKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTL  110

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            + H  ILALAVLFLW NAS+FI KS P IP+VHIPEEPVLQ ASA++ ++N   A LRDI
Sbjct  111  ISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDI  170

Query  624  ASGR  635
            ASG+
Sbjct  171  ASGK  174



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +3

Query  153  EXESLVEXIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            E ESL+E +++KIH      SSSSSD E E++    +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPKSLKSKVYRLFGRERPVHKVLG  81

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+F+W++KK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLW NA+ 
Sbjct  82   GGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P IPEVHIPEEP+LQ AS L+ ++N  ++ LR+IASGRD+
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDI  187



>ref|XP_002317731.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
 gb|EEE95951.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
Length=240

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 120/161 (75%), Gaps = 6/161 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESLV+ I +KI  HDSSSSSDS+ E+ +       + +K+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKIFRLFGREKPVHKVLGGGKPA  66

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I +LAVLFLW N S F+ K 
Sbjct  67   DVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFSLAVLFLWSNTSDFLNKP  126

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEV +PE+ V + AS L+ ++N   A LRDIASGRDL
Sbjct  127  PPKIPEVVLPEKCVREVASVLRIEINRGFAVLRDIASGRDL  167



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  +CHGLI
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLI  143

Query  462  LALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             +L VLFLW NASSFI KS P IPEV IPE+ V+  A + ++++N   A LR+IA GRD+
Sbjct  144  FSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNVALSTRHEINRAFANLREIALGRDI  203



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH 
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHV  121

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +I+ALAVLFLW NA+ FI KS P IPEVHIPE+P+LQ AS L+ ++N   + L +IASGR
Sbjct  122  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  181

Query  636  DL  641
            DL
Sbjct  182  DL  183



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 135/170 (79%), Gaps = 4/170 (2%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            MA  D+++  S++E + +K+H H++SS SDS+  + + +  +  + +K+ RLFGR++PVH
Sbjct  1    MAEHDKED--SVIESVMEKVHDHETSSDSDSDHGKPKSESDS--LKSKIYRLFGREKPVH  56

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
            KVLGGGK AD+FLWRNKKIS G+LGGATAIW+LFE+LE HLLT VC+ LILAL +LFLW 
Sbjct  57   KVLGGGKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWS  116

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NAS+FI KS PHIPEV IPEEPVLQ A+AL  ++N   + LRDIASGRDL
Sbjct  117  NASTFINKSPPHIPEVRIPEEPVLQIAAALTTEINWAFSVLRDIASGRDL  166



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LI +L +LFLW NASSFI KS P IPEV IPE+ V+  A + + ++N   A LR IA GR
Sbjct  135  LIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  194

Query  636  DL  641
            D+
Sbjct  195  DI  196



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ 
Sbjct  41   VKAKIYRLFGREKPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSL  100

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH  ILAL  LFLW NA +FIKKS P IPE+H+PEE  L  AS+L+N+VN     LR I
Sbjct  101  LCHISILALGGLFLWSNAHTFIKKSPPQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSI  160

Query  624  ASGRDL  641
            A GRDL
Sbjct  161  ALGRDL  166



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH 
Sbjct  71   VYRLFGREKPVHKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHV  130

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +I+ LAVLFLW N + FI KS P IP+VHIPEEPVLQ AS L+ ++N   + LR+IASGR
Sbjct  131  MIVVLAVLFLWSNVTRFIHKSPPKIPQVHIPEEPVLQLASGLRIEINRGFSSLREIASGR  190

Query  636  DL  641
            DL
Sbjct  191  DL  192



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LI +L +LFLW NASSFI KS P IPEV IPE+ V+  A + + ++N   A LR IA GR
Sbjct  135  LIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR  194

Query  636  DL  641
            D+
Sbjct  195  DI  196



>ref|NP_001118533.1| reticulon-like protein B5 [Arabidopsis thaliana]
 gb|AEC10652.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=187

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++PVHKVLGGGK A
Sbjct  13   ESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREKPVHKVLGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA + I K+
Sbjct  70   DVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKT  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +P IPE+H+PEE  L  AS+L+N++N     LR IA GRDL
Sbjct  130  SPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDL  170



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+KIH      SS S   + EK ++ S++ AK+ RLFGR++PVHKVLGGG  A
Sbjct  13   ESLMEKIAEKIHD--HHDSSSSSDSDHEKPESQSALKAKIYRLFGREKPVHKVLGGGLPA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI +LA +FLW NA +F+KKS
Sbjct  71   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMFLWSNAHAFMKKS  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+ + EE  L  ASAL+N++N     LR IA GRDL
Sbjct  131  PPKIPEIQVKEEHFLLIASALRNELNQAFVILRSIALGRDL  171



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + A + RLFGR++PVH+V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT 
Sbjct  44   VKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTL  103

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LILALA+LFLW NA +FIKK+ P IPEVH+PEEP LQ ASA + ++NH  A LR I
Sbjct  104  VCHTLILALAILFLWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSI  163

Query  624  ASGRDL  641
            ASGRDL
Sbjct  164  ASGRDL  169



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E  SL++ I++KIH H   SSS S+ E E+K  + SSM +KV RLFGR++PVHKVLGGGK
Sbjct  68   ERGSLMDKISEKIH-HKGDSSSSSDDESEKKPSSPSSMKSKVYRLFGRERPVHKVLGGGK  126

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ LA LFLW NA+ FI+
Sbjct  127  PADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVTLAALFLWSNATMFIR  186

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS P IPEVHIPE+P+LQ AS L+ ++N   + L +IASGRDL
Sbjct  187  KSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDL  229



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + A + RLFGR++PVH+V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT 
Sbjct  44   VKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTL  103

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LILALA+LFLW NA +FIKK+ P IPEVH+PEEP LQ ASA + ++NH  A LR I
Sbjct  104  VCHTLILALAILFLWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSI  163

Query  624  ASGRDL  641
            ASGRDL
Sbjct  164  ASGRDL  169



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 3/170 (2%)
 Frame = +3

Query  132  MAXXDRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  311
            M+  + K  ESL+E I++K   HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKNKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  312  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWX  491
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW 
Sbjct  58   DVFGGGKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  492  NASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            NA++FI KS P IPEV IP++PVL+FA AL+ ++N   A LRDIASGRDL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDL  167



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            + RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH 
Sbjct  49   IYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHC  108

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LIL+LAVLFLW NAS+FI KS P+IPEV IPE+  +  A +L+ ++N   A LR+I  GR
Sbjct  109  LILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGR  168

Query  636  DL  641
            DL
Sbjct  169  DL  170



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            KV RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGG TAIWILFE L YHLLT VCH
Sbjct  73   KVFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGVTAIWILFECLGYHLLTFVCH  132

Query  453  GLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASG  632
            GLI +L VLFLW NASSFI KS P IPEV IPE+ V+  A + + ++N     LR IA G
Sbjct  133  GLIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFVNLRQIALG  192

Query  633  RDL  641
            RD+
Sbjct  193  RDI  195



>gb|KDO86332.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=213

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + A + RLFGR++PVH+V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT 
Sbjct  44   VKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTL  103

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LILALA+LFLW NA +FIKK+ P IPEVH+PEEP LQ ASA + ++NH  A LR I
Sbjct  104  VCHTLILALAILFLWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSI  163

Query  624  ASGRDL  641
            ASGRDL
Sbjct  164  ASGRDL  169



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            + RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH 
Sbjct  49   IYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHC  108

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LIL+LAVLFLW NAS+FI KS P+IPEV IPE+  +  A +L+ ++N   A LR+I  GR
Sbjct  109  LILSLAVLFLWSNASTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGR  168

Query  636  DL  641
            +L
Sbjct  169  EL  170



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR++PVH+VLGGGK ADVFLWRNKK+S G LG  T IW LFE+ EYHLLT   H LI
Sbjct  52   RLFGRERPVHQVLGGGKPADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLI  111

Query  462  LALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            L LAVLFLW NA +FI KS P IPEV IPEEPVLQFASAL+ ++N   A LRDIASG+DL
Sbjct  112  LTLAVLFLWSNAHAFIHKSPPRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDL  171



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  270  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  449
            AK+ RLFGR++PVHKVLGGGK A++FLWR+KK+S GVLG AT IW LFE+L+YHLLT VC
Sbjct  53   AKIYRLFGRERPVHKVLGGGKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVC  112

Query  450  HGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIAS  629
            H LI+A+ VLFLW NAS+FI  + P IPEV +P + VL  ASAL+ ++N  L  LRDIAS
Sbjct  113  HILIVAITVLFLWSNASAFINTAPPQIPEVVLPRDIVLGVASALRIEMNRILEILRDIAS  172

Query  630  GRDL  641
            G+DL
Sbjct  173  GKDL  176



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVH+VLGGGK ADV LWRNKKIS   LGG T  W+ FE+LEYHLLT 
Sbjct  46   VKAKIFRLFGREKPVHQVLGGGKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTL  105

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VC+ LI++LA+LFLW NA +FI KS P IPEVHIPE+P LQ  SAL  ++N   A LR I
Sbjct  106  VCYTLIVSLAILFLWSNAHTFIHKSPPRIPEVHIPEDPFLQVVSALTIEINQGFAALRSI  165

Query  624  ASGRDL  641
            ASGRDL
Sbjct  166  ASGRDL  171



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH 
Sbjct  63   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHV  122

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +I+ALAVLFLW NA+ FI KS P IPE+HIPE+P+LQ AS L+ ++N   + L +IASGR
Sbjct  123  MIVALAVLFLWSNATMFIHKSPPKIPEIHIPEDPLLQLASGLRIEINRGFSSLHEIASGR  182

Query  636  DL  641
            D+
Sbjct  183  DI  184



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IA+KI       SS S + E EK  + S++ AK+ RLFGR++PVHKVLGGG  A
Sbjct  13   ESLIEKIAEKI---HDHDSSSSSESEHEKPDSPSALKAKIYRLFGREKPVHKVLGGGLPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI ALAVLFL  NA +F+KKS
Sbjct  70   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFLLSNAHAFMKKS  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+HI EE  L  ASAL+N++N     LR IA GRDL
Sbjct  130  PPKIPEIHIKEEHFLLIASALRNELNQAFVILRSIALGRDL  170



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 119/161 (74%), Gaps = 6/161 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESLV+ I +KI  HDSSSSSDS+ E+ +       + +KV RLFGR++PVHKVLGGGK A
Sbjct  13   ESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKVFRLFGRERPVHKVLGGGKPA  66

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I  LAVLFLW N S F+ K 
Sbjct  67   DVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLFLWSNTSDFLNKP  126

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPEV +PE+ V + ASAL+ ++N   A L DIASGRDL
Sbjct  127  PPKIPEVVLPEQCVREVASALRIEINRGFAVLHDIASGRDL  167



>gb|AFK48295.1| unknown [Lotus japonicus]
Length=193

 Score =   149 bits (375),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 119/161 (74%), Gaps = 6/161 (4%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL++ I+DK+H HDSSS SDSEK           +  K+ RLFGR++P+H VLGGGK A
Sbjct  17   ESLLDKISDKLHGHDSSSDSDSEKPSLSS------VKQKIFRLFGREKPLHSVLGGGKPA  70

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LW+NKK+S G LG ATA+W+ FE+LEYHLLT VCH LIL++ +LFLW NA + + K+
Sbjct  71   DVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSITLLFLWSNAHTLLHKA  130

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IP  H+PEEP L+ ASAL+ ++NH  A LRDI +G+D+
Sbjct  131  PPRIPVFHLPEEPFLEIASALRIEINHGFAALRDIGTGKDV  171



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++PVHKVLGGGK A
Sbjct  13   ESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREKPVHKVLGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLW NA + I K+
Sbjct  70   DVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKT  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +P IPE+H+PEE  L  AS+L+N++N     LR IA GRDL
Sbjct  130  SPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDL  170



>gb|AFK34557.1| unknown [Medicago truncatula]
 gb|KEH18780.1| seed maturation protein [Medicago truncatula]
Length=267

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 2/175 (1%)
 Frame = +3

Query  123  ESAMAXXDRKEXESLVEXIADKIHRHdsssssdsekeeee--kkkttssMDAKVRRLFGR  296
            E +    DR   +SL+E I +K+H  D SSS        E  KK    S+  KV RLFGR
Sbjct  6    EKSTVTVDRDGGDSLLEKITEKLHFEDDSSSDSDSHSHSELDKKPVIESVKEKVFRLFGR  65

Query  297  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  476
            ++PVH VLGGGK ADVFLW+NKK+S G L  ATAIW+ FE+LEYH LT +CH  IL LA+
Sbjct  66   EKPVHSVLGGGKPADVFLWKNKKLSAGTLATATAIWVFFELLEYHFLTLICHISILVLAL  125

Query  477  LFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            LFLW NA +F+ K+ PHIP VH+PEEP LQ ASAL+ ++N   + LRDI +G+D+
Sbjct  126  LFLWSNAHTFVHKTPPHIPIVHLPEEPFLQIASALRIEINRGFSALRDIGTGKDV  180



>gb|KJB19086.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=214

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            ++K+ ESL+E IA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PVH V G
Sbjct  6    EKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPVHHVFG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW NA+ 
Sbjct  63   GGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQ  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDLXM  647
            FI KS PHIPEV IP+EPVL+F  AL+ ++N   A LRDIA GRDL M
Sbjct  123  FINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKM  170



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 121/166 (73%), Gaps = 2/166 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH       S S   + +  K ++S+  K+ RLFGR+QP+HKV G
Sbjct  4    EHKHEESIMEKIAEKIHG--HDDGSSSSSSDSDDDKKSASLKTKIYRLFGREQPLHKVFG  61

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLW +A++
Sbjct  62   GGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSATT  121

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS PHIPEVHIPEE VL+ AS L+ ++N     LRDIASGRDL
Sbjct  122  FIHKSPPHIPEVHIPEEVVLELASGLRIEINRGFTVLRDIASGRDL  167



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +3

Query  150  KEXESLVEXIADKIHRHdsssssdsekeeeekkk---ttssMDAKVRRLFGRQQPVHKVL  320
            K  ESL++ + DKIH HDSSS+    +   +K      ++S+ +KV RLFGR++PVH V 
Sbjct  9    KAAESLLDKVPDKIHGHDSSSALPPSEAVRDKGIGGGYSASLKSKVNRLFGREKPVHHVF  68

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK AD+FLWR KK+S GVL   T IW+ FE+LEYHLLT V H LI+ + +LFLW NAS
Sbjct  69   GGGKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIVMLFLWSNAS  128

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI KS PHIP+V IPE+PVLQ ASA+ +++N     +R+IASG+DL
Sbjct  129  TFINKSPPHIPQVQIPEKPVLQIASAITSEINRAFVIVREIASGKDL  175



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            D K  ES++E I +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKVL
Sbjct  4    DHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKVL  63

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK AD+FLWRNKK+S GVLG  TA W+LFE+ EYHLL  +CH  I ALA LFLW NA 
Sbjct  64   GGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNAC  123

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI KS PHIPEVHIPE+P+LQ  S L+ ++N  L  LR+IASG+D+
Sbjct  124  TFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDV  170



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AKV RLFGR++PVH+VLGGGK ADV LWR+KKIS G L  ATAIW++FE++ YHLLT 
Sbjct  44   VKAKVYRLFGREKPVHQVLGGGKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTF  103

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCHGLIL+L +LFLW  A +FI KS P IPEV IPE+  +Q A  L+ ++N  LA LR++
Sbjct  104  VCHGLILSLVILFLWSKACTFINKSPPRIPEVSIPEDQAVQVARTLRYEMNRALAVLREV  163

Query  624  ASGRDL  641
            A GRD+
Sbjct  164  ALGRDV  169



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 126/167 (75%), Gaps = 4/167 (2%)
 Frame = +3

Query  153  EXESLVEXIADKIHRH----dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            E ESL+E +++KIH       SSSS D  +++     +  S+ +KV RLFGR++PVHKVL
Sbjct  23   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVL  82

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLL  +CH +I+ALAVLFLW NA+
Sbjct  83   GGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNAT  142

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             FI KS P IPEVHIPEEP+LQ AS L+ ++N   + L +IASGRD+
Sbjct  143  MFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDI  189



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ RLFGR++PVH++LGGGK ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT 
Sbjct  43   VKSKINRLFGREKPVHQILGGGKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTL  102

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
             CH LIL+LA++FLW NA+  I KS PHIP V IPE  V+  A +L+ ++N   A LR+I
Sbjct  103  FCHCLILSLAIIFLWSNATFLINKSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREI  162

Query  624  ASGRDL  641
            A+GRDL
Sbjct  163  ATGRDL  168



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  EXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            E ESL++ I++KIH H   SSS S  E+E++  + SS+ AKV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLLDKISEKIH-HGDDSSSSSSDEDEKEASSPSSLKAKVYRLFGREKPVHKVLGGGK  80

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             AD+F+WR+KK+S  VLGG TA+W+LFE++EYHLL+ + H LI+ LAVLF+W NAS FI 
Sbjct  81   PADIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSLLSHVLIVVLAVLFIWSNASMFIN  140

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            KS P IPEVHIPEEP+LQ AS L+ ++N     LRDIASGRDL
Sbjct  141  KSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDL  183



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 129/172 (75%), Gaps = 7/172 (4%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIH------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  305
            D+KE E+L+E  A+K+H         SS S   +K + +   + +S+  K+ RLFGR++P
Sbjct  9    DKKE-ETLIEKPAEKVHGDHDSSSSASSESDSEKKVKSKPASSPTSVKDKIFRLFGREKP  67

Query  306  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  485
            VH+V GGGK ADVFLWRNK+IS  VLGGATA+W+LFE+LEYHLLT VCH LILALA+LFL
Sbjct  68   VHQVFGGGKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAILFL  127

Query  486  WXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            W NA++FI KS P IPEV + EEP LQ A+A++ ++N  LA LR+IASGRDL
Sbjct  128  WSNATTFINKSPPRIPEVRLSEEPFLQVAAAVRFEINRALAVLREIASGRDL  179



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AKV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVL GAT IW+LFE+L+YHLLT 
Sbjct  53   VKAKVFRIFGRERPVHHVLGGGKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTL  112

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            V H LI ALA+LFLW NA +FI K+ P IPEV +PEEP LQ AS L+  +N   A L DI
Sbjct  113  VGHILIGALAILFLWSNAHAFIHKTPPRIPEVRLPEEPFLQVASELRVQINCAFALLHDI  172

Query  624  ASGRDL  641
            ASGRDL
Sbjct  173  ASGRDL  178



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ES+++ I+DK H    SSSS S   +++KK + + + AK+ RLFGR+QPVH VLGGGK A
Sbjct  12   ESMMDKISDKFHGGGGSSSSSSSDSDDDKKGSAAGVKAKIYRLFGREQPVHAVLGGGKPA  71

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT V H LIL+LA LFLW N   FI KS
Sbjct  72   DLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLWSNVCIFIHKS  131

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P+IPEV IPE+  +  A +L++++N  L  LR+I  GRDL
Sbjct  132  PPNIPEVKIPEDLTVNIALSLRHEINRGLFTLREIGHGRDL  172



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 125/166 (75%), Gaps = 5/166 (3%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVHKV G
Sbjct  4    EHKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVHKVFG  58

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLW +A++
Sbjct  59   GGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATT  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ PHIPEVHIPEE VLQ AS L+ ++N     LR+IA GRDL
Sbjct  119  FIHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDL  164



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + +K+ R+FGR++PVHKVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE+LE HLLT 
Sbjct  41   LKSKIYRIFGREKPVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTL  100

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VC+ LILALA+LFLW NAS+FI KS PHIPEV IPEEPVLQ A+AL+ ++N   + LRDI
Sbjct  101  VCYFLILALALLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAALRIEINWAFSVLRDI  160

Query  624  ASGRDL  641
            ASGRDL
Sbjct  161  ASGRDL  166



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            ++K+ ESL+E IA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PVH V G
Sbjct  6    EKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPVHHVFG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW NA+ 
Sbjct  63   GGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQ  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDLXM  647
            FI KS PHIPEV IP+EPVL+F  AL+ ++N   A LRDIA GRDL M
Sbjct  123  FINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKM  170



>ref|XP_010523772.1| PREDICTED: reticulon-like protein B5 [Tarenaya hassleriana]
Length=253

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IADKI       SS S   + EK ++ S++  K+ RLFGR++PVHKV GGGK A
Sbjct  13   ESLLEKIADKI---HDHDSSSSSDSDNEKMESPSAVKEKIYRLFGREKPVHKVFGGGKPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DV LWR+KK+S  VLG  TA+W+LFE++EYHLL+ VCH  IL LAVLFLW NA SFI KS
Sbjct  70   DVLLWRDKKLSAAVLGTTTAVWVLFELVEYHLLSFVCHISILTLAVLFLWSNAHSFINKS  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIA  626
             P IPE+H+ EEP L  ASA++N+VNH    LR+IA
Sbjct  130  PPQIPEIHVAEEPFLLIASAIRNEVNHAFTVLRNIA  165



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            + RLFGR++PV  VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH 
Sbjct  49   IYRLFGRERPVQSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHC  108

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LIL+LAVLFLW NAS+FI KS P+IPEV IPE+  +  A +L+ ++N   A LR+I  GR
Sbjct  109  LILSLAVLFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGR  168

Query  636  DL  641
            DL
Sbjct  169  DL  170



>gb|KJB19089.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=212

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            ++K+ ESL+E IA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PVH V G
Sbjct  6    EKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPVHHVFG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW NA+ 
Sbjct  63   GGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQ  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDLXM  647
            FI KS PHIPEV IP+EPVL+F  AL+ ++N   A LRDIA GRDL M
Sbjct  123  FINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKM  170



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ESL+E I++KIH H  SSSS S+ ++E+K  ++  +  K+ RLFGR++PVHKV G
Sbjct  4    EHKHEESLMEKISEKIHGHGDSSSSSSDSDDEKKSDSS--LKTKIYRLFGREKPVHKVFG  61

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLW +A++
Sbjct  62   GGKPADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWSSATT  121

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K+ PHIPE+HIPE+ VL+ AS L+ ++N     LR IA GRDL
Sbjct  122  FIHKTPPHIPEIHIPEKIVLELASGLRIEINRGFTVLRHIALGRDL  167



>gb|EPS69502.1| hypothetical protein M569_05265, partial [Genlisea aurea]
Length=238

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK++RLFGR++ VH VLGGGK AD+ LW+NK +SVGVL GATA+W+LF+V EYH LT 
Sbjct  31   LKAKIKRLFGREKNVHAVLGGGKVADLLLWKNKNVSVGVLVGATALWVLFDVFEYHFLTL  90

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            V H LI+ L +LFLW N S+F++KS P IPEV IPE+ VL+FAS L+ ++N  L+  RDI
Sbjct  91   VSHALIVGLVILFLWTNGSAFVRKSPPRIPEVIIPEKLVLEFASDLRIEINRALSAFRDI  150

Query  624  ASGRDL  641
            ASG+DL
Sbjct  151  ASGKDL  156



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  K+ RLFGR+QP+HK+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT 
Sbjct  26   LKTKIYRLFGREQPLHKLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTL  85

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
              H  ILALAVLFLW +AS+FI KS  HIPEVHIPE+ VLQ AS L+ ++N     LRDI
Sbjct  86   FGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDI  145

Query  624  ASGRDL  641
            ASGRDL
Sbjct  146  ASGRDL  151



>gb|KJB19091.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=241

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            ++K+ ESL+E IA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PVH V G
Sbjct  6    EKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPVHHVFG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW NA+ 
Sbjct  63   GGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQ  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDLXM  647
            FI KS PHIPEV IP+EPVL+F  AL+ ++N   A LRDIA GRDL M
Sbjct  123  FINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKM  170



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  320
            D K  ES++E I +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKVL
Sbjct  4    DHKHEESIMEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKVL  63

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK AD+FLWRNKK+S GV G  TA W+LFE+ EYHLL  +CH  I ALA LFLW NA 
Sbjct  64   GGGKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNAC  123

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI K++PHIPEV+IPE+PVLQ  S L+ ++N  L  LR+IASG+D+
Sbjct  124  TFIHKASPHIPEVNIPEDPVLQLVSGLRIEINRGLTVLRNIASGKDV  170



>gb|KJB19088.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=254

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            ++K+ ESL+E IA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PVH V G
Sbjct  6    EKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPVHHVFG  62

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW NA+ 
Sbjct  63   GGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQ  122

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDLXM  647
            FI KS PHIPEV IP+EPVL+F  AL+ ++N   A LRDIA GRDL M
Sbjct  123  FINKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKM  170



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            KV RLFGR++PVH VLGGGK ADVFLWRNKKIS GVLGGAT +++LFE++EYHLLT +CH
Sbjct  52   KVFRLFGRERPVHHVLGGGKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICH  111

Query  453  GLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASG  632
             LI ALAV+FLW NA +   K+APHIPEV +PEEP LQ AS L+  +N   A L +IASG
Sbjct  112  ILIGALAVMFLWSNAHTIFHKTAPHIPEVSLPEEPFLQVASELRLQINWAFALLHNIASG  171

Query  633  RDL  641
            R+L
Sbjct  172  REL  174



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR +PVH VLGGGK ADVFLW+NKK S GVLGGATA+WILFE+LEY L+T VCH 
Sbjct  45   VYRLFGRDKPVHTVLGGGKPADVFLWKNKKNSAGVLGGATALWILFELLEYQLITLVCHI  104

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            LI+ LA+ FLW  A++FI K+ P IP+V +PE+ +LQ  ++L+ ++N  ++ LRD+ASGR
Sbjct  105  LIILLAIPFLWSYANTFINKTPPQIPDVRLPEDCLLQVVTSLRIEINRIISTLRDVASGR  164

Query  636  DL  641
            DL
Sbjct  165  DL  166



>gb|KJB52211.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=192

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +3

Query  162  SLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL++ IA+KI  HDSSSS     +  E       + AKV  LFGR++PVH VLGGGK AD
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDNDKPSEST-----IKAKVFHLFGREKPVHHVLGGGKPAD  66

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKSA  521
            +FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALA+LFLW NA++F+ KS 
Sbjct  67   IFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSP  126

Query  522  phipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            P IPEV IP++PV++FA AL+ ++N   A LRDIASGRDL
Sbjct  127  PRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRDL  166



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 121/166 (73%), Gaps = 5/166 (3%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVHKV G
Sbjct  4    EHKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVHKVFG  58

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+ +Y+LLT   H  ILALAVLFLW +AS+
Sbjct  59   GGKPADIFLWRNKKVSGGVLGAATLSWILFELFQYNLLTLFGHISILALAVLFLWSSAST  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K  P IPEVHIPEE VLQ AS L+ ++N     LR IA GRDL
Sbjct  119  FIHKKPPRIPEVHIPEEVVLQLASGLRIEINRGFTLLRHIALGRDL  164



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = +3

Query  159  ESLVEXIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  332
            ES V+ I DK+H    DSSSSS S   + + KKTT++  + V+   GR++PVHKV GGGK
Sbjct  13   ESFVDKITDKLHGSNDDSSSSSSSSDSDSDAKKTTAAPPSPVKEEIGREKPVHKVFGGGK  72

Query  333  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIK  512
             AD+FLWR+KKIS GVLGG TA+W+LFE+LEYHLLT VCH +I  L++LFLW N + FI 
Sbjct  73   PADIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVCHIVIFTLSMLFLWSNVTIFIN  132

Query  513  KSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            K  P IP V + EEP +  A AL+N++N   A LR+IASGRDL
Sbjct  133  KRPPPIPVVSLSEEPFVGVALALRNEINRTCAVLREIASGRDL  175



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +3

Query  162  SLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL++ IA+KI  HDSSSS     +  E       + AKV  LFGR++PVH VLGGGK AD
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDNDKPSEST-----IKAKVFHLFGREKPVHHVLGGGKPAD  66

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKSA  521
            +FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALA+LFLW NA++F+ KS 
Sbjct  67   IFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSP  126

Query  522  phipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            P IPEV IP++PV++FA AL+ ++N   A LRDIASGRDL
Sbjct  127  PRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRDL  166



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 123/166 (74%), Gaps = 5/166 (3%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E IA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVHKV G
Sbjct  4    EHKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVHKVFG  58

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLW +A++
Sbjct  59   GGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATT  118

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI K  PHIPEVHIPEE  LQ AS L+ ++N     LR+IA GR+L
Sbjct  119  FIHKKPPHIPEVHIPEEVALQLASGLRIEINRGFTILRNIALGREL  164



>ref|NP_191715.2| reticulon-like protein B6 [Arabidopsis thaliana]
 sp|Q6DBN4.1|RTNLF_ARATH RecName: Full=Reticulon-like protein B6; Short=AtRTNLB6 [Arabidopsis 
thaliana]
 gb|AAT70439.1| At3g61560 [Arabidopsis thaliana]
 gb|AAV85700.1| At3g61560 [Arabidopsis thaliana]
 gb|AEE80222.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=253

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E IADKI       SS S   E EK ++ S++ AK+ RLFGR++PVHKVLGGG  A
Sbjct  13   ESLMEKIADKI---HDHDSSSSSDSEHEKPESPSALKAKIYRLFGREKPVHKVLGGGLPA  69

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            DVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI ALA LFL  NA +F+ K+
Sbjct  70   DVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKT  129

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+HI EE  L   SAL+N++N     LR IA GRDL
Sbjct  130  PPKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDL  170



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 121/164 (74%), Gaps = 4/164 (2%)
 Frame = +3

Query  159  ESLVEXIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
             SL+E I +KIH   RH SSSSS    +E+ +KK  S + AKV R+FGR++PVH VLGGG
Sbjct  15   PSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRIFGREKPVHHVLGGG  73

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFI  509
            K ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLW NA +FI
Sbjct  74   KSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNAHTFI  133

Query  510  KKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             K+ P IPEV +PEEP LQ AS L+  +N   A L  IASG+DL
Sbjct  134  HKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHSIASGKDL  177



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 121/164 (74%), Gaps = 4/164 (2%)
 Frame = +3

Query  159  ESLVEXIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  329
             SL+E I +KIH   RH SSSSS    +E+ +KK  S + AKV R+FGR++PVH VLGGG
Sbjct  15   PSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRIFGREKPVHHVLGGG  73

Query  330  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFI  509
            K ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLW NA +FI
Sbjct  74   KSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNAHTFI  133

Query  510  KKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             K+ P IPEV +PEEP LQ AS L+  +N   A L  IASG+DL
Sbjct  134  HKTPPRIPEVRLPEEPFLQVASELRVVINCSFALLHSIASGKDL  177



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            M +K+ RLFGR++PVH VLGGGK AD+ LWRNKK S  VL GAT+IW+LFEV+EYHLL  
Sbjct  49   MKSKIYRLFGREKPVHSVLGGGKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNL  108

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LIL+LA LFLW NA +FI KS P+IPEV IPE+  +  A +L+ ++N   + LRDI
Sbjct  109  VCHCLILSLATLFLWSNACTFINKSPPNIPEVKIPEDLTVNIALSLRYEINRGFSTLRDI  168

Query  624  ASGRDL  641
              GRDL
Sbjct  169  GHGRDL  174



>gb|KJB52212.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=222

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +3

Query  162  SLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL++ IA+KI  HDSSSS     +  E       + AKV  LFGR++PVH VLGGGK AD
Sbjct  12   SLMDRIAEKIQAHDSSSSDSDNDKPSEST-----IKAKVFHLFGREKPVHHVLGGGKPAD  66

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKSA  521
            +FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALA+LFLW NA++F+ KS 
Sbjct  67   IFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNKSP  126

Query  522  phipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            P IPEV IP++PV++FA AL+ ++N   A LRDIASGRDL
Sbjct  127  PRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRDL  166



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +3

Query  150  KEXESLVEXIADKIHRHdsssssdsekeeeekkkt---tssMDAKVRRLFGRQQPVHKVL  320
            K  ESL++ I+DKIH HDSSS   S     +K      ++S+ +KV RLFGR++PVH V 
Sbjct  9    KAAESLMDRISDKIHGHDSSSVVPSSGVVHDKGIGGGHSTSLKSKVNRLFGREKPVHHVF  68

Query  321  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNAS  500
            GGGK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A LFLW NAS
Sbjct  69   GGGKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNAS  128

Query  501  SFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            +FI KS PHIP+V IPE+PVLQ AS +  ++N     LR+IASG+DL
Sbjct  129  TFINKSPPHIPQVQIPEKPVLQIASVITMEINRAFVILREIASGKDL  175



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            K+ RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H
Sbjct  81   KMFRLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGH  140

Query  453  GLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASG  632
             LI +L VLFLW NASSFI KS P IPEV IPE+ V+  A + ++++N   A LR IA G
Sbjct  141  ALIFSLGVLFLWSNASSFINKSPPKIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALG  200

Query  633  RDL  641
            RD+
Sbjct  201  RDI  203



>ref|XP_006291739.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
 gb|EOA24637.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
Length=249

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ 
Sbjct  41   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSL  100

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI ALAVLFL  NA +F+ K+ P IPE+HI EE  +  ASAL+N++N     LR I
Sbjct  101  VCHILIFALAVLFLLSNAHAFMNKTPPKIPEIHIKEEHFILIASALRNELNQAFVILRSI  160

Query  624  ASGRDL  641
            A GRDL
Sbjct  161  ALGRDL  166



>ref|XP_010512508.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=249

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ 
Sbjct  41   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSL  100

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI ALA LFL  NA +F+ K+ P IPE+ + EE  L  ASAL+N++N     LR I
Sbjct  101  VCHILIFALAALFLLSNAHAFMNKTPPKIPEISVKEEHFLLIASALRNELNQAFVTLRSI  160

Query  624  ASGRDL  641
            A GRDL
Sbjct  161  ALGRDL  166



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 115/166 (69%), Gaps = 2/166 (1%)
 Frame = +3

Query  150  KEXESLVEXIADKIHRHdsssssdsekeeeekkkt--tssMDAKVRRLFGRQQPVHKVLG  323
            K  ESL++ IADKIH HDS  S   E   E+   +   +S+ AK   LFGR++PVH V G
Sbjct  9    KAAESLMDKIADKIHGHDSPVSPAVESLHEKAVSSGHAASLKAKAYSLFGREKPVHNVFG  68

Query  324  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASS  503
            GGK ADVFLWR+KK S  VL   T IW+ FE+L YHLLT + H LIL LA+LFLW NAS+
Sbjct  69   GGKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAMLFLWSNAST  128

Query  504  FIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
            FI KS P IP+V IPE+PVLQ ASA+  ++N     LR+IASG+DL
Sbjct  129  FINKSPPRIPQVKIPEKPVLQIASAITIEINRAFVILREIASGKDL  174



>ref|XP_010469092.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=249

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ 
Sbjct  41   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSL  100

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI ALA LFL  NA +F+ K+ P IPE+ + EE  L  ASAL+N++N     LR I
Sbjct  101  VCHILIFALAALFLLSNAHAFMNKTPPKIPEISVKEEHFLLIASALRNELNQAFVTLRSI  160

Query  624  ASGRDL  641
            A GRDL
Sbjct  161  ALGRDL  166



>gb|KJB52682.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=183

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AKV RLFGR++P+H+VLG GK AD+ LWRNKK+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +ILAL+VLFLW NAS+FI  S P IPEV IPE+ +L+ AS    ++N  L  +R I
Sbjct  102  ICHLMILALSVLFLWSNASNFINNSPPTIPEVVIPEKCLLKAASCFTFEINRTLDIVRTI  161

Query  624  ASGRDL  641
            A+G+DL
Sbjct  162  ATGKDL  167



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  282  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  461
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI
Sbjct  3    RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALI  62

Query  462  LALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             +L VLFLW NASSFI KS P IPEV IPE+ V+  A + ++++N   A LR IA GRD+
Sbjct  63   FSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDI  122



>ref|XP_010413382.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=241

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AK+ RLFGR++PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ 
Sbjct  33   LKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSL  92

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            VCH LI ALA LFL  NA +F+ K+ P IPE+++ EE  L  ASAL+N++N     LR I
Sbjct  93   VCHILIFALAALFLLSNAHAFMNKTPPKIPEINVKEEHFLLIASALRNELNQAFVTLRSI  152

Query  624  ASGRDL  641
            A GRDL
Sbjct  153  ALGRDL  158



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  273  KVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  452
            K+ RLFGR+QP+HKVLGGGK ADVF+WRNK +S GVLGGATAIWILFE+L YHLL  + H
Sbjct  85   KMFRLFGREQPIHKVLGGGKPADVFMWRNKHVSAGVLGGATAIWILFELLGYHLLAFLGH  144

Query  453  GLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASG  632
             LI +L VLFLW NASSFI KS P IPEV IPE+ V+  A + ++++N   A LR IA G
Sbjct  145  ALIFSLGVLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALG  204

Query  633  RDL  641
            RD+
Sbjct  205  RDI  207



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            +  KV R+FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +WILFE+LEY+LLT 
Sbjct  48   VKTKVFRIFGREKPVHHVLGGGKTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTL  107

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            V H LI  LA+LFLW NA +FI K+ P IPEV +PEEP LQ AS L+  +N   A L +I
Sbjct  108  VAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHNI  167

Query  624  ASGRDL  641
            ASG+DL
Sbjct  168  ASGKDL  173



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = +3

Query  162  SLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  341
            SL+E IA+KIH HDSSSSS    ++++ + +   +  KV RLFGR++PVH V GGGK AD
Sbjct  12   SLMEKIAEKIHGHDSSSSSSDSDDDKQSESS---IKDKVFRLFGREKPVHHVFGGGKPAD  68

Query  342  VFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKSA  521
            + LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW NA+ FI KS 
Sbjct  69   ILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQFINKST  128

Query  522  phipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDLXM  647
            PHIPEV IP+EPVL+FA AL+ ++N   A LRDIA GRDL M
Sbjct  129  PHIPEVQIPKEPVLEFAMALRFEINRAFAVLRDIALGRDLKM  170



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = +3

Query  159  ESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  338
            ESL+E I DKI  H  S + +    +  +      M  KV R+FGR++PVH V GGGK A
Sbjct  8    ESLMEKIEDKILGHHDSPAPEVVHHDSPRS-----MQDKVFRIFGRERPVHHVFGGGKLA  62

Query  339  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWXNASSFIKKS  518
            D+FLWR+KK+S G+LGGAT +W+LFE+LEYHLLT V H LI A+ + FLW N   FI KS
Sbjct  63   DIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWSNGLGFINKS  122

Query  519  AphipevhipeepvLQFASALKNDVNHCLAXLRDIASGRDL  641
             P IPE+ IPE+ +LQ  S++  ++N  L  +RDIASG+DL
Sbjct  123  PPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDL  163



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 125/182 (69%), Gaps = 19/182 (10%)
 Frame = +3

Query  144  DRKEXESLVEXIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  323
            + K  ES++E I++KIH HD SSSS S+ ++++   +   +  K+ RLFGR+QP+HK+ G
Sbjct  4    EHKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLHKLFG  60

Query  324  GGKQ----------------ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            GGK                 AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H 
Sbjct  61   GGKHSENQDINERFGLVFAAADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHI  120

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
             ILALAVLFLW +AS+FI KS  HIPEVHIPE+ VLQ AS L+ ++N     LRDIASGR
Sbjct  121  SILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGR  180

Query  636  DL  641
            DL
Sbjct  181  DL  182



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  276  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  455
            V RLFGR++PVHKVLGGGK AD+F+W+ KK+S GV GGAT  W+LFE++EYHLLT + H 
Sbjct  54   VYRLFGREKPVHKVLGGGKPADIFMWKKKKMSGGVFGGATVAWVLFELMEYHLLTLLSHV  113

Query  456  LILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDIASGR  635
            +IL LAVLFLW NA+ FI KS P IP++HIPEEP+LQ AS L+ ++N   + L +IASGR
Sbjct  114  MILLLAVLFLWSNATMFIHKSPPKIPQLHIPEEPLLQLASGLRIEINRGFSSLHEIASGR  173

Query  636  DL  641
            DL
Sbjct  174  DL  175



>gb|KHF99856.1| Reticulon-like protein B1 [Gossypium arboreum]
Length=174

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +3

Query  264  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  443
            + AKV RLFGR++P+H+VLG GK AD+ LWRNKK+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  444  VCHGLILALAVLFLWXNASSFIKKSAphipevhipeepvLQFASALKNDVNHCLAXLRDI  623
            +CH +ILAL+VLFLW N S+FI  S P IPEV IPE+ +L+ AS    ++N  L  +R I
Sbjct  102  ICHLMILALSVLFLWSNVSNFINNSPPTIPEVVIPEKCLLKAASCFTFEINRTLDIVRTI  161

Query  624  ASGRDL  641
            A+G+DL
Sbjct  162  ATGKDL  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000