BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF040M03

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591548.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    104   8e-23   Nicotiana tomentosiformis
ref|XP_009766829.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    104   9e-23   Nicotiana sylvestris
ref|XP_009757184.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    103   1e-22   Nicotiana sylvestris
ref|XP_009409962.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    103   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009595066.1|  PREDICTED: mannose-6-phosphate isomerase 2-like    102   3e-22   Nicotiana tomentosiformis
ref|XP_009618411.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    102   4e-22   Nicotiana tomentosiformis
ref|XP_009383606.1|  PREDICTED: mannose-6-phosphate isomerase 1-like    100   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009798758.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  99.4    5e-21   Nicotiana sylvestris
ref|XP_006346906.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  99.0    9e-21   Solanum tuberosum [potatoes]
gb|KDP32959.1|  hypothetical protein JCGZ_12990                       98.2    2e-20   Jatropha curcas
ref|XP_011097180.1|  PREDICTED: mannose-6-phosphate isomerase 1 i...  97.1    2e-20   
ref|XP_011099550.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  97.8    2e-20   Sesamum indicum [beniseed]
ref|XP_011097179.1|  PREDICTED: mannose-6-phosphate isomerase 1 i...  96.3    7e-20   Sesamum indicum [beniseed]
gb|EYU34411.1|  hypothetical protein MIMGU_mgv1a006972mg              95.9    8e-20   Erythranthe guttata [common monkey flower]
ref|XP_006357852.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  95.9    1e-19   Solanum tuberosum [potatoes]
ref|XP_004233489.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  95.9    1e-19   Solanum lycopersicum
gb|EYU44628.1|  hypothetical protein MIMGU_mgv1a0065652mg             92.4    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_002531475.1|  mannose-6-phosphate isomerase, putative          94.7    1e-19   
ref|XP_006365538.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  95.1    2e-19   Solanum tuberosum [potatoes]
ref|NP_176878.1|  mannose-6-phosphate isomerase                       94.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797801.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...  94.4    3e-19   
dbj|BAD44147.1|  phosphomannose isomerase (din9)                      94.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356248.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  93.6    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_008807087.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...  93.2    4e-19   
ref|XP_004232352.1|  PREDICTED: mannose-6-phosphate isomerase 2       94.0    5e-19   Solanum lycopersicum
ref|XP_008389273.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  93.2    5e-19   
ref|XP_010470599.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...  94.7    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010470600.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...  94.7    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010916406.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  93.6    6e-19   Elaeis guineensis
ref|XP_009356247.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  94.0    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_004242042.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  93.6    6e-19   
ref|XP_002283926.1|  PREDICTED: mannose-6-phosphate isomerase 1       93.6    7e-19   Vitis vinifera
ref|XP_008367007.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...  93.6    8e-19   
ref|XP_008389272.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  93.6    8e-19   
ref|XP_009356977.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  91.7    9e-19   
emb|CAN60179.1|  hypothetical protein VITISV_011365                   93.2    1e-18   Vitis vinifera
ref|XP_007222285.1|  hypothetical protein PRUPE_ppa005896mg           92.4    2e-18   Prunus persica
ref|XP_008807086.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...  92.4    2e-18   
gb|AAG23720.1|AF159377_1  phosphomannose isomerase                    90.5    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008807084.1|  PREDICTED: mannose-6-phosphate isomerase 2-l...  92.4    2e-18   
ref|XP_009356970.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  92.0    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_008339655.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  91.7    4e-18   Malus domestica [apple tree]
ref|XP_010926023.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  91.3    4e-18   Elaeis guineensis
ref|XP_010265087.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  91.3    5e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008243257.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  91.3    5e-18   Prunus mume [ume]
ref|XP_010098415.1|  Mannose-6-phosphate isomerase                    87.4    3e-17   
ref|XP_004300283.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  89.0    3e-17   Fragaria vesca subsp. vesca
ref|XP_010693191.1|  PREDICTED: mannose-6-phosphate isomerase 1       89.4    4e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011021254.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  88.6    4e-17   Populus euphratica
ref|XP_006383443.1|  hypothetical protein POPTR_0005s15560g           88.6    4e-17   
ref|XP_004165797.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  88.6    5e-17   
ref|XP_008457018.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  88.6    5e-17   Cucumis melo [Oriental melon]
ref|XP_010549921.1|  PREDICTED: mannose-6-phosphate isomerase 1       88.2    6e-17   Tarenaya hassleriana [spider flower]
ref|XP_010061894.1|  PREDICTED: mannose-6-phosphate isomerase 1 i...  86.7    7e-17   
ref|XP_004145852.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  87.8    8e-17   Cucumis sativus [cucumbers]
ref|XP_009127517.1|  PREDICTED: mannose-6-phosphate isomerase 2       87.8    9e-17   Brassica rapa
ref|XP_002887099.1|  predicted protein                                87.4    1e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010415256.1|  PREDICTED: mannose-6-phosphate isomerase 2       87.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_011464099.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  87.4    1e-16   Fragaria vesca subsp. vesca
ref|XP_010511622.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  87.4    1e-16   Camelina sativa [gold-of-pleasure]
gb|AEJ89929.1|  mannose-6-phosphate isomerase-like protein            87.4    1e-16   Brassica rapa subsp. chinensis [bok-choy]
emb|CDY12611.1|  BnaA02g12790D                                        87.4    1e-16   Brassica napus [oilseed rape]
ref|XP_006391469.1|  hypothetical protein EUTSA_v10018552mg           86.7    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_008244515.1|  PREDICTED: mannose-6-phosphate isomerase 1       86.7    2e-16   Prunus mume [ume]
emb|CDY42336.1|  BnaC02g17130D                                        86.7    2e-16   Brassica napus [oilseed rape]
ref|XP_010061893.1|  PREDICTED: mannose-6-phosphate isomerase 1 i...  86.7    2e-16   Eucalyptus grandis [rose gum]
ref|XP_006303108.1|  hypothetical protein CARUB_v100218701mg          82.0    2e-16   
ref|XP_010107822.1|  putative mannose-6-phosphate isomerase           86.3    3e-16   
ref|XP_002526993.1|  mannose-6-phosphate isomerase, putative          85.5    5e-16   Ricinus communis
ref|XP_002305820.1|  DARK INDUCIBLE 9 family protein                  85.5    6e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007215391.1|  hypothetical protein PRUPE_ppa005846mg           85.5    6e-16   
ref|XP_009345680.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  85.1    7e-16   Pyrus x bretschneideri [bai li]
ref|XP_009342661.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  85.1    9e-16   Pyrus x bretschneideri [bai li]
ref|XP_008342936.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  84.7    1e-15   
ref|XP_010532333.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  84.7    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_011035071.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  84.0    2e-15   Populus euphratica
gb|KDP29436.1|  hypothetical protein JCGZ_18357                       84.0    2e-15   Jatropha curcas
ref|XP_008381268.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  83.2    4e-15   Malus domestica [apple tree]
ref|XP_008381266.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  83.2    4e-15   Malus domestica [apple tree]
gb|AAX31279.1|  phosphomannose isomerase                              82.8    5e-15   Cyamopsis tetragonoloba [cluster bean]
gb|KJB43062.1|  hypothetical protein B456_007G181800                  82.4    5e-15   Gossypium raimondii
gb|KJB43060.1|  hypothetical protein B456_007G181800                  82.8    6e-15   Gossypium raimondii
gb|KJB43061.1|  hypothetical protein B456_007G181800                  82.4    6e-15   Gossypium raimondii
ref|XP_010528481.1|  PREDICTED: mannose-6-phosphate isomerase 2       82.4    7e-15   Tarenaya hassleriana [spider flower]
gb|KHG01171.1|  Mannose-6-phosphate isomerase                         81.3    2e-14   Gossypium arboreum [tree cotton]
ref|XP_006430767.1|  hypothetical protein CICLE_v10011731mg           80.9    2e-14   Citrus clementina [clementine]
gb|KDO59031.1|  hypothetical protein CISIN_1g013464mg                 80.9    2e-14   Citrus sinensis [apfelsine]
ref|XP_003552724.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  80.5    3e-14   Glycine max [soybeans]
ref|XP_007033251.1|  Mannose-6-phosphate isomerase, type I            80.5    3e-14   Theobroma cacao [chocolate]
ref|XP_006408404.1|  hypothetical protein EUTSA_v10020776mg           80.1    4e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006296710.1|  hypothetical protein CARUB_v10013753mg           78.6    5e-14   
ref|XP_009357811.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  79.3    7e-14   Pyrus x bretschneideri [bai li]
ref|XP_009357810.1|  PREDICTED: mannose-6-phosphate isomerase 1-l...  79.3    7e-14   Pyrus x bretschneideri [bai li]
gb|KHG02503.1|  Mannose-6-phosphate isomerase                         79.3    8e-14   Gossypium arboreum [tree cotton]
ref|XP_006448445.1|  hypothetical protein CICLE_v10017881mg           79.0    8e-14   
emb|CDY11497.1|  BnaA09g40630D                                        77.8    9e-14   Brassica napus [oilseed rape]
gb|KJB48153.1|  hypothetical protein B456_008G055300                  79.0    1e-13   Gossypium raimondii
gb|KDO76962.1|  hypothetical protein CISIN_1g014147mg                 79.0    1e-13   Citrus sinensis [apfelsine]
ref|XP_008436962.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  78.6    1e-13   Cucumis melo [Oriental melon]
ref|XP_006296709.1|  hypothetical protein CARUB_v10013753mg           78.6    1e-13   Capsella rubella
ref|XP_006469088.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  78.6    1e-13   Citrus sinensis [apfelsine]
ref|XP_002884330.1|  hypothetical protein ARALYDRAFT_477494           78.6    2e-13   
ref|XP_010499042.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  78.2    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_001775706.1|  predicted protein                                78.2    2e-13   
gb|EPS59833.1|  hypothetical protein M569_14970                       77.8    2e-13   Genlisea aurea
emb|CDY54299.1|  BnaC01g41980D                                        77.8    2e-13   Brassica napus [oilseed rape]
emb|CDX77287.1|  BnaC08g03320D                                        75.5    3e-13   
ref|XP_006482242.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  77.4    3e-13   Citrus sinensis [apfelsine]
ref|XP_004143675.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  76.3    8e-13   Cucumis sativus [cucumbers]
gb|KHN17308.1|  Mannose-6-phosphate isomerase                         75.9    9e-13   Glycine soja [wild soybean]
ref|NP_186906.1|  mannose-6-phosphate isomerase                       75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ESA05112.1|  hypothetical protein GLOINDRAFT_35949                 75.5    1e-12   
emb|CDY67541.1|  BnaAnng24620D                                        75.5    2e-12   Brassica napus [oilseed rape]
emb|CDY34738.1|  BnaA01g32870D                                        75.5    2e-12   Brassica napus [oilseed rape]
ref|XP_001754844.1|  predicted protein                                75.5    2e-12   
ref|XP_009118359.1|  PREDICTED: mannose-6-phosphate isomerase 1       75.5    2e-12   Brassica rapa
ref|XP_002987355.1|  hypothetical protein SELMODRAFT_125724           74.7    3e-12   
ref|XP_007139158.1|  hypothetical protein PHAVU_008G006200g           74.3    3e-12   Phaseolus vulgaris [French bean]
ref|XP_010485568.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  74.7    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010463670.1|  PREDICTED: mannose-6-phosphate isomerase 1       74.7    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006842317.1|  hypothetical protein AMTR_s00079p00142130        74.3    3e-12   Amborella trichopoda
gb|ABR16432.1|  unknown                                               74.3    3e-12   Picea sitchensis
ref|XP_003567941.1|  PREDICTED: mannose-6-phosphate isomerase 1       74.3    4e-12   Brachypodium distachyon [annual false brome]
ref|XP_001695020.1|  mannose-6-phosphate isomerase                    73.6    4e-12   Chlamydomonas reinhardtii
dbj|BAM19882.1|  mannose-6-phosphate isomerase                        71.6    5e-12   Papilio xuthus [Chinese swallowtail]
ref|XP_003532343.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  73.9    5e-12   Glycine max [soybeans]
ref|XP_004489108.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  73.6    6e-12   Cicer arietinum [garbanzo]
ref|XP_003541320.1|  PREDICTED: mannose-6-phosphate isomerase 1       73.2    1e-11   Glycine max [soybeans]
gb|KEH21549.1|  mannose-6-phosphate isomerase                         72.4    2e-11   Medicago truncatula
gb|AFW79921.1|  hypothetical protein ZEAMMB73_049955                  68.6    2e-11   
ref|XP_004968078.1|  PREDICTED: mannose-6-phosphate isomerase 1-like  72.0    2e-11   Setaria italica
gb|AFW79922.1|  hypothetical protein ZEAMMB73_049955                  69.7    3e-11   
emb|CDY43229.1|  BnaC05g48220D                                        71.6    3e-11   Brassica napus [oilseed rape]
ref|XP_009147339.1|  PREDICTED: mannose-6-phosphate isomerase 1       71.6    3e-11   Brassica rapa
emb|CDY57541.1|  BnaA05g33470D                                        71.6    3e-11   Brassica napus [oilseed rape]
ref|NP_596445.1|  mannose-6-phosphate isomerase (predicted)           71.2    4e-11   Schizosaccharomyces pombe
gb|KFY44699.1|  hypothetical protein V494_01366                       70.9    4e-11   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|EWM30265.1|  mannose-6-phosphate isomerase                         70.9    5e-11   Nannochloropsis gaditana
ref|XP_006690173.1|  mannose-6-phosphate isomerase                    70.5    7e-11   Yamadazyma tenuis ATCC 10573
gb|EPY53747.1|  mannose-6-phosphate isomerase                         70.1    1e-10   Schizosaccharomyces cryophilus OY26
ref|NP_001140476.1|  uncharacterized protein LOC100272536             70.1    1e-10   Zea mays [maize]
gb|AAX28286.2|  SJCHGC09301 protein                                   68.6    1e-10   Schistosoma japonicum
ref|XP_001384544.2|  mannose-6-phosphate isomerase                    69.3    2e-10   Scheffersomyces stipitis CBS 6054
gb|KFY05395.1|  hypothetical protein O988_00022                       68.2    2e-10   Pseudogymnoascus sp. VKM F-3808
ref|XP_001525942.1|  mannose-6-phosphate isomerase                    68.9    3e-10   Lodderomyces elongisporus NRRL YB-4239
gb|EDK38036.2|  hypothetical protein PGUG_02134                       68.6    3e-10   Meyerozyma guilliermondii ATCC 6260
ref|XP_001486463.1|  hypothetical protein PGUG_02134                  68.6    3e-10   Meyerozyma guilliermondii ATCC 6260
ref|XP_002954744.1|  hypothetical protein VOLCADRAFT_65163            68.6    4e-10   Volvox carteri f. nagariensis
ref|XP_008555945.1|  PREDICTED: mannose-6-phosphate isomerase         68.2    4e-10   Microplitis demolitor
ref|XP_007920019.1|  hypothetical protein MYCFIDRAFT_48216            68.2    5e-10   Pseudocercospora fijiensis CIRAD86
ref|XP_006822952.1|  PREDICTED: mannose-6-phosphate isomerase-like    68.2    5e-10   Saccoglossus kowalevskii
ref|NP_001041907.1|  Os01g0127900                                     68.2    5e-10   
ref|XP_002615302.1|  hypothetical protein CLUG_04184                  68.2    5e-10   Clavispora lusitaniae ATCC 42720
ref|XP_780304.2|  PREDICTED: mannose-6-phosphate isomerase-like       67.8    6e-10   Strongylocentrotus purpuratus [purple urchin]
ref|XP_004200422.1|  Piso0_003008                                     67.8    6e-10   
gb|KER00636.1|  hypothetical protein AUEXF2481DRAFT_548               67.8    6e-10   Aureobasidium subglaciale EXF-2481
gb|EPE02644.1|  mannose-6-phosphate isomerase                         67.8    6e-10   Ophiostoma piceae UAMH 11346
gb|KEQ87513.1|  mannose-6-phosphate isomerase                         67.8    6e-10   Aureobasidium pullulans EXF-150
ref|XP_004930563.1|  PREDICTED: mannose-6-phosphate isomerase-like    67.4    7e-10   Bombyx mori [silk moth]
ref|XP_006623253.1|  PREDICTED: mannose-6-phosphate isomerase-like    65.9    7e-10   Apis dorsata [rock honeybee]
gb|KFH65394.1|  phosphomannose isomerase type I                       67.4    7e-10   Mortierella verticillata NRRL 6337
emb|CAX73569.1|  mannose phosphate isomerase                          67.4    7e-10   Schistosoma japonicum
ref|XP_003007952.1|  mannose-6-phosphate isomerase                    67.0    9e-10   Verticillium alfalfae VaMs.102
ref|XP_001749420.1|  hypothetical protein                             66.2    9e-10   Monosiga brevicollis MX1
ref|XP_009651556.1|  mannose-6-phosphate isomerase                    67.0    1e-09   Verticillium dahliae VdLs.17
dbj|BAO41038.2|  mannose-6-phosphate isomerase                        67.0    1e-09   Kluyveromyces marxianus DMKU3-1042
ref|XP_003868823.1|  Pmi1 phosphomannose isomerase                    66.6    1e-09   Candida orthopsilosis Co 90-125
dbj|GAM82182.1|  hypothetical protein ANO11243_001610                 66.6    1e-09   fungal sp. No.11243
ref|XP_007723041.1|  mannose-6-phosphate isomerase                    66.6    1e-09   Capronia coronata CBS 617.96
emb|CCE44802.1|  hypothetical protein CPAR2_406050                    66.6    2e-09   Candida parapsilosis
gb|EFX81906.1|  hypothetical protein DAPPUDRAFT_128126                66.2    2e-09   Daphnia pulex
ref|XP_003694263.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...  66.2    2e-09   
emb|CEP08578.1|  hypothetical protein                                 63.2    2e-09   Parasitella parasitica
ref|XP_007294418.1|  putative mannose-6-phosphate isomerase           66.2    2e-09   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_623842.1|  PREDICTED: mannose-6-phosphate isomerase-like i...  66.2    2e-09   Apis mellifera [bee]
ref|XP_002173848.1|  mannose-6-phosphate isomerase                    66.2    2e-09   Schizosaccharomyces japonicus yFS275
ref|XP_457357.2|  DEHA2B09350p                                        66.2    2e-09   Debaryomyces hansenii CBS767
gb|EMG49367.1|  Mannose-6-phosphate isomerase                         66.2    2e-09   Candida maltosa Xu316
gb|EME49470.1|  hypothetical protein DOTSEDRAFT_68288                 66.2    2e-09   Dothistroma septosporum NZE10
emb|CCD74651.1|  putative mannose-6-phosphate isomerase               66.2    2e-09   Schistosoma mansoni
emb|CBJ28774.1|  Mannose-6-phosphate isomerase                        65.5    2e-09   Ectocarpus siliculosus
gb|EPX71061.1|  mannose-6-phosphate isomerase                         65.9    2e-09   Schizosaccharomyces octosporus yFS286
gb|ACG45229.1|  mannose-6-phosphate isomerase                         65.5    3e-09   Zea mays [maize]
ref|NP_001140535.1|  uncharacterized protein LOC100272600             65.5    3e-09   Zea mays [maize]
gb|KHN73989.1|  putative mannose-6-phosphate isomerase                65.9    3e-09   Toxocara canis
gb|KGB38300.1|  putative mannose-6-phosphate isomerase                65.5    3e-09   Schistosoma haematobium
ref|XP_004979620.1|  PREDICTED: mannose-6-phosphate isomerase 2-like  65.5    3e-09   Setaria italica
gb|KIH91195.1|  mannose-6-phosphate isomerase                         65.5    4e-09   Sporothrix brasiliensis 5110
gb|EAZ08978.1|  hypothetical protein OsI_31243                        65.1    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002418846.1|  mannose-6-phosphate isomerase, putative; pho...  65.1    4e-09   Candida dubliniensis CD36
gb|KDN66154.1|  putative phosphomannose isomerase type I              65.1    4e-09   Colletotrichum sublineola
ref|XP_007673636.1|  hypothetical protein BAUCODRAFT_31721            65.1    5e-09   Baudoinia panamericana UAMH 10762
dbj|GAN06914.1|  phosphomannose isomerase type I                      65.1    5e-09   Mucor ambiguus
gb|KGR00547.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans GC75
gb|KHC72837.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P75016
gb|KHC66042.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P75010
ref|XP_714656.1|  hypothetical protein CaO19.8968                     65.1    5e-09   
gb|KHC80739.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P78042
gb|KGR11799.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P57072
gb|KHC54026.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P60002
gb|KGT70334.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans 12C
gb|KGR13934.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P78048
gb|KGU35531.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P57055
gb|KGU12950.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans 19F
gb|KGQ95949.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P37005
gb|KHC58058.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P37039
gb|KGU29012.1|  mannose-6-phosphate isomerase                         65.1    5e-09   Candida albicans P34048
ref|XP_714562.1|  hypothetical protein CaO19.1390                     65.1    5e-09   Candida albicans SC5314
gb|EFZ22736.1|  hypothetical protein SINV_15264                       64.7    5e-09   
pdb|1PMI|A  Chain A, Candida Albicans Phosphomannose Isomerase        65.1    5e-09   Candida albicans
gb|EMF17849.1|  mannose-6-phosphate isomerase                         64.7    6e-09   Sphaerulina musiva SO2202
gb|ABU62653.1|  mannose-6-phosphate isomerase                         64.7    6e-09   Mytilus edulis [blue mussel]
ref|XP_011160040.1|  PREDICTED: mannose-6-phosphate isomerase iso...  64.7    6e-09   Solenopsis invicta [imported red fire ant]
gb|KFY93234.1|  hypothetical protein V498_04527                       64.7    6e-09   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|XP_011262818.1|  PREDICTED: mannose-6-phosphate isomerase         64.3    7e-09   
emb|CDP94208.1|  Protein Bm13978, isoform c                           64.3    7e-09   
emb|CEI89889.1|  Putative Mannose-6-phosphate isomerase               64.3    7e-09   Rhizopus microsporus
gb|ABX56011.1|  mannose-6-phosphate isomerase                         64.7    7e-09   Mytilus edulis [blue mussel]
gb|ABX56010.1|  mannose-6-phosphate isomerase                         64.3    7e-09   Mytilus edulis [blue mussel]
gb|KIH52704.1|  hypothetical protein ANCDUO_17192                     61.2    7e-09   Ancylostoma duodenale
gb|ABX56009.1|  mannose-6-phosphate isomerase                         64.3    7e-09   Mytilus edulis [blue mussel]
gb|EHJ72135.1|  putative Mannose-6-phosphate isomerase                64.3    7e-09   
gb|KFY29906.1|  hypothetical protein V494_08381                       64.7    8e-09   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY22248.1|  hypothetical protein V493_06732                       64.3    8e-09   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|EFQ31468.1|  phosphomannose isomerase type I                       64.3    8e-09   Colletotrichum graminicola M1.001
gb|KFY07372.1|  hypothetical protein V492_07204                       64.3    8e-09   Pseudogymnoascus sp. VKM F-4246
gb|ELR04529.1|  phosphomannose isomerase type I                       64.3    8e-09   Pseudogymnoascus destructans 20631-21
gb|ABU62655.1|  mannose-6-phosphate isomerase                         64.3    9e-09   Mytilus trossulus [bay mussel]
ref|XP_007514601.1|  mannose-6-phosphate isomerase                    64.3    9e-09   Bathycoccus prasinos
emb|CCG82227.1|  Mannose-6-phosphate isomerase                        64.3    9e-09   Taphrina deformans PYCC 5710
gb|KFZ14708.1|  hypothetical protein V501_03099                       64.3    9e-09   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFZ03104.1|  hypothetical protein V502_11222                       64.3    9e-09   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY83685.1|  hypothetical protein V500_10015                       64.3    9e-09   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFY11112.1|  hypothetical protein V491_07342                       64.3    9e-09   Pseudogymnoascus sp. VKM F-3775
gb|KFX95148.1|  hypothetical protein O988_05954                       64.3    1e-08   Pseudogymnoascus sp. VKM F-3808
gb|KFX88290.1|  hypothetical protein V490_07730                       64.3    1e-08   Pseudogymnoascus sp. VKM F-3557
gb|KFY37598.1|  hypothetical protein V495_07069                       64.3    1e-08   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|EGI59455.1|  Mannose-6-phosphate isomerase                         64.3    1e-08   Acromyrmex echinatior
gb|KFY79299.1|  hypothetical protein V499_01715                       63.9    1e-08   Pseudogymnoascus sp. VKM F-103
gb|ELU00241.1|  hypothetical protein CAPTEDRAFT_229052                63.9    1e-08   Capitella teleta
ref|XP_007796865.1|  putative mannose-6-phosphate isomerase protein   63.9    1e-08   
gb|KFY58531.1|  hypothetical protein V496_06097                       63.9    1e-08   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_003060607.1|  predicted protein                                63.9    1e-08   Micromonas pusilla CCMP1545
emb|CEG82939.1|  Putative Mannose-6-phosphate isomerase               63.9    1e-08   Rhizopus microsporus
emb|CEI87990.1|  Putative Mannose-6-phosphate isomerase               63.9    1e-08   Rhizopus microsporus
gb|EYE99727.1|  mannose-6-phosphate isomerase, class I                63.9    1e-08   Aspergillus ruber CBS 135680
emb|CEG73470.1|  Putative Mannose-6-phosphate isomerase               63.9    1e-08   Rhizopus microsporus
ref|XP_001224504.1|  hypothetical protein CHGG_06848                  63.9    1e-08   Chaetomium globosum CBS 148.51
ref|XP_011064085.1|  PREDICTED: mannose-6-phosphate isomerase iso...  63.5    1e-08   Acromyrmex echinatior
gb|ENH82186.1|  mannose-6-phosphate isomerase                         63.9    1e-08   
gb|EMR91159.1|  putative mannose-6-phosphate class i protein          63.9    1e-08   Botrytis cinerea BcDW1
ref|XP_001547579.1|  hypothetical protein BC1G_13823                  63.9    1e-08   Botrytis cinerea B05.10
ref|XP_003136932.1|  mannose-6-phosphate isomerase                    63.5    1e-08   Loa loa
emb|CCF35294.1|  mannose-6-phosphate isomerase                        63.9    1e-08   Colletotrichum higginsianum
ref|XP_007729067.1|  phosphomannose isomerase type I                  63.5    1e-08   Capronia epimyces CBS 606.96
ref|XP_001598973.1|  hypothetical protein SS1G_01063                  63.5    1e-08   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_011064084.1|  PREDICTED: mannose-6-phosphate isomerase iso...  63.5    1e-08   Acromyrmex echinatior
ref|XP_002547690.1|  mannose-6-phosphate isomerase                    63.5    1e-08   Candida tropicalis MYA-3404
gb|KIV97728.1|  mannose-6-phosphate isomerase, class I                63.5    2e-08   Exophiala mesophila
gb|ABX56008.1|  mannose-6-phosphate isomerase                         63.5    2e-08   Mytilus edulis [blue mussel]
gb|EFN82383.1|  Mannose-6-phosphate isomerase                         63.2    2e-08   Harpegnathos saltator
emb|CCA15775.1|  mannose6phosphate isomerase putative                 63.2    2e-08   Albugo laibachii Nc14
gb|KIY92119.1|  mannose-6-phosphate isomerase                         59.7    2e-08   Monoraphidium neglectum
ref|XP_005844140.1|  hypothetical protein CHLNCDRAFT_139231           63.2    2e-08   Chlorella variabilis
gb|ABX56012.1|  mannose-6-phosphate isomerase                         63.2    2e-08   Mytilus edulis [blue mussel]
gb|KFP85624.1|  Mannose-6-phosphate isomerase                         63.2    2e-08   Acanthisitta chloris
dbj|BAP72500.1|  mannose-6-phosphate isomerase                        63.2    2e-08   Kluyveromyces marxianus
ref|XP_011142723.1|  PREDICTED: mannose-6-phosphate isomerase         63.2    2e-08   Harpegnathos saltator
gb|ABX56007.1|  mannose-6-phosphate isomerase                         63.2    2e-08   Mytilus edulis [blue mussel]
ref|XP_002478490.1|  mannose-6-phosphate isomerase, class I           63.2    2e-08   Talaromyces stipitatus ATCC 10500
gb|EPB84028.1|  phosphomannose isomerase type I                       62.8    2e-08   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003097592.1|  hypothetical protein CRE_14866                   63.2    2e-08   Caenorhabditis remanei
dbj|GAM42886.1|  mannose-6-phosphate isomerase                        62.8    2e-08   Talaromyces cellulolyticus
ref|XP_001661364.1|  AAEL002331-PA                                    62.8    2e-08   Aedes aegypti
ref|XP_001897936.1|  mannose-6-phosphate isomerase, class I famil...  62.8    2e-08   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001647737.1|  AAEL015438-PA                                    62.8    2e-08   
ref|XP_003491147.1|  PREDICTED: mannose-6-phosphate isomerase-like    62.8    3e-08   Bombus impatiens
ref|XP_011406198.1|  PREDICTED: mannose-6-phosphate isomerase-like    62.0    3e-08   
ref|XP_003842169.1|  similar to mannose-6-phosphate isomerase         62.8    3e-08   Leptosphaeria maculans JN3
ref|XP_003959609.1|  hypothetical protein KAFR_0K01190                62.8    3e-08   
ref|XP_009248302.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...  62.4    3e-08   
ref|XP_003857009.1|  hypothetical protein MYCGRDRAFT_67239            62.8    3e-08   
ref|XP_011335760.1|  PREDICTED: mannose-6-phosphate isomerase iso...  62.4    3e-08   
ref|XP_007744674.1|  mannose-6-phosphate isomerase                    62.4    3e-08   
gb|ESZ98190.1|  mannose-6-phosphate isomerase, class I                62.4    3e-08   
gb|KIW26029.1|  mannose-6-phosphate isomerase, class I                62.4    3e-08   
ref|XP_011335762.1|  PREDICTED: mannose-6-phosphate isomerase iso...  62.4    3e-08   
gb|KIX97283.1|  hypothetical protein Z520_06735                       62.4    3e-08   
ref|XP_007802556.1|  hypothetical protein EPUS_01760                  62.4    4e-08   
ref|XP_008086444.1|  RmlC-like cupin                                  62.4    4e-08   
ref|XP_002423224.1|  Mannose-6-phosphate isomerase, putative          62.4    4e-08   
ref|XP_501053.1|  YALI0B18348p                                        62.4    4e-08   
gb|EJW85159.1|  phosphomannose isomerase type I                       62.0    4e-08   
ref|XP_004594757.1|  PREDICTED: mannose-6-phosphate isomerase         62.0    4e-08   
ref|XP_003704597.1|  PREDICTED: mannose-6-phosphate isomerase-like    62.0    5e-08   
gb|KIW94869.1|  mannose-6-phosphate isomerase, class I                62.0    5e-08   
gb|EGT39417.1|  hypothetical protein CAEBREN_23243                    62.0    5e-08   
gb|EKC33579.1|  Mannose-6-phosphate isomerase                         62.0    5e-08   
gb|EGT58447.1|  hypothetical protein CAEBREN_29115                    62.0    5e-08   
emb|CDH53485.1|  mannose-6-phosphate isomerase                        62.0    5e-08   
dbj|GAA88568.1|  mannose-6-phosphate isomerase, class I               62.0    5e-08   
ref|XP_002505002.1|  predicted protein                                61.6    5e-08   
ref|XP_001392750.1|  mannose-6-phosphate isomerase                    62.0    5e-08   
gb|KIW77350.1|  mannose-6-phosphate isomerase, class I                62.0    5e-08   
ref|XP_002837532.1|  hypothetical protein                             61.6    6e-08   
ref|XP_001848124.1|  mannose-6-phosphate isomerase                    61.6    6e-08   
ref|XP_006126332.1|  PREDICTED: mannose-6-phosphate isomerase iso...  61.6    6e-08   
gb|EYC01143.1|  hypothetical protein Y032_0110g188                    60.5    6e-08   
ref|XP_003398360.1|  PREDICTED: mannose-6-phosphate isomerase-like    61.6    6e-08   
gb|KFV63742.1|  Mannose-6-phosphate isomerase                         61.6    6e-08   
gb|ERL85596.1|  hypothetical protein D910_03015                       61.6    6e-08   
gb|ENN74580.1|  hypothetical protein YQE_08833                        61.6    6e-08   
ref|XP_011440524.1|  PREDICTED: mannose-6-phosphate isomerase-like    61.6    6e-08   
ref|XP_002116196.1|  hypothetical protein TRIADDRAFT_30639            61.6    6e-08   
ref|XP_007734742.1|  mannose-6-phosphate isomerase                    61.6    6e-08   
gb|ERG85041.1|  mannose-6-phosphate isomerase                         61.6    6e-08   
dbj|GAD93488.1|  mannose-6-phosphate isomerase, class I               61.6    7e-08   
gb|EPS30621.1|  hypothetical protein PDE_05573                        61.6    7e-08   
ref|XP_003267271.1|  PREDICTED: mannose-6-phosphate isomerase iso...  60.8    7e-08   
ref|XP_009154855.1|  phosphomannose isomerase type I                  61.6    7e-08   
gb|EYC01142.1|  hypothetical protein Y032_0110g188                    60.5    7e-08   
emb|CDS12287.1|  hypothetical protein LRAMOSA04482                    61.2    7e-08   
ref|NP_001276084.1|  mannose-6-phosphate isomerase isoform 2          60.8    7e-08   
ref|NP_002426.1|  mannose-6-phosphate isomerase isoform 1             61.2    7e-08   
ref|XP_007703802.1|  hypothetical protein COCSADRAFT_98809            61.6    7e-08   
ref|XP_003811134.1|  PREDICTED: mannose-6-phosphate isomerase iso...  61.2    7e-08   
gb|EAW99297.1|  mannose phosphate isomerase, isoform CRA_c            61.2    7e-08   
ref|XP_003267270.1|  PREDICTED: mannose-6-phosphate isomerase iso...  61.2    7e-08   
ref|XP_003283731.1|  hypothetical protein DICPUDRAFT_26332            61.2    7e-08   
emb|CDR46054.1|  CYFA0S21e01728g1_1                                   61.2    8e-08   
ref|XP_002146202.1|  mannose-6-phosphate isomerase, class I           61.2    8e-08   
ref|NP_001092020.1|  mannose-6-phosphate isomerase                    61.2    8e-08   
ref|XP_001268927.1|  mannose-6-phosphate isomerase, class I           61.2    9e-08   
gb|KFX44958.1|  Mannose-6-phosphate isomerase                         61.2    9e-08   
ref|XP_003267272.1|  PREDICTED: mannose-6-phosphate isomerase iso...  60.8    9e-08   
gb|KEY76734.1|  mannose 6 phosphate isomerase class I                 61.2    9e-08   
ref|NP_001276086.1|  mannose-6-phosphate isomerase isoform 4          60.8    9e-08   
gb|KIW58535.1|  mannose-6-phosphate isomerase, class I                61.2    9e-08   
ref|XP_001800818.1|  hypothetical protein SNOG_10550                  59.3    9e-08   
ref|XP_004029673.1|  mannose-6-phosphate isomerase, putative          60.5    1e-07   
gb|EPZ35741.1|  Mannose-6-phosphate isomerase, type I domain-cont...  60.8    1e-07   
gb|KFO65386.1|  Mannose-6-phosphate isomerase                         60.8    1e-07   
ref|XP_638475.1|  mannose-6-phosphate isomerase                       60.8    1e-07   
ref|XP_007282893.1|  mannose-6-phosphate isomerase                    60.8    1e-07   
gb|EQB57853.1|  hypothetical protein CGLO_01974                       60.8    1e-07   
ref|XP_001536654.1|  mannose-6-phosphate isomerase                    60.8    1e-07   
ref|XP_006126333.1|  PREDICTED: mannose-6-phosphate isomerase iso...  60.8    1e-07   
emb|CCI46765.1|  unnamed protein product                              60.5    1e-07   
gb|KIN05810.1|  hypothetical protein OIDMADRAFT_189374                60.8    1e-07   
ref|XP_010193565.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...  58.5    1e-07   
ref|XP_007832925.1|  Mannose-6-phosphate isomerase                    60.5    1e-07   
ref|XP_001264431.1|  mannose-6-phosphate isomerase, class I           60.5    1e-07   
gb|KIW54081.1|  mannose-6-phosphate isomerase, class I                60.5    1e-07   
ref|XP_005175413.1|  PREDICTED: mannose-6-phosphate isomerase         60.5    1e-07   
ref|XP_001233064.3|  PREDICTED: mannose-6-phosphate isomerase         60.5    1e-07   
ref|XP_752698.1|  mannose-6-phosphate isomerase, class I              60.5    1e-07   
gb|AAU06585.1|  mannosephosphate isomerase                            60.5    1e-07   
ref|XP_008021890.1|  hypothetical protein SETTUDRAFT_36928            60.5    1e-07   
dbj|BAG57385.1|  unnamed protein product                              60.1    1e-07   
gb|AGO11776.1|  AaceriADR003Cp                                        60.5    2e-07   
gb|EFA76020.1|  mannose-6-phosphate isomerase                         60.5    2e-07   
ref|NP_504843.1|  Protein C05C8.7                                     60.5    2e-07   
ref|XP_002126287.1|  PREDICTED: mannose-6-phosphate isomerase-like    60.5    2e-07   
ref|XP_009909891.1|  PREDICTED: mannose-6-phosphate isomerase iso...  60.5    2e-07   
ref|XP_011304120.1|  PREDICTED: mannose-6-phosphate isomerase-like    60.5    2e-07   
gb|ETN74545.1|  phosphomannose isomerase type I                       60.1    2e-07   
gb|EYC01141.1|  hypothetical protein Y032_0110g188                    60.5    2e-07   
gb|EJU05977.1|  mannos-6-phosphate isomerase                          60.1    2e-07   
gb|KIW39438.1|  mannose-6-phosphate isomerase, class I                60.1    2e-07   
gb|KDR75171.1|  hypothetical protein GALMADRAFT_249114                60.1    2e-07   
emb|CEP60384.1|  LALA0S01e09516g1_1                                   60.1    2e-07   
ref|XP_011108701.1|  hypothetical protein H072_2714                   60.1    2e-07   
ref|XP_008932049.1|  PREDICTED: mannose-6-phosphate isomerase iso...  60.1    2e-07   
gb|ERT00382.1|  mannose-6-phosphate isomerase, class I                60.1    2e-07   
ref|XP_009169023.1|  hypothetical protein T265_05690                  60.1    2e-07   
ref|XP_453675.1|  hypothetical protein                                60.1    2e-07   
gb|KFW76214.1|  Mannose-6-phosphate isomerase                         60.1    2e-07   
gb|ETN75179.1|  mannose-6-phosphate isomerase, class I                60.1    2e-07   
gb|KIX93517.1|  hypothetical protein Z520_10695                       60.1    2e-07   
ref|XP_003304903.1|  hypothetical protein PTT_17636                   60.1    2e-07   
gb|KHJ33041.1|  putative mannose-6-phosphate class i                  60.1    2e-07   
gb|EEH36234.2|  mannose-6-phosphate isomerase                         60.1    2e-07   
ref|XP_004362977.1|  zinc-containing alcohol dehydrogenase            60.1    2e-07   
gb|ELQ40245.1|  mannose-6-phosphate isomerase                         60.1    2e-07   
ref|XP_003715901.1|  mannose-6-phosphate isomerase                    60.1    2e-07   
ref|XP_010768130.1|  PREDICTED: mannose-6-phosphate isomerase-like    57.0    2e-07   
emb|CCX13665.1|  Similar to Mannose-6-phosphate isomerase; acc. n...  59.7    2e-07   
ref|XP_001940330.1|  mannose-6-phosphate isomerase                    59.7    2e-07   
gb|ETE58039.1|  Mannose-6-phosphate isomerase                         59.7    2e-07   
ref|XP_007684616.1|  hypothetical protein COCMIDRAFT_33673            59.7    2e-07   
gb|EMD90386.1|  hypothetical protein COCHEDRAFT_1139724               59.7    3e-07   
ref|XP_011406199.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-6-ph...  59.7    3e-07   
gb|KIW03585.1|  mannose-6-phosphate isomerase, class I                59.7    3e-07   
ref|XP_007580045.1|  putative mannose-6-phosphate isomerase protein   59.7    3e-07   
gb|EIE85057.1|  phosphomannose isomerase type I                       59.7    3e-07   
ref|XP_002375834.1|  mannose-6-phosphate isomerase, class I           59.7    3e-07   
ref|XP_001511999.1|  PREDICTED: mannose-6-phosphate isomerase         59.7    3e-07   
emb|CAP36419.2|  Protein CBG19118                                     59.7    3e-07   
ref|XP_003662419.1|  hypothetical protein MYCTH_2303016               59.7    3e-07   
ref|XP_007710100.1|  hypothetical protein COCCADRAFT_3239             59.7    3e-07   
ref|XP_008731993.1|  mannose-6-phosphate isomerase, class I           59.7    3e-07   
gb|KFH42006.1|  Mannose-6-phosphate isomerase-like protein            59.7    3e-07   
ref|XP_007588283.1|  putative mannose-6-phosphate isomerase protein   59.7    3e-07   
ref|XP_002637411.1|  Hypothetical protein CBG19118                    59.7    3e-07   
gb|EUN31014.1|  hypothetical protein COCVIDRAFT_88762                 59.7    3e-07   
ref|XP_002195681.1|  PREDICTED: mannose-6-phosphate isomerase         59.7    3e-07   
ref|XP_005111263.1|  PREDICTED: mannose-6-phosphate isomerase-lik...  59.7    3e-07   
ref|XP_005111262.1|  PREDICTED: mannose-6-phosphate isomerase-lik...  59.7    3e-07   
ref|XP_002559619.1|  Pc13g12020                                       59.7    3e-07   
ref|XP_001603028.1|  PREDICTED: mannose-6-phosphate isomerase         59.3    3e-07   
ref|XP_005487917.1|  PREDICTED: mannose-6-phosphate isomerase-like    57.8    3e-07   
gb|EWG86489.1|  Pmi40p                                                59.3    3e-07   
ref|NP_010918.1|  mannose-6-phosphate isomerase PMI40                 59.3    3e-07   
gb|EDN62969.1|  mannose-6-phosphate isomerase                         59.3    3e-07   
ref|XP_003646338.1|  hypothetical protein Ecym_4481                   59.3    3e-07   
gb|KIW80940.1|  mannose-6-phosphate isomerase, class I                59.3    3e-07   
emb|CDM28641.1|  Mannose-6-phosphate isomerase                        59.3    3e-07   
ref|XP_003374851.1|  mannose-6-phosphate isomerase                    59.3    3e-07   
ref|XP_005419847.1|  PREDICTED: mannose-6-phosphate isomerase         59.3    3e-07   
gb|EWG96411.1|  Pmi40p                                                59.3    3e-07   
ref|XP_009044459.1|  hypothetical protein LOTGIDRAFT_109203           59.3    3e-07   
ref|XP_008014046.1|  PREDICTED: mannose-6-phosphate isomerase iso...  59.3    3e-07   
gb|EER36519.1|  phosphomannose isomerase                              59.3    4e-07   
ref|XP_008014047.1|  PREDICTED: mannose-6-phosphate isomerase iso...  59.3    4e-07   
ref|XP_001840654.1|  mannose-6-phosphate isomerase                    59.3    4e-07   
gb|EEH06261.1|  phosphomannose isomerase                              59.3    4e-07   
emb|CBJ28777.1|  Mannose-6-phosphate isomerase, N-terminal fragment   57.0    4e-07   
gb|EUB57818.1|  putative mannose-6-phosphate isomerase                59.3    4e-07   
ref|XP_658271.1|  MANA_EMENI Mannose-6-phosphate isomerase (Phosp...  59.3    4e-07   
emb|CDS20831.1|  mannose 6 phosphate isomerase                        59.3    4e-07   
dbj|GAD95134.1|  mannose-6-phosphate isomerase, class I               59.3    4e-07   
gb|EPQ18013.1|  Mannose-6-phosphate isomerase                         59.3    4e-07   
gb|KGO46649.1|  Mannose-6-phosphate isomerase                         59.3    4e-07   
ref|NP_001240850.1|  mannose-6-phosphate isomerase                    59.3    4e-07   
gb|KGO75257.1|  Mannose-6-phosphate isomerase                         59.3    4e-07   
ref|XP_008014050.1|  PREDICTED: mannose-6-phosphate isomerase iso...  58.5    4e-07   
gb|KJA19592.1|  hypothetical protein HYPSUDRAFT_44152                 59.3    4e-07   
gb|KFO82051.1|  Mannose-6-phosphate isomerase                         58.9    4e-07   
gb|EHK25830.1|  hypothetical protein TRIVIDRAFT_85530                 58.9    4e-07   
gb|KHN82941.1|  Mannose-6-phosphate isomerase                         58.9    5e-07   
gb|EYC23561.1|  hypothetical protein Y032_0015g2723                   58.9    5e-07   
gb|KHJ95397.1|  phosphomannose isomerase type I                       58.9    5e-07   
gb|KIV83321.1|  mannose-6-phosphate isomerase, class I                58.9    5e-07   
gb|EKV06150.1|  Mannose-6-phosphate isomerase                         58.9    5e-07   
gb|KIW14070.1|  mannose-6-phosphate isomerase, class I                58.9    5e-07   
ref|XP_002937526.2|  PREDICTED: mannose-6-phosphate isomerase iso...  58.9    5e-07   
gb|KID97545.1|  mannose-6-phosphate isomerase                         58.9    5e-07   
ref|XP_001903224.1|  hypothetical protein                             58.9    5e-07   
gb|KFG79830.1|  mannose-6-phosphate isomerase                         58.9    5e-07   
gb|EHK39391.1|  hypothetical protein TRIATDRAFT_156021                58.9    5e-07   
gb|KID60308.1|  mannose-6-phosphate isomerase                         58.9    5e-07   
ref|XP_007824231.1|  mannose-6-phosphate isomerase                    58.9    6e-07   
gb|KID84974.1|  mannose-6-phosphate isomerase                         58.9    6e-07   
ref|XP_007809179.1|  mannose-6-phosphate isomerase                    58.9    6e-07   
ref|XP_010745585.1|  PREDICTED: mannose-6-phosphate isomerase         58.5    6e-07   
ref|XP_002559242.1|  Pc13g08170                                       58.5    6e-07   
gb|KIY53400.1|  mannose-6-phosphate isomerase                         58.5    6e-07   
ref|XP_004180741.1|  hypothetical protein TBLA_0E01650                58.5    6e-07   
gb|KII96085.1|  hypothetical protein PLICRDRAFT_130294                58.5    6e-07   
dbj|BAJ97590.1|  predicted protein                                    58.5    6e-07   
ref|XP_006969002.1|  mannose-6-phosphate isomerase                    58.5    6e-07   
ref|XP_010374183.1|  PREDICTED: mannose-6-phosphate isomerase iso...  58.5    6e-07   
ref|XP_010374182.1|  PREDICTED: mannose-6-phosphate isomerase iso...  58.5    6e-07   
gb|EKG20954.1|  Mannose-6-phosphate isomerase type I                  58.5    6e-07   
ref|XP_002625756.1|  mannose-6-phosphate isomerase                    58.5    6e-07   
ref|XP_003901264.1|  PREDICTED: mannose-6-phosphate isomerase iso...  58.5    6e-07   
ref|XP_005645250.1|  mannose-6-phosphate isomerase                    58.5    7e-07   
gb|KFM80450.1|  Mannose-6-phosphate isomerase                         58.5    7e-07   
ref|XP_957390.1|  mannose-6-phosphate isomerase                       58.5    7e-07   
gb|EEQ86957.1|  mannose-6-phosphate isomerase                         58.5    7e-07   
ref|XP_009847421.1|  hypothetical protein NEUTE1DRAFT_119344          58.5    7e-07   
ref|NP_984099.1|  ADR003Cp                                            58.5    7e-07   
ref|NP_001271952.1|  mannose-6-phosphate isomerase                    58.5    7e-07   
ref|XP_007601425.1|  phosphomannose isomerase type I                  58.5    7e-07   
ref|XP_009003515.1|  PREDICTED: mannose-6-phosphate isomerase iso...  58.5    7e-07   
gb|AAA34872.1|  phosphomannose isomerase                              58.5    7e-07   
gb|AEY96223.1|  FADR003Cp                                             58.5    7e-07   
gb|KIW63321.1|  mannose-6-phosphate isomerase, class I                58.5    7e-07   
ref|XP_002753391.1|  PREDICTED: mannose-6-phosphate isomerase iso...  58.5    7e-07   
ref|XP_003967298.1|  PREDICTED: mannose-6-phosphate isomerase-like    58.5    8e-07   
ref|XP_005316863.1|  PREDICTED: mannose-6-phosphate isomerase         58.2    8e-07   
emb|CDJ82540.1|  Mannose-6-phosphate isomerase domain containing ...  58.2    8e-07   
ref|XP_005775908.1|  hypothetical protein EMIHUDRAFT_52642            58.2    8e-07   
gb|KFR02075.1|  Mannose-6-phosphate isomerase                         58.2    8e-07   
sp|Q8J093.1|MPI_OGAPD  RecName: Full=Mannose-6-phosphate isomeras...  58.2    8e-07   
ref|XP_009208912.1|  PREDICTED: mannose-6-phosphate isomerase iso...  58.2    8e-07   
ref|XP_006679522.1|  hypothetical protein BATDEDRAFT_33280            58.2    8e-07   
gb|KHJ41246.1|  mannose-6-phosphate isomerase, class I                58.2    8e-07   
gb|KFD51617.1|  hypothetical protein M513_07496                       58.2    8e-07   
gb|EYE92363.1|  mannose-6-phosphate isomerase                         58.2    8e-07   
ref|XP_008608157.1|  phosphomannose isomerase type I                  58.2    8e-07   
gb|KDR14999.1|  Mannose-6-phosphate isomerase                         58.2    9e-07   
ref|XP_005882824.1|  PREDICTED: mannose-6-phosphate isomerase         58.2    9e-07   
gb|KIL62126.1|  hypothetical protein M378DRAFT_187424                 58.2    9e-07   
gb|KHN94858.1|  mannose-6-phosphate isomerase                         58.2    9e-07   
gb|KDO27723.1|  phosphomannose isomerase type I                       58.2    9e-07   
gb|KIX02250.1|  mannose-6-phosphate isomerase, class I                58.2    9e-07   
ref|XP_009160803.1|  mannose-6-phosphate isomerase                    58.2    9e-07   
ref|XP_002554760.1|  KLTH0F13134p                                     58.2    9e-07   
ref|XP_003234844.1|  mannose-6-phosphate isomerase                    58.2    9e-07   



>ref|XP_009591548.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana tomentosiformis]
Length=419

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 17/92 (18%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE-IQEGKPYAEFWMGTHESGPSYVV  529
            GG L+RL+  VKNYDWGR+G+ES VARLYSRN GD  I++ KPYAEFW+GTH+SGPSYVV
Sbjct  4    GGGLVRLKGCVKNYDWGRLGKESRVARLYSRNNGDHTIEQDKPYAEFWIGTHDSGPSYVV  63

Query  530  VGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                    R A NGL+         +TLK+WI
Sbjct  64   -------DRAAENGLA---------LTLKNWI  79



>ref|XP_009766829.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana sylvestris]
Length=440

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 63/88 (72%), Gaps = 7/88 (8%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            LLRL   VKNYDWGR G+ES VARLY  NTG +I E +PYAEFWMGTH+SGPSYVV    
Sbjct  20   LLRLTGCVKNYDWGRNGKESCVARLYGLNTGGKIYEDQPYAEFWMGTHDSGPSYVV----  75

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
               GR   NG +NG  ++K  +TL+DWI
Sbjct  76   -EEGRRTTNGFANGGEREK--LTLQDWI  100



>ref|XP_009757184.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana sylvestris]
Length=421

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 17/92 (18%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE-IQEGKPYAEFWMGTHESGPSYVV  529
            GG ++RL+  VKNYDWGR G+ES VARLYSRNTGD  I++ KPYAEFWMGTH+SGPSY+V
Sbjct  4    GGGVVRLKGCVKNYDWGRPGKESRVARLYSRNTGDHTIEQDKPYAEFWMGTHDSGPSYLV  63

Query  530  VGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
             G A            NG+A     +TLK+WI
Sbjct  64   KGAA-----------ENGLA-----LTLKNWI  79



>ref|XP_009409962.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 16/105 (15%)
 Frame = +2

Query  311  GKSMEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEF  490
            G++ME    P        LRLRC+V+NYDWGR G ES VARL+  N+G EI+ G+PYAEF
Sbjct  28   GEAMEAPPRP--------LRLRCSVQNYDWGRFGEESTVARLFEGNSGSEIELGRPYAEF  79

Query  491  WMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            WMGTHESGPS+VV   +P         L+ G      VVTLK WI
Sbjct  80   WMGTHESGPSFVV--ASPEAAVAEAECLAPG------VVTLKKWI  116



>ref|XP_009595066.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nicotiana tomentosiformis]
 ref|XP_009595070.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nicotiana tomentosiformis]
Length=416

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 57/90 (63%), Gaps = 21/90 (23%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            G+L++L C VKN DWGRIGRES VARLY RNTG EI   +PYAEFWMGTHESGPSYVV G
Sbjct  8    GSLIKLICCVKNSDWGRIGRESTVARLYYRNTGIEIDLDQPYAEFWMGTHESGPSYVVQG  67

Query  536  GAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                                   VTLKDWI
Sbjct  68   EK---------------------VTLKDWI  76



>ref|XP_009618411.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Nicotiana tomentosiformis]
Length=445

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            LLRL   VKNYDWGR G+ES VARLY  NTG +I E +PYAEFWMGTH+SGPSYVV  G 
Sbjct  22   LLRLTGCVKNYDWGRNGKESCVARLYGLNTGGKIDENQPYAEFWMGTHDSGPSYVVEEGR  81

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                    NG +NG  ++K  +TL+DWI
Sbjct  82   ----TTTENGFANGGEREK--LTLQDWI  103



>ref|XP_009383606.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            LRLRC+V+NYDWGR G ES VARL+ RN+G EI+ G+PYAEFWMGTHESGPS+VV  
Sbjct  10   LRLRCSVQNYDWGRFGEESTVARLFRRNSGKEIELGRPYAEFWMGTHESGPSFVVAA  66



>ref|XP_009798758.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nicotiana sylvestris]
Length=417

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 56/90 (62%), Gaps = 21/90 (23%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            G+L++L C VKN DWGRIGRES VA LY RNTG EI   +PYAEFWMGTHESGPSYVV G
Sbjct  8    GSLIKLICCVKNSDWGRIGRESTVACLYYRNTGIEIDLDQPYAEFWMGTHESGPSYVVQG  67

Query  536  GAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                                   VTLKDWI
Sbjct  68   EK---------------------VTLKDWI  76



>ref|XP_006346906.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Solanum tuberosum]
Length=435

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 66/102 (65%), Gaps = 9/102 (9%)
 Frame = +2

Query  320  MEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMG  499
            ME D + A    G L+RL   VKNYDWG  G+ES VARLY+ N+G+ + + KPYAEFWMG
Sbjct  1    MESDLLSAKDGRGRLVRLMGCVKNYDWGPPGKESRVARLYACNSGNYVDQEKPYAEFWMG  60

Query  500  THESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            TH+SGPSYVV G          NGL NG   +   +TLK+WI
Sbjct  61   THDSGPSYVVEG--------TENGLVNGKG-ETHKLTLKNWI  93



>gb|KDP32959.1| hypothetical protein JCGZ_12990 [Jatropha curcas]
Length=436

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 59/91 (65%), Gaps = 11/91 (12%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVV  532
            G  L RL+C+V+NYDWG+IG +S V RLY  N+G +I  GKPYAE WMGTHESGPS+VV 
Sbjct  13   GQRLQRLKCSVQNYDWGKIGLDSKVGRLYELNSGSQIDVGKPYAELWMGTHESGPSFVV-  71

Query  533  GGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                       NG+ NG       ++LK+WI
Sbjct  72   ----------ENGVENGNPIGSHSISLKEWI  92



>ref|XP_011097180.1| PREDICTED: mannose-6-phosphate isomerase 1 isoform X2 [Sesamum 
indicum]
Length=342

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 8/93 (9%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVV---  532
            +L+L+C+VK Y+WG+IG++S VARLY+ N+G+EI+  +PYAEFWMGTHESGPSY VV   
Sbjct  8    ILKLKCSVKRYEWGKIGKDSRVARLYANNSGEEIRGDEPYAEFWMGTHESGPSYAVVLVE  67

Query  533  --GGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
              GG    G    NG          +++LKDWI
Sbjct  68   ENGGLSNGGLQRENGRKRNYCD---LMSLKDWI  97



>ref|XP_011099550.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Sesamum indicum]
Length=452

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 10/95 (11%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVV---  532
            +++L+C+VKNYDWG++G+ES VARL  +NTG+E    +PYAEFWMGTH+SGPSYVVV   
Sbjct  8    IVKLKCSVKNYDWGKVGKESAVARLCVKNTGEETDGDEPYAEFWMGTHDSGPSYVVVSVE  67

Query  533  --GGAPPPG--RIAGNGLSNGVAKDKFVVTLKDWI  625
              GG    G  R  G+G          +V+LKDWI
Sbjct  68   ANGGYANGGLEREDGHGCERKCCN---LVSLKDWI  99



>ref|XP_011097179.1| PREDICTED: mannose-6-phosphate isomerase 1 isoform X1 [Sesamum 
indicum]
Length=439

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 8/93 (9%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVV---  532
            +L+L+C+VK Y+WG+IG++S VARLY+ N+G+EI+  +PYAEFWMGTHESGPSY VV   
Sbjct  8    ILKLKCSVKRYEWGKIGKDSRVARLYANNSGEEIRGDEPYAEFWMGTHESGPSYAVVLVE  67

Query  533  --GGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
              GG    G    NG          +++LKDWI
Sbjct  68   ENGGLSNGGLQRENGRKRNYCD---LMSLKDWI  97



>gb|EYU34411.1| hypothetical protein MIMGU_mgv1a006972mg [Erythranthe guttata]
Length=424

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 61/95 (64%), Gaps = 20/95 (21%)
 Frame = +2

Query  347  GTGGA--LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPS  520
            G GG   ++RLRC+V  Y+WG++G ESGVARLY++N GDEI  G PYAEFWMGTHESGPS
Sbjct  3    GAGGVPGIVRLRCSVMRYEWGKLGEESGVARLYAKNNGDEIDGGGPYAEFWMGTHESGPS  62

Query  521  YVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            Y           +  +G S         ++LKDWI
Sbjct  63   YA----------MEASGGSE--------ISLKDWI  79



>ref|XP_006357852.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Solanum tuberosum]
Length=440

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 66/104 (63%), Gaps = 8/104 (8%)
 Frame = +2

Query  320  MEVDGVPAAGTGG--ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFW  493
            ME DG+      G   LLRL  +VKNYDWGR  +ES V RLY  N+G +I E + YAEFW
Sbjct  1    MEADGLSTTMEEGFKGLLRLMGSVKNYDWGRSAKESCVGRLYRLNSGRKIDEKQQYAEFW  60

Query  494  MGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            MGTH+SGPSY+V  G    GRI  NG +NG    +   TLKDWI
Sbjct  61   MGTHDSGPSYIVEEG----GRIQ-NGYANG-GGIRNKCTLKDWI  98



>ref|XP_004233489.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Solanum lycopersicum]
Length=435

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 9/102 (9%)
 Frame = +2

Query  320  MEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMG  499
            M+ D +      G L+RL   VKNYDWG  G+ES VARLY+ N+G+ + + KPYAEFWMG
Sbjct  1    MDTDLLSVTEGRGRLVRLMGCVKNYDWGPPGKESRVARLYACNSGNYVDQEKPYAEFWMG  60

Query  500  THESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            TH+SGPSYVV G          NGL NG   +   +TLK+WI
Sbjct  61   THDSGPSYVVEG--------TENGLVNGKG-EGHKLTLKNWI  93



>gb|EYU44628.1| hypothetical protein MIMGU_mgv1a0065652mg, partial [Erythranthe 
guttata]
Length=171

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L++L+CAVKNYDWG++G +S V+RLY+ N+  E+    PYAEFWMGTH+SGPSY  V   
Sbjct  8    LVKLKCAVKNYDWGKVGEKSSVSRLYANNSRAEVDADSPYAEFWMGTHDSGPSYAAV---  64

Query  542  PPPGRIAGNGLSNGVAKDKF-VVTLKDWI  625
              P   +     NG  ++    V+LKDWI
Sbjct  65   --PNGDSEERRDNGFKRENSNSVSLKDWI  91



>ref|XP_002531475.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF30899.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
Length=374

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 11/88 (13%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L RLRC+V+NY+WG+IG +S VA+LY+ N+G EI+  KPYAE WMGTH+SGPS+VV  G 
Sbjct  10   LKRLRCSVQNYNWGKIGSDSQVAKLYALNSGSEIEVDKPYAELWMGTHDSGPSFVVESGG  69

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                        NG+      ++LKDWI
Sbjct  70   -----------ENGIGIGSQSLSLKDWI  86



>ref|XP_006365538.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Solanum tuberosum]
Length=418

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            G L++L C VK  DWGRIGRES VARLY RNTG  I + +PYAEFWMGTHESGPSYV
Sbjct  6    GGLIKLICCVKKSDWGRIGRESTVARLYYRNTGINIDQNQPYAEFWMGTHESGPSYV  62



>ref|NP_176878.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9FZH5.1|MPI2_ARATH RecName: Full=Mannose-6-phosphate isomerase 2; AltName: Full=Phosphohexomutase 
2; AltName: Full=Phosphomannose isomerase 
2; Short=PMI2; AltName: Full=Protein DARK INDUCIBLE 9 [Arabidopsis 
thaliana]
 gb|AAF98217.1|AC007152_13 Putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 dbj|BAD44244.1| phosphomannose isomerase (din9) [Arabidopsis thaliana]
 gb|ABG25084.1| At1g67070 [Arabidopsis thaliana]
 gb|AEE34592.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
Length=441

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +2

Query  308  GGKSMEVDGVPAAG-TGGA-LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPY  481
            G  +++ +G   A  TGG  + RLRC VKNY+WG++G ES VARL   NTG  +    PY
Sbjct  2    GADAIQTNGHDQAKLTGGEEIQRLRCFVKNYEWGKLGPESLVARLQEANTGQRVDSEIPY  61

Query  482  AEFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            AEFWMGTHESGPS+V  G        +G+G+S     DK +VTLK W+
Sbjct  62   AEFWMGTHESGPSHVEFG--------SGHGVS-----DKCMVTLKSWV  96



>ref|XP_008797801.1| PREDICTED: LOW QUALITY PROTEIN: mannose-6-phosphate isomerase 
1-like [Phoenix dactylifera]
Length=424

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 14/87 (16%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            LRLRC+V+NY+WG++G +S VARL+SRN+G EI   +PYAEFWMGTHESGPS++V   + 
Sbjct  7    LRLRCSVQNYEWGKLGEDSRVARLFSRNSGAEIDPERPYAEFWMGTHESGPSFLVRAESG  66

Query  545  PPGRIAGNGLSNGVAKDKFVVTLKDWI  625
             P              D   VTL+ WI
Sbjct  67   SP--------------DSEPVTLRKWI  79



>dbj|BAD44147.1| phosphomannose isomerase (din9) [Arabidopsis thaliana]
Length=441

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +2

Query  308  GGKSMEVDGVPAAG-TGGA-LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPY  481
            G  +++ +G   A  TGG  + RLRC VKNY+WG++G ES VARL   NTG  +    PY
Sbjct  2    GADAIQTNGHDQAKLTGGEEIQRLRCFVKNYEWGKLGPESLVARLQEANTGQRVDSEIPY  61

Query  482  AEFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            AEFWMGTHESGPS+V  G        +G+G+S     DK +VTLK W+
Sbjct  62   AEFWMGTHESGPSHVEFG--------SGHGVS-----DKCMVTLKSWV  96



>ref|XP_009356248.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=358

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG +GR S VARL++ N+G +I  GKPYAEFW+GTHESGPSY   G  P
Sbjct  20   VRLRCSVKNYDWGIVGRNSKVARLFALNSGSDIDPGKPYAEFWIGTHESGPSYADSGSEP  79



>ref|XP_008807087.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X3 [Phoenix 
dactylifera]
Length=326

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            L LRC+V+ YDWG++G ES VARL+SRN+  EI+  +PYAEFWMGTHESGPS+VV G + 
Sbjct  9    LNLRCSVQKYDWGKLGEESRVARLFSRNSEAEIEPERPYAEFWMGTHESGPSFVVRGESG  68

Query  545  PP  550
             P
Sbjct  69   SP  70



>ref|XP_004232352.1| PREDICTED: mannose-6-phosphate isomerase 2 [Solanum lycopersicum]
Length=434

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            LLRL  +VKNYDWGR  +ES V RLY  N+  +I E +PYAEFWMGTH+SGPSY+VV   
Sbjct  10   LLRLIGSVKNYDWGRTAKESCVGRLYRLNSRTKIDEKQPYAEFWMGTHDSGPSYIVVERG  69

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
               GRI     + G  +DK   +LKDWI
Sbjct  70   ---GRIQNGHANGGGIRDK--CSLKDWI  92



>ref|XP_008389273.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Malus 
domestica]
Length=363

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC VKNYDWG +GR S VARL++ N+G +I  GKPYAEFW+GTHESGPSY   G  P
Sbjct  20   VRLRCXVKNYDWGIVGRNSKVARLFALNSGSDIDPGKPYAEFWIGTHESGPSYADSGSEP  79



>ref|XP_010470599.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X1 [Camelina 
sativa]
Length=498

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 82/145 (57%), Gaps = 15/145 (10%)
 Frame = +2

Query  200  FTENSICRFSYNWVIYLLILSAWIHSSGLLILCVQTGGKSMEVDGVPAAG--TGG-ALLR  370
             T   + R +++ V Y++++   +  S       + G  +++ +G   A   TGG  + R
Sbjct  21   ITHREVTRKTHSSVFYIIVICILLSDSS--ATNKKMGADAIQTNGHDQAKLLTGGEKIQR  78

Query  371  LRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAPPP  550
            LRC VKNY+WG++G +S VARL   N+G ++    P+AEFWMGTHESGPS+V        
Sbjct  79   LRCFVKNYEWGKLGPDSLVARLQEANSGGKVDAAVPHAEFWMGTHESGPSHVEF------  132

Query  551  GRIAGNGLSNGVAKDKFVVTLKDWI  625
                G+G + G   +K +VTLK W+
Sbjct  133  ----GSGQNEGSDNNKCMVTLKSWV  153



>ref|XP_010470600.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X2 [Camelina 
sativa]
Length=500

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 82/145 (57%), Gaps = 15/145 (10%)
 Frame = +2

Query  200  FTENSICRFSYNWVIYLLILSAWIHSSGLLILCVQTGGKSMEVDGVPAAG--TGG-ALLR  370
             T   + R +++ V Y++++   +  S       + G  +++ +G   A   TGG  + R
Sbjct  21   ITHREVTRKTHSSVFYIIVICILLSDSS--ATNKKMGADAIQTNGHDQAKLLTGGEKIQR  78

Query  371  LRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAPPP  550
            LRC VKNY+WG++G +S VARL   N+G ++    P+AEFWMGTHESGPS+V        
Sbjct  79   LRCFVKNYEWGKLGPDSLVARLQEANSGGKVDAAVPHAEFWMGTHESGPSHVEF------  132

Query  551  GRIAGNGLSNGVAKDKFVVTLKDWI  625
                G+G + G   +K +VTLK W+
Sbjct  133  ----GSGQNEGSDNNKCMVTLKSWV  153



>ref|XP_010916406.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Elaeis guineensis]
Length=426

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 14/87 (16%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            LRLRC+++NYDWG++G +S VARL+SRN+G EI   +PYAEFWMGTHESGPS++  G + 
Sbjct  9    LRLRCSIQNYDWGKLGEDSRVARLFSRNSGAEIDPERPYAEFWMGTHESGPSFLARGESG  68

Query  545  PPGRIAGNGLSNGVAKDKFVVTLKDWI  625
             P              D   +TL+ WI
Sbjct  69   GP--------------DSEPLTLRKWI  81



>ref|XP_009356247.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=438

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG +GR S VARL++ N+G +I  GKPYAEFW+GTHESGPSY   G  P
Sbjct  20   VRLRCSVKNYDWGIVGRNSKVARLFALNSGSDIDPGKPYAEFWIGTHESGPSYADSGSEP  79



>ref|XP_004242042.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Solanum lycopersicum]
Length=418

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            G L++L C VK  DWGRIG+ES VARLY RNTG  I + +PYAEFWMGTHESGPSYV
Sbjct  6    GGLIKLICCVKKSDWGRIGQESTVARLYYRNTGINIDQNQPYAEFWMGTHESGPSYV  62



>ref|XP_002283926.1| PREDICTED: mannose-6-phosphate isomerase 1 [Vitis vinifera]
Length=420

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L RLRC+V+NYDWGR+G ES VARL+S N+G E+Q  KPYAE WMGTHESGPS+++
Sbjct  12   LRRLRCSVQNYDWGRLGSESTVARLFSMNSGAEVQLDKPYAELWMGTHESGPSFLI  67



>ref|XP_008367007.1| PREDICTED: LOW QUALITY PROTEIN: mannose-6-phosphate isomerase 
1-like [Malus domestica]
Length=439

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC VKNYDWG +GR S VARL++ N+G +I  GKPYAEFW+GTHESGPSY   G  P
Sbjct  20   VRLRCXVKNYDWGIVGRNSKVARLFALNSGSDIDPGKPYAEFWIGTHESGPSYADSGSEP  79



>ref|XP_008389272.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Malus 
domestica]
Length=439

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC VKNYDWG +GR S VARL++ N+G +I  GKPYAEFW+GTHESGPSY   G  P
Sbjct  20   VRLRCXVKNYDWGIVGRNSKVARLFALNSGSDIDPGKPYAEFWIGTHESGPSYADSGSEP  79



>ref|XP_009356977.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=244

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG  GR S VARL++ N+G +I  G+PYAEFW+GTHESGPSY   G  P
Sbjct  20   VRLRCSVKNYDWGIFGRNSKVARLFALNSGSDIDSGRPYAEFWIGTHESGPSYADSGSEP  79



>emb|CAN60179.1| hypothetical protein VITISV_011365 [Vitis vinifera]
Length=455

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L RLRC+V+NYDWGR+G ES VARL+S N+G E+Q  KPYAE WMGTHESGPS+++
Sbjct  47   LRRLRCSVQNYDWGRLGSESTVARLFSMNSGAEVQLDKPYAELWMGTHESGPSFLI  102



>ref|XP_007222285.1| hypothetical protein PRUPE_ppa005896mg [Prunus persica]
 gb|EMJ23484.1| hypothetical protein PRUPE_ppa005896mg [Prunus persica]
Length=438

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG +GR S VARL++ N+G +I   KPYAEFW+GTHESGPSY   G  P
Sbjct  19   VRLRCSVKNYDWGIVGRHSKVARLFALNSGSDIDPAKPYAEFWIGTHESGPSYADSGSEP  78



>ref|XP_008807086.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X2 [Phoenix 
dactylifera]
Length=426

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG--G  538
            L LRC+V+ YDWG++G ES VARL+SRN+  EI+  +PYAEFWMGTHESGPS+VV G  G
Sbjct  9    LNLRCSVQKYDWGKLGEESRVARLFSRNSEAEIEPERPYAEFWMGTHESGPSFVVRGESG  68

Query  539  AP  544
            +P
Sbjct  69   SP  70



>gb|AAG23720.1|AF159377_1 phosphomannose isomerase [Arabidopsis thaliana]
Length=235

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 64/110 (58%), Gaps = 20/110 (18%)
 Frame = +2

Query  299  VQTGGKSMEVDGVPAAGTGGA-LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGK  475
            +QT G         A  TGG  + RLRC VKNY+WG++G ES VARL   NTG  +    
Sbjct  1    IQTNGHDQ------AKLTGGEEIQRLRCFVKNYEWGKLGPESLVARLQEANTGQRVDSEI  54

Query  476  PYAEFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            PYAEFWMGTHESGPS+V  G        +G+G+      DK + TLK W+
Sbjct  55   PYAEFWMGTHESGPSHVEFG--------SGHGVF-----DKCMATLKSWV  91



>ref|XP_008807084.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807085.1| PREDICTED: mannose-6-phosphate isomerase 2-like isoform X1 [Phoenix 
dactylifera]
Length=435

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG--G  538
            L LRC+V+ YDWG++G ES VARL+SRN+  EI+  +PYAEFWMGTHESGPS+VV G  G
Sbjct  9    LNLRCSVQKYDWGKLGEESRVARLFSRNSEAEIEPERPYAEFWMGTHESGPSFVVRGESG  68

Query  539  AP  544
            +P
Sbjct  69   SP  70



>ref|XP_009356970.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=439

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG  GR S VARL++ N+G +I  G+PYAEFW+GTHESGPSY   G  P
Sbjct  20   VRLRCSVKNYDWGIFGRNSKVARLFALNSGSDIDSGRPYAEFWIGTHESGPSYADSGSEP  79



>ref|XP_008339655.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Malus domestica]
Length=452

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG  GR S VARL++ N+G +I  G+PYAEFW+GTHESGPSY   G  P
Sbjct  33   VRLRCSVKNYDWGIFGRNSKVARLFALNSGSDIDSGRPYAEFWIGTHESGPSYADSGSEP  92



>ref|XP_010926023.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Elaeis guineensis]
Length=426

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 14/87 (16%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            L LRC+V+ YDWG++G++S VARL+SRN+  EI+  +PYAEFWMGTHESGPS++V G + 
Sbjct  9    LSLRCSVQKYDWGKLGKDSKVARLFSRNSEAEIEPERPYAEFWMGTHESGPSFLVRGESG  68

Query  545  PPGRIAGNGLSNGVAKDKFVVTLKDWI  625
             P              D   V+L+ WI
Sbjct  69   SP--------------DSKPVSLRKWI  81



>ref|XP_010265087.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Nelumbo nucifera]
Length=431

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 13/88 (15%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L  LRC+V+NYDWGRIG ES VA L+  N+G EIQ  KPYAE WMGTH SGPS++++G  
Sbjct  13   LQLLRCSVQNYDWGRIGEESKVAELFLLNSGMEIQNDKPYAELWMGTHNSGPSFLILG--  70

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                R  G+GL          ++LK WI
Sbjct  71   ---NRDGGSGLEP--------LSLKSWI  87



>ref|XP_008243257.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Prunus mume]
Length=438

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG +GR S VARL++ N+G +I   KPYAEFW+GTHESGPS+   G  P
Sbjct  19   VRLRCSVKNYDWGIVGRHSKVARLFALNSGSDIDPAKPYAEFWIGTHESGPSFADSGSEP  78



>ref|XP_010098415.1| Mannose-6-phosphate isomerase [Morus notabilis]
 gb|EXC44004.1| Mannose-6-phosphate isomerase [Morus notabilis]
Length=244

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = +2

Query  347  GTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
                 + RLRC+V+NYDWGR G +S VA LY+ N+G EI   KPYAE WMGTH+SGPS++
Sbjct  6    AIASKVQRLRCSVQNYDWGRKGVDSTVAELYALNSGSEIDPEKPYAEIWMGTHDSGPSFL  65

Query  527  VVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            V       G ++    S+G        +LK WI
Sbjct  66   VPSEHKSNGNLSVEFGSHG-------ESLKSWI  91



>ref|XP_004300283.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Fragaria vesca 
subsp. vesca]
Length=434

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 17/89 (19%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            ++ RL C+V+NYDWG+IG +S VARLY+ N+G EI   KPYAEFWMGTH+SGPS+++   
Sbjct  16   SVQRLCCSVQNYDWGKIGPDSEVARLYASNSGSEIDPEKPYAEFWMGTHDSGPSFLIQKD  75

Query  539  APPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                     NG+S         ++LK+WI
Sbjct  76   L--------NGMS---------MSLKEWI  87



>ref|XP_010693191.1| PREDICTED: mannose-6-phosphate isomerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=479

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 10/93 (11%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNT-GDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            L RL+C+VKNYDWG+IG +S V RL+S N+ G+++   +PYAEFWMGTHESGPS+V+   
Sbjct  50   LQRLKCSVKNYDWGKIGSDSEVYRLFSANSEGNKLDPNRPYAEFWMGTHESGPSHVI---  106

Query  539  APPPGRIAGNG----LSNGVAKDKFVVTLKDWI  625
                G++  NG    + NG   D    TLK WI
Sbjct  107  --KKGKVLANGNHGFVLNGKFGDLEGDTLKSWI  137



>ref|XP_011021254.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Populus euphratica]
Length=437

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 14/94 (15%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRE-SGVARLYSRNTGDEI--QEGKPYAEFWMGTHESGPSY  523
            GG L RLRC+V+NYDWG+ G E S VARLY  N+G +I  ++ KP+AEFW+GTH SGPS+
Sbjct  11   GGGLKRLRCSVQNYDWGKKGTEGSEVARLYELNSGYDIAFEKKKPFAEFWVGTHGSGPSF  70

Query  524  VVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            VV GG         NG SNG       ++LK+WI
Sbjct  71   VVEGGVE-------NGDSNGSGS----LSLKEWI  93



>ref|XP_006383443.1| hypothetical protein POPTR_0005s15560g [Populus trichocarpa]
 gb|ERP61240.1| hypothetical protein POPTR_0005s15560g [Populus trichocarpa]
Length=434

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 14/94 (15%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRE-SGVARLYSRNTGDEI--QEGKPYAEFWMGTHESGPSY  523
            GG L RLRC+V+NYDWG+ G E S VARLY  N+G +I  ++ KP+AEFW+GTH SGPS+
Sbjct  11   GGGLKRLRCSVQNYDWGKKGTEGSEVARLYELNSGYDIAFEKKKPFAEFWVGTHGSGPSF  70

Query  524  VVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            VV GG         NG SNG       ++LK+WI
Sbjct  71   VVEGGVE-------NGDSNGSGS----LSLKEWI  93



>ref|XP_004165797.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis sativus]
Length=441

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 61/102 (60%), Gaps = 12/102 (12%)
 Frame = +2

Query  320  MEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMG  499
            ME D  P       + RL+C+V+ YDWG  G++S VARL++ N+G  I   KPYAEFWMG
Sbjct  1    MESDAFPTKKQSN-VFRLKCSVQTYDWGIRGQDSLVARLFALNSGSLIDPHKPYAEFWMG  59

Query  500  THESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            TH+SGPS+++    PP        + NG   D +  +LK W+
Sbjct  60   THDSGPSFLI----PP-------AVENGGRIDSYSTSLKSWV  90



>ref|XP_008457018.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis melo]
Length=441

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 12/102 (12%)
 Frame = +2

Query  320  MEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMG  499
            ME D  P       + RL+C+V+ YDWG  G++S VARL++ N+G  I   KPYAEFWMG
Sbjct  1    MESDAFPTKKQSN-VFRLKCSVQTYDWGIRGQDSLVARLFALNSGSVIDPDKPYAEFWMG  59

Query  500  THESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            TH+SGPS+++       GRI           D +  +LK W+
Sbjct  60   THDSGPSFLIPAAVENGGRI-----------DSYSTSLKSWV  90



>ref|XP_010549921.1| PREDICTED: mannose-6-phosphate isomerase 1 [Tarenaya hassleriana]
Length=428

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 60/106 (57%), Gaps = 24/106 (23%)
 Frame = +2

Query  320  MEVDGVPAAGTGGALLR----LRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAE  487
            ME D + A G     LR    LRC+VK+YDWGR G +S VARL+S N+G +I   +PYAE
Sbjct  1    METDSIEANGGCAVDLRRIRRLRCSVKDYDWGRTGSDSLVARLHSTNSGAQIDSTRPYAE  60

Query  488  FWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
             WMGTH SGPSY+  G             SNG       +TLK WI
Sbjct  61   LWMGTHGSGPSYLADG-------------SNG-------MTLKSWI  86



>ref|XP_010061894.1| PREDICTED: mannose-6-phosphate isomerase 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW68933.1| hypothetical protein EUGRSUZ_F02498 [Eucalyptus grandis]
Length=310

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 11/88 (13%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L RLRC+V+ YDWGR G ES VA+L++ N+G E    +PYAEFWMGTH SGPS+++  G 
Sbjct  9    LRRLRCSVQKYDWGRRGAESRVAKLFALNSGAEADPDRPYAEFWMGTHGSGPSFLLPAG-  67

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                   GNG  + V+ D   VTLK WI
Sbjct  68   ------CGNG-GHKVSPD---VTLKAWI  85



>ref|XP_004145852.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis sativus]
 gb|KGN57784.1| Phosphomannose isomerase [Cucumis sativus]
Length=441

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 62/102 (61%), Gaps = 12/102 (12%)
 Frame = +2

Query  320  MEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMG  499
            ME D +P       + +L+C+V+ YDWG  G++S VARL++ N+G  I   KPYAEFWMG
Sbjct  1    MESDALPTKKQSN-VFQLKCSVQTYDWGIRGQDSLVARLFALNSGSLIDPDKPYAEFWMG  59

Query  500  THESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            TH+SGPS+++    PP        + NG   D +  +LK W+
Sbjct  60   THDSGPSFLI----PP-------AVENGGRIDSYSTSLKSWV  90



>ref|XP_009127517.1| PREDICTED: mannose-6-phosphate isomerase 2 [Brassica rapa]
Length=444

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 10/86 (12%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAPP  547
            RLRCAVKNY+WG++G ES VARL+  N+G+ +    P+AE WMGTHESGPS+VV      
Sbjct  24   RLRCAVKNYEWGKLGHESLVARLHEANSGNRVDPAVPHAELWMGTHESGPSHVV------  77

Query  548  PGRIAGNGLSNGVAKDKFVVTLKDWI  625
                    L +G      +VTLK W+
Sbjct  78   ----KEEELGSGHCGSDCMVTLKSWV  99



>ref|XP_002887099.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63358.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 57/91 (63%), Gaps = 12/91 (13%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVV  532
            G  + RLRC VKNY+WG++G +S VARL   NTG  +    P+AEFWMGTHESGPS+V  
Sbjct  19   GEEIQRLRCFVKNYEWGKLGPDSLVARLQEANTGQRVDPEIPHAEFWMGTHESGPSHVEF  78

Query  533  GGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            G         G+G S     DK +VTLK W+
Sbjct  79   GS-------LGHGGS-----DKCMVTLKSWV  97



>ref|XP_010415256.1| PREDICTED: mannose-6-phosphate isomerase 2 [Camelina sativa]
Length=444

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 12/108 (11%)
 Frame = +2

Query  308  GGKSMEVDGVPAAG-TGGA-LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPY  481
            G  +++ +G   A  TGG  + RLRC VKNY+WG++G +S VARL   N G ++    P+
Sbjct  2    GADAIQTNGHDQAKLTGGEEIQRLRCFVKNYEWGKLGPDSLVARLQEANLGGKVDAAVPH  61

Query  482  AEFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            AEFWMGTHESGPS+V            G+G + G   +K +VTLK W+
Sbjct  62   AEFWMGTHESGPSHVGF----------GSGQNEGSDNNKCMVTLKSWV  99



>ref|XP_011464099.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Fragaria vesca 
subsp. vesca]
Length=437

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +RLRC+VKNYDWG +G  S VARL++ N+G +I   KPYAEFW+GTHESGPS+   G   
Sbjct  16   VRLRCSVKNYDWGILGHHSKVARLFALNSGSDIDPAKPYAEFWIGTHESGPSFAESGSEE  75

Query  545  PP  550
             P
Sbjct  76   DP  77



>ref|XP_010511622.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Camelina sativa]
Length=445

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 13/109 (12%)
 Frame = +2

Query  308  GGKSMEVDGVPAAG--TGGA-LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKP  478
            G  +++ +G   A   TGG  + RL C VKNY+WG++G +S VARL   N+G+++    P
Sbjct  2    GADAIQTNGHDQAKLLTGGEEIQRLICFVKNYEWGKLGPDSLVARLQEANSGEKVDAAVP  61

Query  479  YAEFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            +AEFWMGTHESGPS+V            G+G + G   +K +VTLK W+
Sbjct  62   HAEFWMGTHESGPSHVQF----------GSGQNTGSDNNKCMVTLKSWV  100



>gb|AEJ89929.1| mannose-6-phosphate isomerase-like protein [Brassica rapa subsp. 
chinensis]
Length=444

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 10/86 (12%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAPP  547
            RLRCAVKNY+WG++G ES VARL+  N+G+ +    P+AE WMGTHESGPS+VV      
Sbjct  24   RLRCAVKNYEWGKLGHESLVARLHEANSGNRVDPAVPHAELWMGTHESGPSHVV------  77

Query  548  PGRIAGNGLSNGVAKDKFVVTLKDWI  625
                    L +G      +VTLK W+
Sbjct  78   ----KEEELGSGHGGSDCMVTLKSWV  99



>emb|CDY12611.1| BnaA02g12790D [Brassica napus]
Length=444

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 10/86 (12%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAPP  547
            RLRCAVKNY+WG++G ES VARL+  N+G+ +    P+AE WMGTHESGPS+VV      
Sbjct  24   RLRCAVKNYEWGKLGHESLVARLHEANSGNRVDPAVPHAELWMGTHESGPSHVV------  77

Query  548  PGRIAGNGLSNGVAKDKFVVTLKDWI  625
                    L +G      +VTLK W+
Sbjct  78   ----KEEELGSGHGGSDCMVTLKSWV  99



>ref|XP_006391469.1| hypothetical protein EUTSA_v10018552mg [Eutrema salsugineum]
 gb|ESQ28755.1| hypothetical protein EUTSA_v10018552mg [Eutrema salsugineum]
Length=445

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 12/108 (11%)
 Frame = +2

Query  308  GGKSMEVDGVPAAGTGGA--LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPY  481
            G  +++ +G   A    A  + RLRCAVKNY+WG++G +S VARL+  N+GD +    P+
Sbjct  2    GADAIQTNGHDPAKLTAARGIQRLRCAVKNYEWGKLGPDSLVARLHEANSGDRVDPVVPH  61

Query  482  AEFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            AE WMGTHES PSYVV       GR   NG        + +VTLK W+
Sbjct  62   AELWMGTHESAPSYVVKEEEFGSGR---NG-------SECMVTLKSWV  99



>ref|XP_008244515.1| PREDICTED: mannose-6-phosphate isomerase 1 [Prunus mume]
Length=440

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 14/109 (13%)
 Frame = +2

Query  299  VQTGGKSMEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKP  478
            +++ GKSM+           +L RLRC+V+NYDWG+ G +S VARL + N+  EI   KP
Sbjct  1    MESIGKSMK-----HHNQKSSLQRLRCSVQNYDWGKRGTDSLVARLSALNSSSEIDPEKP  55

Query  479  YAEFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            YAE WMGTHESGPS+++  G    G ++    S         ++LKDW+
Sbjct  56   YAEIWMGTHESGPSFLIQNGDENNGFLSIGSES---------LSLKDWV  95



>emb|CDY42336.1| BnaC02g17130D [Brassica napus]
Length=444

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 10/86 (12%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAPP  547
            RLRCAVKNY+WG++G +S VARL+  N+G+ +    P+AE WMGTHESGPS+VV      
Sbjct  24   RLRCAVKNYEWGKLGHDSLVARLHEANSGNRVDPAVPHAELWMGTHESGPSHVV------  77

Query  548  PGRIAGNGLSNGVAKDKFVVTLKDWI  625
                    L +G    + +VTLK W+
Sbjct  78   ----KEEELGSGHGGSECMVTLKSWV  99



>ref|XP_010061893.1| PREDICTED: mannose-6-phosphate isomerase 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW68932.1| hypothetical protein EUGRSUZ_F02498 [Eucalyptus grandis]
Length=439

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 11/88 (13%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L RLRC+V+ YDWGR G ES VA+L++ N+G E    +PYAEFWMGTH SGPS+++  G 
Sbjct  9    LRRLRCSVQKYDWGRRGAESRVAKLFALNSGAEADPDRPYAEFWMGTHGSGPSFLLPAG-  67

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                   GNG  + V+ D   VTLK WI
Sbjct  68   ------CGNG-GHKVSPD---VTLKAWI  85



>ref|XP_006303108.1| hypothetical protein CARUB_v100218701mg, partial [Capsella rubella]
 gb|EOA36006.1| hypothetical protein CARUB_v100218701mg, partial [Capsella rubella]
Length=119

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 17/93 (18%)
 Frame = +2

Query  350  TGGA-LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            TGG  + RLRC VKNY+WG++G +S VARL   N+G  +    P+AEFWMGTHESGPS+V
Sbjct  19   TGGEEIQRLRCFVKNYEWGKLGPDSLVARLQEANSGRRVDSAVPHAEFWMGTHESGPSHV  78

Query  527  VVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
              G                   DK +VTLK W+
Sbjct  79   GFGS----------------GSDKCMVTLKSWV  95



>ref|XP_010107822.1| putative mannose-6-phosphate isomerase [Morus notabilis]
 gb|EXC17063.1| putative mannose-6-phosphate isomerase [Morus notabilis]
Length=435

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = +2

Query  347  GTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
                 + RLRC+V+NYDWGR G +S VA LY+ N+G EI   KPYAE WMGTH+SGPS++
Sbjct  6    AIASKVQRLRCSVQNYDWGRKGVDSTVAELYALNSGSEIDPEKPYAEIWMGTHDSGPSFL  65

Query  527  VVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            V       G ++    S+G        +LK WI
Sbjct  66   VPSEHKSNGNLSVEFGSHG-------ESLKSWI  91



>ref|XP_002526993.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF35365.1| mannose-6-phosphate isomerase, putative [Ricinus communis]
Length=446

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            RL+C+V NYDWG +G+ S VARL+S N+G +I  GKPYAEFW+GTH+SGPS+V
Sbjct  30   RLKCSVHNYDWGIVGKNSQVARLFSLNSGSDIDPGKPYAEFWIGTHKSGPSFV  82



>ref|XP_002305820.1| DARK INDUCIBLE 9 family protein [Populus trichocarpa]
 gb|EEE86331.1| DARK INDUCIBLE 9 family protein [Populus trichocarpa]
Length=440

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (65%), Gaps = 14/94 (15%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRE-SGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSY  523
            GG L RLRC+V+NYDWG+ G E S VARLY  N+G   E+++ KP+AEFWMGTH SGPS+
Sbjct  12   GGGLKRLRCSVQNYDWGKKGTEGSEVARLYELNSGSDIELEKKKPFAEFWMGTHGSGPSF  71

Query  524  VVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            VV            +G+ NG +     + LK+WI
Sbjct  72   VV-----------ESGVENGDSIGSGSMGLKEWI  94



>ref|XP_007215391.1| hypothetical protein PRUPE_ppa005846mg [Prunus persica]
 gb|EMJ16590.1| hypothetical protein PRUPE_ppa005846mg [Prunus persica]
 gb|AGH25529.1| phosphomannose isomerase [Prunus persica]
Length=440

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 9/88 (10%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L RLRC+V+NYDWG+ G +S VARL + N+  EI   KPYAE WMGTHESGPS+++  G 
Sbjct  18   LQRLRCSVQNYDWGKRGTDSLVARLSALNSSSEIDPEKPYAEIWMGTHESGPSFLIQNGD  77

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
               G ++    S         ++LKDW+
Sbjct  78   ENNGFLSIGSES---------LSLKDWV  96



>ref|XP_009345680.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Pyrus x bretschneideri]
Length=441

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 11/91 (12%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            G+L RLRC+V+NYDWG+ G++S VARL + N+G  I   K YAEFWMGTHESGPS++   
Sbjct  17   GSLQRLRCSVQNYDWGKRGQDSQVARLSAFNSGSGINPEKSYAEFWMGTHESGPSFL---  73

Query  536  GAPPPGRIAGNGLSNG-VAKDKFVVTLKDWI  625
                   I  +  +NG       +++LKDWI
Sbjct  74   -------IQNSDENNGFFPIGSQIISLKDWI  97



>ref|XP_009342661.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Pyrus x bretschneideri]
Length=441

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 11/91 (12%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            G+L RLRC+V+NYDWG+ G++S VARL + N+G  I   K YAEFWMGTHESGPS++   
Sbjct  17   GSLQRLRCSVQNYDWGKRGQDSQVARLCAFNSGSGINPEKSYAEFWMGTHESGPSFL---  73

Query  536  GAPPPGRIAGNGLSNG-VAKDKFVVTLKDWI  625
                   I  +  +NG       +++LKDWI
Sbjct  74   -------IQNSDENNGFFPIGSQIISLKDWI  97



>ref|XP_008342936.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Malus domestica]
Length=441

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 11/91 (12%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            G+L RLRC+V+NYDWG+ G++S VARL + N+G  I   K YAEFWMGTHESGPS++   
Sbjct  17   GSLQRLRCSVQNYDWGKRGQDSQVARLSAFNSGSGINPEKSYAEFWMGTHESGPSFL---  73

Query  536  GAPPPGRIAGNGLSNG-VAKDKFVVTLKDWI  625
                   I  +  +NG       + +LKDWI
Sbjct  74   -------IQNSDENNGFFPIGSQIJSLKDWI  97



>ref|XP_010532333.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532338.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=456

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 5/74 (7%)
 Frame = +2

Query  308  GGKSMEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAE  487
            GG +++ D V      G L+RLRC+V+NYDWG  G +S VARL+S N+G  I   KPYAE
Sbjct  15   GGGNVDGDAV-----SGGLVRLRCSVQNYDWGIEGHDSQVARLFSLNSGSGIDPLKPYAE  69

Query  488  FWMGTHESGPSYVV  529
             W+GTHESGPS+VV
Sbjct  70   LWIGTHESGPSFVV  83



>ref|XP_011035071.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Populus euphratica]
Length=440

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 14/94 (15%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRE-SGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSY  523
            GG L RLRC+V+NYDWG+ G E S VARLY  N+    E+++ KP+AEFWMGTH SGPS+
Sbjct  12   GGGLKRLRCSVQNYDWGKKGTEGSEVARLYELNSRSDLELEKKKPFAEFWMGTHGSGPSF  71

Query  524  VVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            VV            +G+ NG +     ++LK+WI
Sbjct  72   VV-----------ESGVENGDSIGSGSMSLKEWI  94



>gb|KDP29436.1| hypothetical protein JCGZ_18357 [Jatropha curcas]
Length=455

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L RL+C+V+NYDWG IG  S VARL++ N+G +I   KPYAEFW+GTHESGPS++  G A
Sbjct  37   LPRLKCSVQNYDWGIIGNNSQVARLFALNSGSDICPNKPYAEFWIGTHESGPSFLDHGNA  96



>ref|XP_008381268.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Malus 
domestica]
Length=436

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 13/107 (12%)
 Frame = +2

Query  305  TGGKSMEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYA  484
             G KSM+     A    G + RLRC+++NYDWG+ G++S VARL + N+G  I   K YA
Sbjct  4    VGKKSMKNQNQRA----GLIQRLRCSIQNYDWGKRGQDSQVARLSAFNSGSGINPQKSYA  59

Query  485  EFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            EFWMGTHESGPS+++            NG     ++   +++LKDWI
Sbjct  60   EFWMGTHESGPSFLIRNSD------ENNGFFPIGSQ---IISLKDWI  97



>ref|XP_008381266.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Malus 
domestica]
Length=442

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 13/107 (12%)
 Frame = +2

Query  305  TGGKSMEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYA  484
             G KSM+     A    G + RLRC+++NYDWG+ G++S VARL + N+G  I   K YA
Sbjct  4    VGKKSMKNQNQRA----GLIQRLRCSIQNYDWGKRGQDSQVARLSAFNSGSGINPQKSYA  59

Query  485  EFWMGTHESGPSYVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            EFWMGTHESGPS+++            NG     ++   +++LKDWI
Sbjct  60   EFWMGTHESGPSFLIRNSD------ENNGFFPIGSQ---IISLKDWI  97



>gb|AAX31279.1| phosphomannose isomerase [Cyamopsis tetragonoloba]
Length=428

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L RL C+VKNYDWG  GR S VARLY+ N+G +    +PYAE WMGTH+S PS++V  GA
Sbjct  14   LQRLHCSVKNYDWGLPGRISNVARLYALNSGSQFHPDEPYAELWMGTHDSEPSFLVSNGA  73



>gb|KJB43062.1| hypothetical protein B456_007G181800 [Gossypium raimondii]
Length=422

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            G  L RLR  V+NY+WGR G E+ VARL + NTG EI+  KPYAEFWMGTHESGP+ +V
Sbjct  6    GEKLKRLRAWVQNYEWGRSGAEAEVARLLALNTGAEIEPNKPYAEFWMGTHESGPNVLV  64



>gb|KJB43060.1| hypothetical protein B456_007G181800 [Gossypium raimondii]
Length=443

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            G  L RLR  V+NY+WGR G E+ VARL + NTG EI+  KPYAEFWMGTHESGP+ +V
Sbjct  6    GEKLKRLRAWVQNYEWGRSGAEAEVARLLALNTGAEIEPNKPYAEFWMGTHESGPNVLV  64



>gb|KJB43061.1| hypothetical protein B456_007G181800 [Gossypium raimondii]
Length=435

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            G  L RLR  V+NY+WGR G E+ VARL + NTG EI+  KPYAEFWMGTHESGP+ +V
Sbjct  6    GEKLKRLRAWVQNYEWGRSGAEAEVARLLALNTGAEIEPNKPYAEFWMGTHESGPNVLV  64



>ref|XP_010528481.1| PREDICTED: mannose-6-phosphate isomerase 2 [Tarenaya hassleriana]
Length=439

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 54/91 (59%), Gaps = 16/91 (18%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVV  532
             G +LRLRCAVKNY+WG++G +S VA L+  N+G  +    PYAE WMGT ESGPS+VV 
Sbjct  14   AGGILRLRCAVKNYEWGKVGSDSLVAGLHEANSGSRVDPAVPYAELWMGTLESGPSHVV-  72

Query  533  GGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                 P    G+G           VTLK WI
Sbjct  73   -----PSAENGSG----------SVTLKSWI  88



>gb|KHG01171.1| Mannose-6-phosphate isomerase [Gossypium arboreum]
Length=432

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  AAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPS  520
            A   G  L RLR  V+NY+WGR G E+ VARL + N+G EI+  KPYAEFWMGTHESGP+
Sbjct  2    AGVNGEKLKRLRAWVQNYEWGRSGAEAEVARLLALNSGAEIEPNKPYAEFWMGTHESGPN  61

Query  521  YVV  529
             +V
Sbjct  62   VLV  64



>ref|XP_006430767.1| hypothetical protein CICLE_v10011731mg [Citrus clementina]
 gb|ESR44007.1| hypothetical protein CICLE_v10011731mg [Citrus clementina]
Length=442

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            LLRL C+V+ YDWGR G +S V++LY  N+G      KPYAEFWMGTHESGPS++
Sbjct  11   LLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDIDKPYAEFWMGTHESGPSFL  65



>gb|KDO59031.1| hypothetical protein CISIN_1g013464mg [Citrus sinensis]
Length=442

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            LLRL C+V+ YDWGR G +S V++LY  N+G      KPYAEFWMGTHESGPS++
Sbjct  11   LLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDIDKPYAEFWMGTHESGPSFL  65



>ref|XP_003552724.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Glycine max]
Length=421

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 51/88 (58%), Gaps = 17/88 (19%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            L RL C+VKNYDWG  GR S VARL++ N+  E     PYAE WMGTH+SGPS++     
Sbjct  6    LQRLHCSVKNYDWGLPGRVSEVARLHALNSASEFHAEDPYAELWMGTHDSGPSFLA----  61

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                  + NG  NG       V+LK WI
Sbjct  62   ------SSNGNENG-------VSLKAWI  76



>ref|XP_007033251.1| Mannose-6-phosphate isomerase, type I [Theobroma cacao]
 gb|EOY04177.1| Mannose-6-phosphate isomerase, type I [Theobroma cacao]
Length=424

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 16/95 (17%)
 Frame = +2

Query  341  AAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPS  520
            A      L RLR  V+NYDWGR G E+ VARL + N G E++  +PYAEFWMGTH+SGPS
Sbjct  2    AKANADKLRRLRAWVQNYDWGRCGAEAQVARLLALNCGAEVEPERPYAEFWMGTHDSGPS  61

Query  521  YVVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            +                L++   +++  V LK+WI
Sbjct  62   F----------------LADEEGQEEENVGLKEWI  80



>ref|XP_006408404.1| hypothetical protein EUTSA_v10020776mg [Eutrema salsugineum]
 gb|ESQ49857.1| hypothetical protein EUTSA_v10020776mg [Eutrema salsugineum]
Length=432

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 5/74 (7%)
 Frame = +2

Query  320  MEVDGVPAAGTGGA-----LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYA  484
            ME+  V  A  G       L RL+C+VK+YDWG+IG +S V R+Y+ N+  +I   +PYA
Sbjct  1    MEIATVVKANGGCEADRRRLRRLKCSVKDYDWGKIGSDSLVYRVYAANSDYQIDSTRPYA  60

Query  485  EFWMGTHESGPSYV  526
            E WMGTHESGPSY+
Sbjct  61   ELWMGTHESGPSYL  74



>ref|XP_006296710.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
 gb|EOA29608.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
Length=333

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+YDWG+IG +S V R+Y+ N+ D+I   +PYAE WMGTHESGPSY+
Sbjct  25   CSVKDYDWGKIGSDSLVYRVYAANSDDQIDSTRPYAELWMGTHESGPSYL  74



>ref|XP_009357811.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=436

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +2

Query  305  TGGKSMEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYA  484
             G KSM+     A    G + RLRC+V+NYDWG+ G +S VARL + N+   I   K YA
Sbjct  4    VGKKSMKNQNQRA----GLIQRLRCSVQNYDWGKRGHDSQVARLSAFNSDSGINPEKSYA  59

Query  485  EFWMGTHESGPSYVV  529
            EFWMGTHESGPS+++
Sbjct  60   EFWMGTHESGPSFLI  74



>ref|XP_009357810.1| PREDICTED: mannose-6-phosphate isomerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=442

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +2

Query  305  TGGKSMEVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYA  484
             G KSM+     A    G + RLRC+V+NYDWG+ G +S VARL + N+   I   K YA
Sbjct  4    VGKKSMKNQNQRA----GLIQRLRCSVQNYDWGKRGHDSQVARLSAFNSDSGINPEKSYA  59

Query  485  EFWMGTHESGPSYVV  529
            EFWMGTHESGPS+++
Sbjct  60   EFWMGTHESGPSFLI  74



>gb|KHG02503.1| Mannose-6-phosphate isomerase [Gossypium arboreum]
Length=425

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 17/86 (20%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAPP  547
            RLR  V+NYDWGR G E+ VARL + N+G E++  +PYAEFWMGTH+SGPS+        
Sbjct  12   RLRGWVQNYDWGRCGAEAQVARLLALNSGAEVKPDRPYAEFWMGTHDSGPSF--------  63

Query  548  PGRIAGNGLSNGVAKDKFVVTLKDWI  625
                    L++G  +D+  V LK+WI
Sbjct  64   --------LADGYGEDQ-NVGLKEWI  80



>ref|XP_006448445.1| hypothetical protein CICLE_v10017881mg [Citrus clementina]
 gb|ESR61685.1| hypothetical protein CICLE_v10017881mg [Citrus clementina]
Length=423

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            LRL+CAVKNY+WG +G +S V+RL+  N+G  I   +PYAEFW+GTHESG S++  GG
Sbjct  20   LRLQCAVKNYNWGIVGNKSHVSRLFCLNSGTHINPNEPYAEFWIGTHESGASFLDHGG  77



>emb|CDY11497.1| BnaA09g40630D [Brassica napus]
Length=329

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            L RLRC+VK+Y WG+IG +S V R+Y+ N+  +I   +PYAE WMGTHESGPSY+
Sbjct  18   LHRLRCSVKDYAWGKIGSDSLVYRVYAVNSDGQIDSTRPYAELWMGTHESGPSYL  72



>gb|KJB48153.1| hypothetical protein B456_008G055300 [Gossypium raimondii]
Length=424

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            RLR  V+NYDWGR G E+ VARL + N+G E++  +PYAEFWMGTH+SGPS++  G
Sbjct  12   RLRGWVQNYDWGRCGAEAQVARLLALNSGAEVKPDRPYAEFWMGTHDSGPSFLADG  67



>gb|KDO76962.1| hypothetical protein CISIN_1g014147mg [Citrus sinensis]
Length=430

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            LRL+CAVKNY+WG +G +S V+RL+  N+G  I   +PYAEFW+GTHESG S++  GG
Sbjct  20   LRLQCAVKNYNWGIVGSKSHVSRLFCLNSGTHINPNEPYAEFWIGTHESGASFLDHGG  77



>ref|XP_008436962.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis melo]
 ref|XP_008436963.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cucumis melo]
Length=390

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVG  535
            LLRL+C V+NYDWG IG  S VARL+  N+G   +  G+ YAEFW+GTH+SGPSYVV G
Sbjct  26   LLRLKCCVQNYDWGVIGCNSQVARLFLLNSGRCNVDPGECYAEFWIGTHKSGPSYVVYG  84



>ref|XP_006296709.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
 gb|EOA29607.1| hypothetical protein CARUB_v10013753mg [Capsella rubella]
Length=432

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+YDWG+IG +S V R+Y+ N+ D+I   +PYAE WMGTHESGPSY+
Sbjct  25   CSVKDYDWGKIGSDSLVYRVYAANSDDQIDSTRPYAELWMGTHESGPSYL  74



>ref|XP_006469088.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Citrus sinensis]
Length=430

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            LRL+CAVKNY+WG +G +S V+RL+  N+G  I   +PYAEFW+GTHESG S++  GG
Sbjct  20   LRLQCAVKNYNWGIVGNKSHVSRLFYLNSGTHINPNEPYAEFWIGTHESGASFLDHGG  77



>ref|XP_002884330.1| hypothetical protein ARALYDRAFT_477494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60589.1| hypothetical protein ARALYDRAFT_477494 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+YDWG+IG +S V R+Y+ N+ D+I   +PYAE WMGTHESGPSY+
Sbjct  25   CSVKDYDWGKIGSDSLVYRVYAANSDDQIDPTRPYAELWMGTHESGPSYL  74



>ref|XP_010499042.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Camelina sativa]
Length=432

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+YDWG+IG +S V R+Y+ N+ D+I   +PYAE WMGTHESGPSY+
Sbjct  25   CSVKDYDWGKIGSDSLVYRVYAANSDDQIDPTRPYAELWMGTHESGPSYL  74



>ref|XP_001775706.1| predicted protein [Physcomitrella patens]
 gb|EDQ59509.1| predicted protein [Physcomitrella patens]
Length=425

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 53/88 (60%), Gaps = 20/88 (23%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            +LRL CAV++Y+WGRIG  S V RL++  +G+++ E  PYAE WMGTH SGPS V     
Sbjct  1    MLRLLCAVQHYEWGRIGAASEVGRLHALASGEDV-EDIPYAELWMGTHRSGPSRV-----  54

Query  542  PPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                          VA+DK  V LKDW+
Sbjct  55   --------------VAEDKSEVLLKDWL  68



>gb|EPS59833.1| hypothetical protein M569_14970 [Genlisea aurea]
Length=426

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGK--PYAEFWMGTHESGPSYVV  529
            +++L+C+V NYDWG+   ES VARLYSRN   E  + +G+  PYAE WMGTH+SGPSYVV
Sbjct  8    IVKLKCSVMNYDWGKPRGESTVARLYSRNAAAEKVLDDGEDVPYAELWMGTHDSGPSYVV  67

Query  530  V  532
            V
Sbjct  68   V  68



>emb|CDY54299.1| BnaC01g41980D [Brassica napus]
Length=428

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            L RLRC+VK+Y WG+IG +S V R+Y+ N+  +I   +PYAE WMGTHESGPSY+
Sbjct  18   LHRLRCSVKDYAWGKIGSDSLVYRVYAVNSDGQIDSTRPYAELWMGTHESGPSYL  72



>emb|CDX77287.1| BnaC08g03320D [Brassica napus]
Length=242

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            L RLRC+VK+Y WG+IG +S V R+Y+ N+   I   +PYAE WMGTHE GPSY+
Sbjct  75   LHRLRCSVKDYAWGKIGSDSLVYRVYAANSDQPIDSTRPYAELWMGTHEPGPSYL  129



>ref|XP_006482242.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Citrus sinensis]
Length=439

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            A  RL C+V+ YDWGR G +S V++LY  N+G      KPYAEFWMGTHESGPS++
Sbjct  7    AARRLTCSVQKYDWGRTGADSLVSKLYGLNSGKRTDIDKPYAEFWMGTHESGPSFL  62



>ref|XP_004143675.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Cucumis sativus]
 gb|KGN50328.1| hypothetical protein Csa_5G167200 [Cucumis sativus]
Length=451

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVG  535
            LLRL+C V+NYDWG IG  S VARL+  N+G   +  G+ YAEFW+GTH+SGPS+VV G
Sbjct  26   LLRLKCCVQNYDWGVIGCNSQVARLFFLNSGRCNVDPGECYAEFWIGTHKSGPSFVVYG  84



>gb|KHN17308.1| Mannose-6-phosphate isomerase [Glycine soja]
Length=421

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            L RL C+VKNYDWG  GR S VARL++ N+  ++    P+AE WMGTH+SGPS++
Sbjct  6    LQRLHCSVKNYDWGLPGRVSEVARLHALNSASQLHAEDPFAELWMGTHDSGPSFL  60



>ref|NP_186906.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9M884.1|MPI1_ARATH RecName: Full=Mannose-6-phosphate isomerase 1; AltName: Full=Phosphohexomutase 
1; AltName: Full=Phosphomannose isomerase 
1; Short=PMI1; AltName: Full=Protein MATERNAL EFFECT EMBRYO 
ARREST 31 [Arabidopsis thaliana]
 gb|AAF32464.1| putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 gb|AAL49850.1| putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 gb|AAM20214.1| putative mannose-6-phosphate isomerase [Arabidopsis thaliana]
 gb|AEE73831.1| mannose-6-phosphate isomerase [Arabidopsis thaliana]
Length=432

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+YDWG+IG +S V R+Y+ N+  EI   +PYAE WMGTHESGPSY+
Sbjct  25   CSVKDYDWGKIGSDSLVYRVYAANSDYEIDPTRPYAELWMGTHESGPSYL  74



>gb|ESA05112.1| hypothetical protein GLOINDRAFT_35949 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX58512.1| mannose-6-phosphate isomerase PMI40 [Rhizophagus irregularis 
DAOM 197198w]
Length=429

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            A+ +L+CAV+NYDWG+IG ES VA+    +   EIQ  KPYAE WMGTH +GPS +
Sbjct  5    AVYKLKCAVQNYDWGKIGSESKVAQFAQISKDFEIQLDKPYAELWMGTHPNGPSVL  60



>emb|CDY67541.1| BnaAnng24620D [Brassica napus]
Length=432

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  320  MEVDGVPAA--GTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQE--GKPYAE  487
            ME+  V  A  G    LLRL+C+VK+Y WG IG +S V ++Y+ N  D I     +PYAE
Sbjct  1    MEIATVVKANGGCRRRLLRLKCSVKDYAWGTIGSDSLVYKVYTANCDDRIDSTTKRPYAE  60

Query  488  FWMGTHESGPSYV  526
             WMGTHESGPSY+
Sbjct  61   LWMGTHESGPSYL  73



>emb|CDY34738.1| BnaA01g32870D [Brassica napus]
Length=432

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  320  MEVDGVPAA--GTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQE--GKPYAE  487
            ME+  V  A  G    LLRL+C+VK+Y WG IG +S V ++Y+ N  D I     +PYAE
Sbjct  1    MEIATVVKANGGCRRRLLRLKCSVKDYAWGTIGSDSLVYKVYTANCDDRIDSTTKRPYAE  60

Query  488  FWMGTHESGPSYV  526
             WMGTHESGPSY+
Sbjct  61   LWMGTHESGPSYL  73



>ref|XP_001754844.1| predicted protein [Physcomitrella patens]
 gb|EDQ80298.1| predicted protein [Physcomitrella patens]
Length=427

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            LRL CAV++YDWGRIG  S V RL++   G    E  PYAE WMGTH+SGPS+VV   +P
Sbjct  3    LRLECAVQHYDWGRIGAASEVGRLHALAVGSP-AEDTPYAELWMGTHKSGPSWVVSDNSP  61



>ref|XP_009118359.1| PREDICTED: mannose-6-phosphate isomerase 1 [Brassica rapa]
Length=432

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  320  MEVDGVPAA--GTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQE--GKPYAE  487
            ME+  V  A  G    LLRL+C+VK+Y WG IG +S V ++Y+ N  D I     +PYAE
Sbjct  1    MEIATVVKANGGCRRRLLRLKCSVKDYAWGTIGSDSLVYKVYTANCDDRIDSTTKRPYAE  60

Query  488  FWMGTHESGPSYV  526
             WMGTHESGPSY+
Sbjct  61   LWMGTHESGPSYL  73



>ref|XP_002987355.1| hypothetical protein SELMODRAFT_125724 [Selaginella moellendorffii]
 ref|XP_002989145.1| hypothetical protein SELMODRAFT_129293 [Selaginella moellendorffii]
 gb|EFJ09739.1| hypothetical protein SELMODRAFT_129293 [Selaginella moellendorffii]
 gb|EFJ11670.1| hypothetical protein SELMODRAFT_125724 [Selaginella moellendorffii]
Length=422

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            ++RL+C V++Y+WGRIG ES V RL++  TG  +    PYAE WMGTH SGPS V+  G
Sbjct  1    MIRLQCQVQHYEWGRIGEESEVGRLHALMTGSAVDADVPYAELWMGTHASGPSTVLRRG  59



>ref|XP_007139158.1| hypothetical protein PHAVU_008G006200g [Phaseolus vulgaris]
 gb|ESW11152.1| hypothetical protein PHAVU_008G006200g [Phaseolus vulgaris]
Length=418

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            L RL C+VKNYDWG  GR S VARL++ N+G   +   PYAE W+GTH+S PS++   G
Sbjct  8    LQRLHCSVKNYDWGLPGRVSEVARLHALNSGSRFRAEDPYAELWIGTHDSSPSFLASNG  66



>ref|XP_010485568.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Camelina sativa]
Length=432

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+YDWG+IG +S V R+Y+ N+  +I   +PYAE WMGTHESGPSY+
Sbjct  25   CSVKDYDWGKIGSDSLVYRVYAANSDVQIDPTRPYAELWMGTHESGPSYL  74



>ref|XP_010463670.1| PREDICTED: mannose-6-phosphate isomerase 1 [Camelina sativa]
Length=432

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+YDWG+IG +S V R+Y+ N+  +I   +PYAE WMGTHESGPSY+
Sbjct  25   CSVKDYDWGKIGSDSLVYRVYAANSDVQIDPTRPYAELWMGTHESGPSYL  74



>ref|XP_006842317.1| hypothetical protein AMTR_s00079p00142130 [Amborella trichopoda]
 gb|ERN03992.1| hypothetical protein AMTR_s00079p00142130 [Amborella trichopoda]
Length=421

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            LLRLRC+V++YDWG++G +S V +L+  N+     E KPYAE WMGTH SGPS++V
Sbjct  10   LLRLRCSVQSYDWGKVGEDSEVGKLFCLNSKIPT-ENKPYAELWMGTHGSGPSFIV  64



>gb|ABR16432.1| unknown [Picea sitchensis]
Length=432

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVV-GGA  541
            L+LRC  ++Y+WGR G  S V RLYS  T   I+E KPYAE WMGTH+SG S V++ GGA
Sbjct  10   LQLRCVAQHYEWGRRGSASEVGRLYSLITESPIEEDKPYAELWMGTHDSGHSLVILQGGA  69

Query  542  PPP  550
              P
Sbjct  70   QVP  72



>ref|XP_003567941.1| PREDICTED: mannose-6-phosphate isomerase 1 [Brachypodium distachyon]
Length=447

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 44/65 (68%), Gaps = 3/65 (5%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGD---EIQEGKPYAEFWMGTHESGPSYVV  529
            +LLRLRC V++Y WGR+G  S VARL + N  D   EI   +PYAE WMGTH + PS V+
Sbjct  16   SLLRLRCGVQHYGWGRLGAASLVARLAAANDPDAGAEIDPARPYAELWMGTHPAAPSSVL  75

Query  530  VGGAP  544
            + G P
Sbjct  76   LPGLP  80



>ref|XP_001695020.1| mannose-6-phosphate isomerase [Chlamydomonas reinhardtii]
 gb|EDP02172.1| mannose-6-phosphate isomerase, partial [Chlamydomonas reinhardtii]
Length=365

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            +L+LRCA +NYDWGR  ++S VA+L   N G+E+ E KP+AE WMG H +GPS V   G
Sbjct  1    MLQLRCAAQNYDWGRKYQDSEVAKLAHAN-GNEVDESKPFAELWMGAHPNGPSKVAATG  58



>dbj|BAM19882.1| mannose-6-phosphate isomerase, partial [Papilio xuthus]
Length=211

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSR-NTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            + L+C V+NYDWG++G ES VA+L S  +T   I   KPYAE WMGTH +GPS ++
Sbjct  1    MELQCKVQNYDWGKLGHESKVAKLLSSGDTNALIDTDKPYAELWMGTHPNGPSLII  56



>ref|XP_003532343.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Glycine max]
 gb|KHN24932.1| Mannose-6-phosphate isomerase [Glycine soja]
Length=421

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            L RL C+VKNYDWG  G  S VARL++ N+  ++    P+AE WMGTH+SGPS++
Sbjct  6    LQRLHCSVKNYDWGLPGHVSEVARLHALNSASQLHAEDPFAELWMGTHDSGPSFL  60



>ref|XP_004489108.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Cicer arietinum]
Length=430

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 49/89 (55%), Gaps = 18/89 (20%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            +L RL  +VKNYDWG  G+ S VARL   N+G +    KPYAE W+GTH+SGPS++V   
Sbjct  14   SLQRLHFSVKNYDWGLPGQLSQVARLSELNSGSQFDPIKPYAELWIGTHDSGPSFLVSDN  73

Query  539  APPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
                              D   VTLKDWI
Sbjct  74   ------------------DGKSVTLKDWI  84



>ref|XP_003541320.1| PREDICTED: mannose-6-phosphate isomerase 1 [Glycine max]
 gb|KHN47669.1| Mannose-6-phosphate isomerase [Glycine soja]
Length=437

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 4/61 (7%)
 Frame = +2

Query  371  LRCAVKNYDWGRIGRESGVARLYSRNTGD----EIQEGKPYAEFWMGTHESGPSYVVVGG  538
            L C+VKNY+WG+  R+S VA+L+S N+G     ++ E +PYAE WMG+H SGPS++V  G
Sbjct  23   LHCSVKNYEWGKPCRDSLVAKLFSMNSGSLQSSQLDEDQPYAELWMGSHVSGPSFIVFDG  82

Query  539  A  541
            +
Sbjct  83   S  83



>gb|KEH21549.1| mannose-6-phosphate isomerase [Medicago truncatula]
Length=424

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 18/94 (19%)
 Frame = +2

Query  344  AGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSY  523
            +    +L +L C+VKNYDWG  G+ S VA+L   N+G +    KPYAE W+GTH+SGPS+
Sbjct  4    SNPNNSLQKLHCSVKNYDWGLPGQLSQVAKLSELNSGFKFDPMKPYAELWIGTHDSGPSF  63

Query  524  VVVGGAPPPGRIAGNGLSNGVAKDKFVVTLKDWI  625
            +V                     D   ++LKDWI
Sbjct  64   LVSDD------------------DGQRISLKDWI  79



>gb|AFW79921.1| hypothetical protein ZEAMMB73_049955, partial [Zea mays]
Length=125

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            LLRLRCAV++Y+WG+ G  S VARL   N  D     +PYAE WMGTH SGPS +V  G+
Sbjct  26   LLRLRCAVQHYEWGQRGAASLVARLADHNNPD---PARPYAELWMGTHPSGPSSLVDDGS  82



>ref|XP_004968078.1| PREDICTED: mannose-6-phosphate isomerase 1-like [Setaria italica]
Length=440

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 4/71 (6%)
 Frame = +2

Query  329  DGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHE  508
            D  P+      LLRLRCAV++Y+WGR G  S VARL  ++        +PYAE WMGTH 
Sbjct  22   DVEPSPPPPQRLLRLRCAVQHYEWGRRGSASLVARLADQDP----DPARPYAELWMGTHP  77

Query  509  SGPSYVVVGGA  541
            SGPS ++ GGA
Sbjct  78   SGPSTLLDGGA  88



>gb|AFW79922.1| hypothetical protein ZEAMMB73_049955 [Zea mays]
Length=239

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            LLRLRCAV++Y+WG+ G  S VARL   N  D     +PYAE WMGTH SGPS +V  G+
Sbjct  26   LLRLRCAVQHYEWGQRGAASLVARLADHNNPD---PARPYAELWMGTHPSGPSSLVDDGS  82



>emb|CDY43229.1| BnaC05g48220D [Brassica napus]
Length=436

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+Y WG+IG +S V R+Y+ N+   I   +PYAE WMGTHESGPSY+
Sbjct  26   CSVKDYAWGKIGSDSLVYRVYAANSDQPIDSTRPYAELWMGTHESGPSYL  75



>ref|XP_009147339.1| PREDICTED: mannose-6-phosphate isomerase 1 [Brassica rapa]
Length=433

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+Y WG+IG +S V R+Y+ N+   I   +PYAE WMGTHESGPSY+
Sbjct  26   CSVKDYAWGKIGSDSLVYRVYAANSDQPIDSTRPYAELWMGTHESGPSYL  75



>emb|CDY57541.1| BnaA05g33470D [Brassica napus]
Length=433

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  377  CAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            C+VK+Y WG+IG +S V R+Y+ N+   I   +PYAE WMGTHESGPSY+
Sbjct  26   CSVKDYAWGKIGSDSLVYRVYAANSDQPIDSTRPYAELWMGTHESGPSYL  75



>ref|NP_596445.1| mannose-6-phosphate isomerase (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|O43014.1|MPI_SCHPO RecName: Full=Mannose-6-phosphate isomerase; AltName: Full=Phosphohexomutase; 
AltName: Full=Phosphomannose isomerase; Short=PMI 
[Schizosaccharomyces pombe 972h-]
 emb|CAA17896.1| mannose-6-phosphate isomerase (predicted) [Schizosaccharomyces 
pombe]
Length=412

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            + RL+C VK+Y WG++G ES  A+L     G E+    PYAE WMG+H SGPS+V+  G 
Sbjct  1    MYRLKCDVKSYGWGKVGHESLAAKLAEAGYGFEVDPNTPYAELWMGSHPSGPSFVMQTGK  60

Query  542  P  544
            P
Sbjct  61   P  61



>gb|KFY44699.1| hypothetical protein V494_01366 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=402

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVG  535
            ++L+L+C +KN DWG+ G+ES  ARL+SR  G+  I + K Y+E WMGT+   PSYV+  
Sbjct  4    SVLQLKCGIKNDDWGKKGKESKAARLWSRTPGNGPIDDSKMYSEMWMGTYPKNPSYVISS  63

Query  536  GAPPPGRIAGN  568
            G P    +  N
Sbjct  64   GLPLADHLKQN  74



>gb|EWM30265.1| mannose-6-phosphate isomerase [Nannochloropsis gaditana]
Length=449

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 5/64 (8%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD---EIQEGKPYAEFWMGTHESGPSYVVV  532
            +LRL CA++ YDWG+ G ES VA+L  +  GD   E Q+   YAE WMGTH SGPS V+V
Sbjct  1    MLRLECAIQTYDWGKPGLESAVAQL--KQEGDDHFEAQQDTRYAELWMGTHPSGPSTVIV  58

Query  533  GGAP  544
               P
Sbjct  59   PAGP  62



>ref|XP_006690173.1| mannose-6-phosphate isomerase [Candida tenuis ATCC 10573]
 ref|XP_006690174.1| hypothetical protein CANTEDRAFT_115983 [Candida tenuis ATCC 10573]
 gb|EGV60959.1| mannose-6-phosphate isomerase [Candida tenuis ATCC 10573]
 gb|EGV60960.1| hypothetical protein CANTEDRAFT_115983 [Candida tenuis ATCC 10573]
Length=439

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            +L RL C  +NYDWG+IG  S VA+   S N   +I E KPYAE WMGTH S PS  V  
Sbjct  2    SLFRLDCGYQNYDWGKIGSSSAVAQFAASSNPATKIDESKPYAELWMGTHPSVPSKAVDA  61

Query  536  G  538
            G
Sbjct  62   G  62



>gb|EPY53747.1| mannose-6-phosphate isomerase [Schizosaccharomyces cryophilus 
OY26]
Length=411

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            + RL+C V +YDWGR+G +S  A+     +G +++E KPYAE WMG++ SGPS V+  G
Sbjct  1    MYRLKCQVMDYDWGRVGHDSLAAQFAKNGSGFDVKEDKPYAELWMGSYHSGPSIVMQTG  59



>ref|NP_001140476.1| uncharacterized protein LOC100272536 [Zea mays]
 gb|ACF83911.1| unknown [Zea mays]
 gb|ACG46630.1| mannose-6-phosphate isomerase [Zea mays]
Length=435

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            LLRLRCAV++Y+WG+ G  S VARL   N  D     +PYAE WMGTH SGPS +V  G+
Sbjct  26   LLRLRCAVQHYEWGQRGAASLVARLADHNNPD---PARPYAELWMGTHPSGPSSLVDDGS  82



>gb|AAX28286.2| SJCHGC09301 protein [Schistosoma japonicum]
Length=265

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSYVV  529
            + RLRCA + YDWG+ G +S V +L  R++G   E+ + KPYAE WMGTH SGPS+++
Sbjct  17   MFRLRCAFQTYDWGKFGADSEVYKLL-RHSGQIQELDDSKPYAELWMGTHVSGPSFLM  73



>ref|XP_001384544.2| mannose-6-phosphate isomerase [Scheffersomyces stipitis CBS 6054]
 gb|ABN66515.2| mannose-6-phosphate isomerase [Scheffersomyces stipitis CBS 6054]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVG  535
            +L R+ C  +NYDWG+IG  S VA+  S +     I   KPYAE WMGTH S PS  V G
Sbjct  2    SLFRINCGYQNYDWGKIGSTSAVAQFASSSDASVSIDNSKPYAELWMGTHPSVPSVAVDG  61

Query  536  GAPPPGR  556
            GA   G+
Sbjct  62   GADVEGK  68



>gb|KFY05395.1| hypothetical protein O988_00022 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=341

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVG  535
            ++L+L+C VKN DWG+ G++S  A+L+S+  G+ +I + K Y+E WMGT+   PSYV+  
Sbjct  4    SVLQLKCGVKNDDWGKKGKQSQAAQLWSKTPGNGQIDDSKMYSEMWMGTYPKNPSYVISS  63

Query  536  GAP  544
            G P
Sbjct  64   GLP  66



>ref|XP_001525942.1| mannose-6-phosphate isomerase [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK44321.1| mannose-6-phosphate isomerase [Lodderomyces elongisporus NRRL 
YB-4239]
Length=437

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 3/58 (5%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSYVV  529
            L RL+C  +NYDWG+IG  S VA+ +++N+    EI E KPYAE WMGTH S PS  +
Sbjct  5    LFRLQCGYQNYDWGKIGSSSAVAQ-FAKNSDPSIEIDESKPYAELWMGTHPSVPSQAI  61



>gb|EDK38036.2| hypothetical protein PGUG_02134 [Meyerozyma guilliermondii ATCC 
6260]
Length=429

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 46/80 (58%), Gaps = 7/80 (9%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYS-RNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            ++ R+ C  +NYDWG++G  S VA+  S  +    I E KPYAE WMGTH S PS VV G
Sbjct  2    SVFRINCGYQNYDWGKVGSSSAVAQFASTSDPSITIDEKKPYAELWMGTHPSVPSTVVSG  61

Query  536  GAPPPGRIAGNGLSNGVAKD  595
            G       +G  L + V +D
Sbjct  62   GK------SGQTLRDLVTED  75



>ref|XP_001486463.1| hypothetical protein PGUG_02134 [Meyerozyma guilliermondii ATCC 
6260]
Length=429

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 46/80 (58%), Gaps = 7/80 (9%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYS-RNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            ++ R+ C  +NYDWG++G  S VA+  S  +    I E KPYAE WMGTH S PS VV G
Sbjct  2    SVFRINCGYQNYDWGKVGSSSAVAQFASTSDPSITIDEKKPYAELWMGTHPSVPSTVVSG  61

Query  536  GAPPPGRIAGNGLSNGVAKD  595
            G       +G  L + V +D
Sbjct  62   GK------SGQTLRDLVTED  75



>ref|XP_002954744.1| hypothetical protein VOLCADRAFT_65163 [Volvox carteri f. nagariensis]
 gb|EFJ44150.1| hypothetical protein VOLCADRAFT_65163 [Volvox carteri f. nagariensis]
Length=450

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            +L+LRCA +NYDWGR   ES VA+L   N G  I E KP+AE WMG H + PS +   G
Sbjct  1    MLQLRCAAQNYDWGRKASESEVAKLAQAN-GSAIDESKPFAELWMGAHPNCPSKLQSTG  58



>ref|XP_008555945.1| PREDICTED: mannose-6-phosphate isomerase [Microplitis demolitor]
Length=407

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYV  526
            + L CAV+NYDWG+ G  S VA+L   ++ + +I + KPYAE WMGTH +GPS++
Sbjct  1    MELECAVQNYDWGKKGMTSSVAQLIKSSSPEVKIDDDKPYAELWMGTHPNGPSFI  55



>ref|XP_007920019.1| hypothetical protein MYCFIDRAFT_48216 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME87974.1| hypothetical protein MYCFIDRAFT_48216 [Pseudocercospora fijiensis 
CIRAD86]
Length=454

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSR--NTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            LLRL+C   +Y+WG+IG++S  AR  S   ++G  IQ+ +PYAE WMGTH S PS  +  
Sbjct  5    LLRLQCGCNSYEWGKIGKDSAAARFASATPSSGFSIQQDQPYAELWMGTHPSNPSKDLAT  64

Query  536  G  538
            G
Sbjct  65   G  65



>ref|XP_006822952.1| PREDICTED: mannose-6-phosphate isomerase-like [Saccoglossus kowalevskii]
Length=428

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARL-YSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            +  L+CA++ Y WGRIG +S VA+L  S +   ++Q+ KPYAE WMGTH SGPS ++
Sbjct  5    VFSLKCAIQQYAWGRIGEDSEVAKLSQSIDKSFQLQKDKPYAELWMGTHPSGPSQIL  61



>ref|NP_001041907.1| Os01g0127900 [Oryza sativa Japonica Group]
 dbj|BAB18294.1| putative mannose-6-phosphate isomerase [Oryza sativa Japonica 
Group]
 dbj|BAF03821.1| Os01g0127900 [Oryza sativa Japonica Group]
 dbj|BAG91810.1| unnamed protein product [Oryza sativa Japonica Group]
Length=428

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDE-IQEGKPYAEFWMGTHESGPSYVVVGG  538
            LRLRCAV++Y+WGR G  S VARL   N  D      +PYAE WMGTH S PS ++  G
Sbjct  18   LRLRCAVQHYEWGRRGEASLVARLSDANADDHGPDPARPYAELWMGTHPSAPSSLLADG  76



>ref|XP_002615302.1| hypothetical protein CLUG_04184 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ40056.1| hypothetical protein CLUG_04184 [Clavispora lusitaniae ATCC 42720]
Length=458

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSR-NTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            L R+ C  +NYDWG+IG  S VA+  ++ N    I E KPYAE WMGTH S PS VV   
Sbjct  23   LFRIDCGYQNYDWGKIGSSSAVAQYAAKSNPATVIDEKKPYAELWMGTHPSVPSKVVDEA  82

Query  539  APPPGRIAGNGLSNGVAKD  595
            A     + G  L + V+ D
Sbjct  83   A-----LEGKYLRDVVSSD  96



>ref|XP_780304.2| PREDICTED: mannose-6-phosphate isomerase-like [Strongylocentrotus 
purpuratus]
Length=431

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYV  526
            A++ LRCAV+ Y WGRIG +S VA L   +  D  +Q  +PYAE WMGTH  GPS V
Sbjct  5    AVVSLRCAVQQYAWGRIGLDSAVASLSQSSNKDFTLQADQPYAELWMGTHPKGPSIV  61



>ref|XP_004200422.1| Piso0_003008 [Millerozyma farinosa CBS 7064]
 ref|XP_004201053.1| Piso0_003008 [Millerozyma farinosa CBS 7064]
 emb|CCE80681.1| Piso0_003008 [Millerozyma farinosa CBS 7064]
 emb|CCE79916.1| Piso0_003008 [Millerozyma farinosa CBS 7064]
Length=440

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYS-RNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            + R+ C  +NYDWG+IG +S VAR  S  ++  ++ E KPYAE WMGTH S PS  V   
Sbjct  5    IFRINCGYQNYDWGKIGSKSAVARFASFSDSSVKVDESKPYAELWMGTHPSVPSKAVEAD  64

Query  539  A  541
            A
Sbjct  65   A  65



>gb|KER00636.1| hypothetical protein AUEXF2481DRAFT_548 [Aureobasidium subglaciale 
EXF-2481]
Length=448

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C   +Y+WG++G++S  AR  S    D  I+E KPYAE WMGTH S PS
Sbjct  5    LIRLQCGCNSYEWGKVGKDSAAARFASATPSDFSIEEEKPYAELWMGTHPSNPS  58



>gb|EPE02644.1| mannose-6-phosphate isomerase [Ophiostoma piceae UAMH 11346]
Length=449

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNT---GDEIQEGKPYAEFWMGTHESGPSYVVV  532
            L+RL+C V +YDWG++G +S VA  Y+  T   G  IQE KPYAE WMGTH S PS  V 
Sbjct  5    LIRLQCGVNSYDWGKVGSDS-VAAQYAEATPAGGFSIQEDKPYAELWMGTHPSNPSKDVQ  63

Query  533  GG  538
             G
Sbjct  64   TG  65



>gb|KEQ87513.1| mannose-6-phosphate isomerase [Aureobasidium pullulans EXF-150]
Length=448

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C   +Y+WG++G++S  AR  S    D  I+E KPYAE WMGTH S PS
Sbjct  5    LIRLQCGCNSYEWGKVGKQSAAARFASATPSDFSIEEEKPYAELWMGTHPSNPS  58



>ref|XP_004930563.1| PREDICTED: mannose-6-phosphate isomerase-like [Bombyx mori]
Length=404

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARL-YSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            + L+C   +YDWG++G ES VARL +S ++  +I + KPYAE WMGTH +GPS ++
Sbjct  1    MELQCKALHYDWGKVGSESIVARLLHSADSRIDIDQTKPYAELWMGTHPNGPSLII  56



>ref|XP_006623253.1| PREDICTED: mannose-6-phosphate isomerase-like, partial [Apis 
dorsata]
Length=245

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEI-QEGKPYAEFWMGTHESGPSYV  526
            + L+C V+ YDWG+ G +S VA L      D I  E KPYAE WMGTH +GPSY+
Sbjct  1    MELKCKVQTYDWGKYGIDSTVATLMKSANKDFILDEKKPYAELWMGTHPNGPSYI  55



>gb|KFH65394.1| phosphomannose isomerase type I [Mortierella verticillata NRRL 
6337]
Length=445

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            + RL C  ++YDWG+IG  S VAR  S +    +   KPYAE WMGTH SGPS V
Sbjct  8    IFRLDCKAQSYDWGKIGSASEVARFASSSPAFTVDNSKPYAELWMGTHPSGPSTV  62



>emb|CAX73569.1| mannose phosphate isomerase [Schistosoma japonicum]
Length=464

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 5/59 (8%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQE---GKPYAEFWMGTHESGPSYVV  529
            + RLRCA + YDWG+ G +S V +L  R++G +IQE    KPYAE WMGTH SGPS+++
Sbjct  1    MFRLRCAFQTYDWGKFGADSEVYKLL-RHSG-QIQELDGSKPYAELWMGTHVSGPSFLM  57



>ref|XP_003007952.1| mannose-6-phosphate isomerase [Verticillium alfalfae VaMs.102]
 gb|EEY16031.1| mannose-6-phosphate isomerase [Verticillium alfalfae VaMs.102]
Length=453

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSYVVVG  535
            L+RL+C V +Y+WG+ G ES  AR  +    D  E++  +PYAE WMGTH S PS  V  
Sbjct  6    LIRLQCGVNSYEWGKTGSESAAARFAATTPADGFEVKSDQPYAELWMGTHPSNPSKDVKS  65

Query  536  G  538
            G
Sbjct  66   G  66



>ref|XP_001749420.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85705.1| predicted protein, partial [Monosiga brevicollis MX1]
Length=304

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSR-NTGDEIQEGKPYAEFWMGTHESGPSYVVV  532
            +LR+RC V+ Y WG++G  S VA+L    NT  ++   KPYAE WMGTH   PS VV+
Sbjct  4    VLRMRCEVQQYAWGKLGAASAVAQLAQAGNTDFKLDADKPYAELWMGTHAKAPSKVVL  61



>ref|XP_009651556.1| mannose-6-phosphate isomerase [Verticillium dahliae VdLs.17]
 gb|EGY21084.1| mannose-6-phosphate isomerase [Verticillium dahliae VdLs.17]
Length=453

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSYVVVG  535
            L+RL+C V +Y+WG+ G ES  AR  +    D  E++  +PYAE WMGTH S PS  V  
Sbjct  6    LIRLQCGVNSYEWGKTGSESAAARFAATTPADGFEVKTDQPYAELWMGTHPSNPSKDVKS  65

Query  536  G  538
            G
Sbjct  66   G  66



>dbj|BAO41038.2| mannose-6-phosphate isomerase [Kluyveromyces marxianus DMKU3-1042]
Length=432

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  344  AGTGGALLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            AG+G  L RL    + YDWG+IG  S VA+  + +    +I+E KPYAE WMGTH   PS
Sbjct  2    AGSGSKLFRLDAGFQQYDWGKIGSSSAVAQFAAHSDPSVKIEEDKPYAELWMGTHHKVPS  61

Query  521  Y  523
            Y
Sbjct  62   Y  62



>ref|XP_003868823.1| Pmi1 phosphomannose isomerase [Candida orthopsilosis Co 90-125]
 emb|CCG25919.1| Pmi1 phosphomannose isomerase [Candida orthopsilosis]
Length=435

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSR-NTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L RL+C  +NYDWG+IG  S VA+   + +    I E KPYAE WMGTH S PS  +
Sbjct  5    LFRLQCGFQNYDWGKIGSSSAVAQFVKKSDPSITIDESKPYAELWMGTHPSVPSQAI  61



>dbj|GAM82182.1| hypothetical protein ANO11243_001610 [fungal sp. No.11243]
Length=450

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGKPYAEFWMGTHESGPS  520
            LLRL+C   +Y+WG++G++S  AR  +    D+  +++ KPYAE WMGTH S PS
Sbjct  5    LLRLQCGCNSYEWGKVGKDSAAARFAATTPADDFSVKDDKPYAELWMGTHPSNPS  59



>ref|XP_007723041.1| mannose-6-phosphate isomerase [Capronia coronata CBS 617.96]
 gb|EXJ90847.1| mannose-6-phosphate isomerase [Capronia coronata CBS 617.96]
Length=443

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGKPYAEFWMGTHESGPSYVVVG  535
            L RL+C   +YDWG+ G+ES  AR  +    D+  I+E KPYAE WMGTH S PS  +  
Sbjct  5    LFRLQCGCNSYDWGKKGKESAAARYAATTPSDDFTIKEDKPYAELWMGTHPSLPSKDLTT  64

Query  536  G  538
            G
Sbjct  65   G  65



>emb|CCE44802.1| hypothetical protein CPAR2_406050 [Candida parapsilosis]
Length=435

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSR-NTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L RL+C  +NYDWG+IG  S VA+   + +    I E KPYAE WMGTH S PS  +
Sbjct  5    LFRLQCGYQNYDWGKIGSSSAVAQFVKKSDPSITIDESKPYAELWMGTHPSVPSQAI  61



>gb|EFX81906.1| hypothetical protein DAPPUDRAFT_128126 [Daphnia pulex]
Length=407

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGAP  544
            + L C V+ Y WG++G+ S VA+L   N+   + E  PYAE WMGTH SGPS +     P
Sbjct  1    MELCCVVQKYAWGKVGQSSLVAQLSQGNSAAPVVEVDPYAELWMGTHPSGPSLIKTSNEP  60

Query  545  PPGRIAGNGLSNGVAKDK  598
                +  N  S G A+ K
Sbjct  61   LLNHLLNNVDSLGDAEKK  78



>ref|XP_003694263.1| PREDICTED: LOW QUALITY PROTEIN: mannose-6-phosphate isomerase-like 
[Apis florea]
Length=404

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEI-QEGKPYAEFWMGTHESGPSYV  526
            + L+C V+ YDWG+ G +S VA L      D I  E KPYAE WMGTH +GPSY+
Sbjct  1    MELKCKVQTYDWGKYGIDSTVATLMKSANSDFILDEKKPYAELWMGTHPNGPSYI  55



>emb|CEP08578.1| hypothetical protein [Parasitella parasitica]
Length=134

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
             A+ RL+C  ++YDWG++G  S VA  Y++ +G  + +  PYAE WMGTH + PS V+
Sbjct  2    SAIYRLQCKTQSYDWGKLGNVSKVA-AYAKASGTTVDDKTPYAELWMGTHPNAPSIVM  58



>ref|XP_007294418.1| putative mannose-6-phosphate isomerase [Marssonina brunnea f. 
sp. 'multigermtubi' MB_m1]
 gb|EKD15313.1| putative mannose-6-phosphate isomerase [Marssonina brunnea f. 
sp. 'multigermtubi' MB_m1]
Length=450

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGKPYAEFWMGTHESGPS  520
            L RL+C V +YDWG++G+ES  A   +    D+  IQE KPYAE WMGTH S PS
Sbjct  5    LFRLQCGVNSYDWGKVGKESAAAMFAAATPADDFSIQEDKPYAELWMGTHPSNPS  59



>ref|XP_623842.1| PREDICTED: mannose-6-phosphate isomerase-like isoform X3 [Apis 
mellifera]
 ref|XP_006572418.1| PREDICTED: mannose-6-phosphate isomerase-like isoform X1 [Apis 
mellifera]
 ref|XP_006572419.1| PREDICTED: mannose-6-phosphate isomerase-like isoform X2 [Apis 
mellifera]
Length=403

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGDEI-QEGKPYAEFWMGTHESGPSYV  526
            + L+C V+ YDWG+ G +S VA L      D I  E KPYAE WMGTH +GPSY+
Sbjct  1    MELKCKVQTYDWGKYGIDSTVATLMKSANSDFILDEKKPYAELWMGTHPNGPSYI  55



>ref|XP_002173848.1| mannose-6-phosphate isomerase [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB07555.1| mannose-6-phosphate isomerase [Schizosaccharomyces japonicus 
yFS275]
Length=411

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            + +L+C  K YDWGR+GR S  A      +   ++  KPYAE WMG+H SGPS+    G 
Sbjct  1    MFQLKCEAKCYDWGRVGRNSLAANFAEAGSDLIVENDKPYAELWMGSHTSGPSFCKQSGK  60

Query  542  P  544
            P
Sbjct  61   P  61



>ref|XP_457357.2| DEHA2B09350p [Debaryomyces hansenii CBS767]
 emb|CAG85361.2| DEHA2B09350p [Debaryomyces hansenii CBS767]
Length=441

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSR-NTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            L ++ C  +NYDWG++G  S VA+  S  N   +I E KPYAE WMGTH S PS  V  G
Sbjct  5    LFKIDCGYQNYDWGKVGSSSAVAQFASSANPNVKIDESKPYAELWMGTHPSVPSVAVDAG  64



>gb|EMG49367.1| Mannose-6-phosphate isomerase [Candida maltosa Xu316]
Length=440

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  350  TGGALLRLRCAVKNYDWGRIGRESGVARL-YSRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            T   L R++C  +NYDWG+IG  S VA+  ++ +    I E KPYAE WMGTH+S PS  
Sbjct  2    TSDKLFRIQCGYQNYDWGKIGSSSAVAQFAHNSDPSIVIDETKPYAELWMGTHKSVPSKA  61

Query  527  V  529
            +
Sbjct  62   I  62



>gb|EME49470.1| hypothetical protein DOTSEDRAFT_68288 [Dothistroma septosporum 
NZE10]
Length=450

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGKPYAEFWMGTHESGPSYVVVG  535
            LLRL+C   +Y+WG++G +S  AR  S     +  +Q+ KPYAE WMGTH S PS  +  
Sbjct  5    LLRLQCGCNSYEWGKVGNDSAAARFASATPSSDFSVQQDKPYAELWMGTHPSNPSKDLTT  64

Query  536  G  538
            G
Sbjct  65   G  65



>emb|CCD74651.1| putative mannose-6-phosphate isomerase [Schistosoma mansoni]
Length=477

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            + RL+CA + YDWG+IG  S V +L S+    E+   KPYAE WMGTH SGPS+++
Sbjct  1    MFRLKCAFQVYDWGKIGVNSEVYKLLSQTQ--ELDNLKPYAELWMGTHVSGPSFMM  54



>emb|CBJ28774.1| Mannose-6-phosphate isomerase [Ectocarpus siliculosus]
Length=325

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARL-YSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            + RL CAV+NY WG+ G++S V++L    N G E +E K YAE WMGTH +GPS V+   
Sbjct  1    MRRLNCAVQNYAWGKRGKDSMVSKLKMMENEGFETEEDKTYAELWMGTHPNGPSRVM---  57

Query  539  APPPGRIAG  565
             P PG  + 
Sbjct  58   -PEPGDFSA  65



>gb|EPX71061.1| mannose-6-phosphate isomerase [Schizosaccharomyces octosporus 
yFS286]
Length=411

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            + RL+C V  YDWGR+G  S  A+     +G E+ E KPYAE WMG++ S PS V+  G
Sbjct  1    MYRLKCQVMEYDWGRVGNNSLAAQFAKNGSGFEVNEEKPYAELWMGSYPSCPSTVIQTG  59



>gb|ACG45229.1| mannose-6-phosphate isomerase [Zea mays]
Length=437

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +2

Query  323  EVDGVPAAGTGGA--LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWM  496
            E D  P A       LLRLRCAV++Y+WG+ G  S VARL  +N        +PYAE WM
Sbjct  15   EPDPDPEASPAPPQRLLRLRCAVQHYEWGQRGAASLVARLADQNP----DPARPYAELWM  70

Query  497  GTHESGPSYVVVGG  538
            GTH S PS ++  G
Sbjct  71   GTHPSAPSTLLDDG  84



>ref|NP_001140535.1| uncharacterized protein LOC100272600 [Zea mays]
 gb|ACF84028.1| unknown [Zea mays]
 tpg|DAA53656.1| TPA: mannose-6-phosphate isomerase [Zea mays]
Length=437

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +2

Query  323  EVDGVPAAGTGGA--LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWM  496
            E D  P A       LLRLRCAV++Y+WG+ G  S VARL  +N        +PYAE WM
Sbjct  15   EPDPDPEASPAPPQRLLRLRCAVQHYEWGQRGAASLVARLADQNP----DPARPYAELWM  70

Query  497  GTHESGPSYVVVGG  538
            GTH S PS ++  G
Sbjct  71   GTHPSAPSTLLDDG  84



>gb|KHN73989.1| putative mannose-6-phosphate isomerase [Toxocara canis]
Length=768

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEI-QEGKPYAEFWMGTHESGPSYVVVGGAP  544
            +L C V+NYDWGR+G++S VA L      D I  + KPYAE WMG H +GPS +   G  
Sbjct  22   KLSCQVQNYDWGRLGKQSIVASLKQAAQKDFIVDDSKPYAELWMGVHPNGPSVLSTSGES  81

Query  545  PPGRIAGNGLSNGV  586
                IA +  S GV
Sbjct  82   LAAFIASHPSSLGV  95



>gb|KGB38300.1| putative mannose-6-phosphate isomerase [Schistosoma haematobium]
Length=477

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            + RL+CA + YDWG++G  S V +L S+    E+   KPYAE WMGTH SGPS+++
Sbjct  1    MFRLKCAFQVYDWGKVGVNSEVYKLLSQTQ--ELDNLKPYAELWMGTHVSGPSFMM  54



>ref|XP_004979620.1| PREDICTED: mannose-6-phosphate isomerase 2-like [Setaria italica]
Length=455

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +2

Query  323  EVDGVPAAGTGGALLRLRCAVKNYDWGRIGRESGVARL-YSRNTGDEIQEGKPYAEFWMG  499
            + +G PA    G L+RLRCAV++YDWGR G +S VARL           +G+P AE WMG
Sbjct  32   DTNGPPAPPMPG-LMRLRCAVQHYDWGRRGADSLVARLAAGEAGPGGADDGRPCAELWMG  90

Query  500  THESGPS  520
            TH S PS
Sbjct  91   THPSAPS  97



>gb|KIH91195.1| mannose-6-phosphate isomerase [Sporothrix brasiliensis 5110]
Length=462

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE---IQEGKPYAEFWMGTHESGPSYVVV  532
            L+RL+C V +YDWG+ G +S VA  Y+  T  E   IQE KPYAE WMGTH S PS  V 
Sbjct  5    LIRLQCGVNSYDWGKKGADS-VAAQYASATPAEGFSIQEDKPYAELWMGTHPSNPSKDVE  63

Query  533  GG  538
             G
Sbjct  64   TG  65



>gb|EAZ08978.1| hypothetical protein OsI_31243 [Oryza sativa Indica Group]
Length=421

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +2

Query  368  RLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            RLRCAV++Y+WGR G  S VARL  +   D     +PYAE WMGTH SGPS ++ G
Sbjct  13   RLRCAVQHYEWGRRGAASIVARLADQQDPD---LARPYAELWMGTHPSGPSTLLDG  65



>ref|XP_002418846.1| mannose-6-phosphate isomerase, putative; phosphohexomutase, putative; 
phosphomannose isomerase, putative [Candida dubliniensis 
CD36]
 emb|CAX44152.1| mannose-6-phosphate isomerase, putative [Candida dubliniensis 
CD36]
Length=441

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDESKPYAELWMGTHPSVPSKAI  62



>gb|KDN66154.1| putative phosphomannose isomerase type I [Colletotrichum sublineola]
Length=454

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRN--TGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            L +L+C V +Y+WG+ G ES  AR  S     G  IQ  KPYAE WMGTH S PS  V  
Sbjct  7    LFKLQCGVNSYEWGKKGEESAAARFASTTPPEGFSIQSEKPYAELWMGTHPSNPSKEVQS  66

Query  536  G  538
            G
Sbjct  67   G  67



>ref|XP_007673636.1| hypothetical protein BAUCODRAFT_31721 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC99403.1| hypothetical protein BAUCODRAFT_31721 [Baudoinia compniacensis 
UAMH 10762]
Length=465

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGKPYAEFWMGTHESGPS  520
            LLRL+C   +Y+WG+IG  S  AR  S    D+  IQ  KPYAE WMGTH S PS
Sbjct  6    LLRLQCGCNSYEWGKIGESSAAARYASVTPRDDFSIQSDKPYAELWMGTHPSNPS  60



>dbj|GAN06914.1| phosphomannose isomerase type I [Mucor ambiguus]
Length=422

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGG  538
            A+ RL+C  ++YDWG+ G  S VA  Y++ +G  + + KPY+E WMGTH + PS V+   
Sbjct  3    AIYRLQCKAQSYDWGKFGDVSKVAA-YAKASGATVDDKKPYSELWMGTHPNAPSIVMDES  61

Query  539  APPPGRIAGNG--LSNGVAKDKF  601
              P   +  N   LS     D++
Sbjct  62   KTPLSELIKNNADLSTKAVYDQY  84



>gb|KGR00547.1| mannose-6-phosphate isomerase [Candida albicans GC75]
 gb|KGU11248.1| mannose-6-phosphate isomerase [Candida albicans P87]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KHC72837.1| mannose-6-phosphate isomerase [Candida albicans P75016]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KHC66042.1| mannose-6-phosphate isomerase [Candida albicans P75010]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>ref|XP_714656.1| hypothetical protein CaO19.8968 [Candida albicans SC5314]
 gb|EAK95608.1| hypothetical protein CaO19.8968 [Candida albicans SC5314]
 gb|KHC88312.1| mannose-6-phosphate isomerase [Candida albicans SC5314]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KHC80739.1| mannose-6-phosphate isomerase [Candida albicans P78042]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KGR11799.1| mannose-6-phosphate isomerase [Candida albicans P57072]
 gb|KGU33034.1| mannose-6-phosphate isomerase [Candida albicans P75063]
 gb|KHC38549.1| mannose-6-phosphate isomerase [Candida albicans P76055]
 gb|KHC39993.1| mannose-6-phosphate isomerase [Candida albicans P76067]
 gb|KHC44666.1| mannose-6-phosphate isomerase [Candida albicans Ca6]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KHC54026.1| mannose-6-phosphate isomerase [Candida albicans P60002]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KGT70334.1| mannose-6-phosphate isomerase [Candida albicans 12C]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KGR13934.1| mannose-6-phosphate isomerase [Candida albicans P78048]
 gb|KGU15736.1| mannose-6-phosphate isomerase [Candida albicans L26]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KGU35531.1| mannose-6-phosphate isomerase [Candida albicans P57055]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KGU12950.1| mannose-6-phosphate isomerase [Candida albicans 19F]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KGQ95949.1| mannose-6-phosphate isomerase [Candida albicans P37005]
 gb|KGR20771.1| mannose-6-phosphate isomerase [Candida albicans P37037]
 gb|KHC81990.1| mannose-6-phosphate isomerase [Candida albicans SC5314]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KHC58058.1| mannose-6-phosphate isomerase [Candida albicans P37039]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|KGU29012.1| mannose-6-phosphate isomerase [Candida albicans P34048]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>ref|XP_714562.1| hypothetical protein CaO19.1390 [Candida albicans SC5314]
 sp|P34948.2|MPI_CANAL RecName: Full=Mannose-6-phosphate isomerase; AltName: Full=Phosphohexomutase; 
AltName: Full=Phosphomannose isomerase; Short=PMI 
[Candida albicans SC5314]
 emb|CAA57548.1| mannose-6-phosphate isomerase [Candida albicans]
 gb|EAK95509.1| hypothetical protein CaO19.1390 [Candida albicans SC5314]
 gb|EEQ47460.1| mannose-6-phosphate isomerase [Candida albicans WO-1]
 gb|KGQ89485.1| mannose-6-phosphate isomerase [Candida albicans P94015]
Length=441

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  6    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  62



>gb|EFZ22736.1| hypothetical protein SINV_15264 [Solenopsis invicta]
Length=411

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            + LRCAV+ Y WG++G  S VA L  S N    + E + YAE WMGTHE+GPSY+     
Sbjct  10   MELRCAVQTYSWGKLGMNSIVANLVKSVNDDFTVNEQENYAELWMGTHENGPSYLKDTDV  69

Query  542  PPPGRIAGNG  571
            P    I  N 
Sbjct  70   PLQKYIEENA  79



>pdb|1PMI|A Chain A, Candida Albicans Phosphomannose Isomerase
Length=440

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR-LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L R++C  +NYDWG+IG  S VA+ +++ +    I E KPYAE WMGTH S PS  +
Sbjct  5    LFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAI  61



>gb|EMF17849.1| mannose-6-phosphate isomerase [Sphaerulina musiva SO2202]
Length=453

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGKPYAEFWMGTHESGPS  520
            LLRL+C   +Y+WG++G +S  AR  +    ++  +Q+ KPYAE WMGTH S PS
Sbjct  5    LLRLQCGCNSYEWGKVGNDSAAARYAASTPSNDFSVQQDKPYAELWMGTHPSNPS  59



>gb|ABU62653.1| mannose-6-phosphate isomerase [Mytilus edulis]
Length=426

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  GTGGALLRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSY  523
            G    +  +RC+V+NY WG+ G  S VA+L  S +   +I E KPYAE WMGTH +GPS 
Sbjct  2    GDTERVFEIRCSVQNYAWGKHGSSSAVAQLAASADKNLKIDENKPYAELWMGTHSNGPSE  61

Query  524  VVVGG  538
            +   G
Sbjct  62   IYKDG  66



>ref|XP_011160040.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Solenopsis 
invicta]
 ref|XP_011160047.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Solenopsis 
invicta]
 ref|XP_011160054.1| PREDICTED: mannose-6-phosphate isomerase isoform X1 [Solenopsis 
invicta]
Length=402

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            + LRCAV+ Y WG++G  S VA L  S N    + E + YAE WMGTHE+GPSY+     
Sbjct  1    MELRCAVQTYSWGKLGMNSIVANLVKSVNDDFTVNEQENYAELWMGTHENGPSYLKDTDV  60

Query  542  PPPGRIAGNG  571
            P    I  N 
Sbjct  61   PLQKYIEENA  70



>gb|KFY93234.1| hypothetical protein V498_04527, partial [Pseudogymnoascus pannorum 
VKM F-4517 (FW-2822)]
Length=428

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>ref|XP_011262818.1| PREDICTED: mannose-6-phosphate isomerase [Camponotus floridanus]
 ref|XP_011262819.1| PREDICTED: mannose-6-phosphate isomerase [Camponotus floridanus]
 gb|EFN63894.1| Mannose-6-phosphate isomerase [Camponotus floridanus]
Length=401

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSYV  526
            + L+CA++ Y+WG+ G +S VA L  S NT   + E K YAE WMGTHE+GPSY+
Sbjct  1    MELKCAIQTYNWGKHGMDSIVATLMKSANTDFVVDEEKTYAELWMGTHENGPSYL  55



>emb|CDP94208.1| Protein Bm13978, isoform c [Brugia malayi]
Length=414

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = +2

Query  353  GGALLRLRCAVKNYDWGRIGRESGVARL-YSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            G  + +L CAV+ YDWGR G +S VA L ++ +    I+E KPYAE WMG H +GPS +V
Sbjct  18   GDEMEKLICAVQTYDWGRRGSQSEVAILMHAADKQFVIEETKPYAELWMGVHPNGPSKLV  77

Query  530  VGGAPPPGRIA  562
              G     +IA
Sbjct  78   SDGKLLSEKIA  88



>emb|CEI89889.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            ++ RL+C  ++YDWG++G  S VA  Y++ +G EI   KPYAE WMGTH + PS V+
Sbjct  3    SIYRLQCKPQSYDWGKLGDVSKVAA-YAKASGVEIDNSKPYAELWMGTHPNAPSIVL  58



>gb|ABX56011.1| mannose-6-phosphate isomerase [Mytilus edulis]
Length=426

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  GTGGALLRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSY  523
            G    +  +RC+V+NY WG+ G  S VA+L  S +   +I E KPYAE WMGTH +GPS 
Sbjct  2    GDTERVFEIRCSVQNYAWGKHGSSSAVAQLAASADKNLKIDENKPYAELWMGTHSNGPSE  61

Query  524  VVVGG  538
            +   G
Sbjct  62   IYKDG  66



>gb|ABX56010.1| mannose-6-phosphate isomerase [Mytilus edulis]
Length=426

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  GTGGALLRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSY  523
            G    +  +RC+V+NY WG+ G  S VA+L  S +   +I E KPYAE WMGTH +GPS 
Sbjct  2    GDTERVFEIRCSVQNYAWGKHGSSSAVAQLAASADKNLKIDENKPYAELWMGTHSNGPSE  61

Query  524  VVVGG  538
            +   G
Sbjct  62   IYKDG  66



>gb|KIH52704.1| hypothetical protein ANCDUO_17192 [Ancylostoma duodenale]
 gb|KIH55609.1| hypothetical protein ANCDUO_14229 [Ancylostoma duodenale]
Length=124

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            + RL C VK Y WG+ G ES VARL++    + E+ E + YAE WMGTH  GP+
Sbjct  1    MQRLECHVKKYKWGKQGSESEVARLFAAGHKNFEVDEDETYAELWMGTHPDGPA  54



>gb|ABX56009.1| mannose-6-phosphate isomerase [Mytilus edulis]
Length=426

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  GTGGALLRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSY  523
            G    +  +RC+V+NY WG+ G  S VA+L  S +   +I E KPYAE WMGTH +GPS 
Sbjct  2    GDTERVFEIRCSVQNYAWGKHGSSSAVAQLAASADKNLKIDENKPYAELWMGTHSNGPSE  61

Query  524  VVVGG  538
            +   G
Sbjct  62   IYKDG  66



>gb|EHJ72135.1| putative Mannose-6-phosphate isomerase [Danaus plexippus]
Length=403

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSR-NTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            + L C V+NY+WG+IG +S VA+L S  N    I   KPYAE WMGTH + PS ++  G 
Sbjct  1    MELECKVQNYEWGKIGLDSTVAKLISNANPSLTIYPEKPYAELWMGTHPNSPSLIIDRGV  60



>gb|KFY29906.1| hypothetical protein V494_08381 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=487

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVV  532
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS  V 
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPSKDVT  93



>gb|KFY22248.1| hypothetical protein V493_06732 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=487

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVV  532
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS  V 
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPSKDVT  93



>gb|EFQ31468.1| phosphomannose isomerase type I [Colletotrichum graminicola M1.001]
Length=454

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSR--NTGDEIQEGKPYAEFWMGTHESGPSYVVVG  535
            L +L+C V +Y+WG+ G ES  AR  +   + G  IQ  KPYAE WMGTH S PS  V  
Sbjct  7    LFKLQCGVNSYEWGKKGEESAAARFAATTPSEGFSIQSEKPYAELWMGTHPSNPSKEVQS  66

Query  536  G  538
            G
Sbjct  67   G  67



>gb|KFY07372.1| hypothetical protein V492_07204 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=487

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVV  532
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS  V 
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPSKDVT  93



>gb|ELR04529.1| phosphomannose isomerase type I [Pseudogymnoascus destructans 
20631-21]
Length=487

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  AR  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAARFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|ABU62655.1| mannose-6-phosphate isomerase [Mytilus trossulus]
Length=426

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +2

Query  347  GTGGALLRLRCAVKNYDWGRIGRESGVARLY-SRNTGDEIQEGKPYAEFWMGTHESGPSY  523
            G    +  +RC+V+NY WG+ G  S VA+L  S +   +I E KPYAE WMGTH +GPS 
Sbjct  2    GDTERVFEIRCSVQNYAWGKHGSSSAVAQLAASADKNLKIDENKPYAELWMGTHPNGPSE  61

Query  524  VVVGG  538
            +   G
Sbjct  62   IYKDG  66



>ref|XP_007514601.1| mannose-6-phosphate isomerase [Bathycoccus prasinos]
 emb|CCO14841.1| mannose-6-phosphate isomerase [Bathycoccus prasinos]
Length=415

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +2

Query  356  GALLRLRCAVKNYDWGRIGRE-SGVARLYSRNTGDEIQEGKPYAEFWMGTHESG  514
            GAL++L+CA+++YDWG  G+  S VA L S N  ++I E KP+AE WMGTH SG
Sbjct  4    GALVQLKCAIQHYDWGVSGQTPSAVAELGSLNREEKIDEEKPHAELWMGTHLSG  57



>emb|CCG82227.1| Mannose-6-phosphate isomerase [Taphrina deformans PYCC 5710]
Length=444

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVAR--LYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            L +L+C V  Y+WG+IG++S  AR  L +     ++++ KPYAE WMGTH S PS V+
Sbjct  7    LFQLQCEVNEYEWGKIGKDSKAARFALSTEEAKFDLKDDKPYAELWMGTHSSAPSRVL  64



>gb|KFZ14708.1| hypothetical protein V501_03099 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=485

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|KFZ03104.1| hypothetical protein V502_11222 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=487

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|KFY83685.1| hypothetical protein V500_10015 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=487

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|KFY11112.1| hypothetical protein V491_07342, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=497

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  46   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  99



>gb|KFX95148.1| hypothetical protein O988_05954 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=487

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|KFX88290.1| hypothetical protein V490_07730 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=487

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|KFY37598.1| hypothetical protein V495_07069 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY57615.1| hypothetical protein V497_05459 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=487

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|EGI59455.1| Mannose-6-phosphate isomerase [Acromyrmex echinatior]
Length=532

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            + L+CAV+ Y WG++G  S VA L      D  + E K YAE WMGTHE+GPSY+     
Sbjct  133  MELKCAVQTYAWGKLGMNSIVASLIKSANADFVVDEQKTYAELWMGTHENGPSYLKDTDI  192

Query  542  PPPGRIAGN  568
            P    I  N
Sbjct  193  PLQKYIQEN  201



>gb|KFY79299.1| hypothetical protein V499_01715 [Pseudogymnoascus pannorum VKM 
F-103]
Length=487

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>gb|ELU00241.1| hypothetical protein CAPTEDRAFT_229052 [Capitella teleta]
Length=401

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRN--TGDEIQEGKPYAEFWMGTHESGPSY  523
            A+  LRCAV+ Y WG++G  S VA L SRN   G ++ E  PYAE WMGTH  GP +
Sbjct  6    AVFPLRCAVQQYAWGKLGSSSAVADL-SRNDDPGFQLDESAPYAELWMGTHPKGPCF  61



>ref|XP_007796865.1| putative mannose-6-phosphate isomerase protein [Eutypa lata UCREL1]
 gb|EMR64037.1| putative mannose-6-phosphate isomerase protein [Eutypa lata UCREL1]
Length=457

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSYVVVG  535
            L+RL+C V +YDWG++G ES  A+  +    +   IQ  KPYAE WMGTH S PS  VV 
Sbjct  6    LIRLQCGVNSYDWGKVGSESAAAKFAAATPSETLNIQSDKPYAELWMGTHPSNPSKDVVT  65

Query  536  G  538
            G
Sbjct  66   G  66



>gb|KFY58531.1| hypothetical protein V496_06097 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=487

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPS  520
            L+RL+C V +YDWG++G +S  A+  +    D  IQE KPYAE WMGTH S PS
Sbjct  36   LIRLQCGVNSYDWGKVGNDSAAAKFAAATPSDFSIQEEKPYAELWMGTHPSNPS  89



>ref|XP_003060607.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55376.1| predicted protein [Micromonas pusilla CCMP1545]
Length=444

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 44/78 (56%), Gaps = 10/78 (13%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            +L L CAV+NYDWG +G +S V+ L   N G      KP+AE WMGTH SGPS VV  GA
Sbjct  2    VLALTCAVQNYDWGVVG-DSEVSSLGEANAGVASDATKPHAELWMGTHPSGPSVVVGTGA  60

Query  542  PPPGRIAGNGLSNGVAKD  595
                     GL   +A D
Sbjct  61   ---------GLKETIASD  69



>emb|CEG82939.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            ++ RL+C  ++YDWG++G  S VA  Y++ +G E+   KPYAE WMGTH + PS V+
Sbjct  3    SIYRLQCKPQSYDWGKLGDVSKVAA-YAKASGVEVDNSKPYAELWMGTHPNAPSIVL  58



>emb|CEI87990.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            ++ RL+C  ++YDWG++G  S VA  Y++ +G E+   KPYAE WMGTH + PS V+
Sbjct  3    SIYRLQCKPQSYDWGKLGDVSKVAA-YAKASGVEVDNSKPYAELWMGTHPNAPSIVL  58



>gb|EYE99727.1| mannose-6-phosphate isomerase, class I [Aspergillus ruber CBS 
135680]
Length=403

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVG  535
            A+++LRC VKN  WG+ G+E   A+L+S+  G+ +I++ K Y+E WMGT+ + PSYV+  
Sbjct  4    AVVQLRCGVKNDGWGKPGKEGMAAKLWSQTPGNGQIEDSKTYSEMWMGTYPTNPSYVLST  63

Query  536  G  538
            G
Sbjct  64   G  64



>emb|CEG73470.1| Putative Mannose-6-phosphate isomerase [Rhizopus microsporus]
Length=416

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  359  ALLRLRCAVKNYDWGRIGRESGVARLYSRNTGDEIQEGKPYAEFWMGTHESGPSYVV  529
            ++ RL+C  ++YDWG++G  S VA  Y++ +G E+   KPYAE WMGTH + PS V+
Sbjct  3    SIYRLQCKPQSYDWGKLGDVSKVAA-YAKASGVEVDNSKPYAELWMGTHPNAPSIVL  58



>ref|XP_001224504.1| hypothetical protein CHGG_06848 [Chaetomium globosum CBS 148.51]
 gb|EAQ85595.1| hypothetical protein CHGG_06848 [Chaetomium globosum CBS 148.51]
Length=453

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGDE--IQEGKPYAEFWMGTHESGPSYVVVG  535
            L+RL+C   +Y+WG+ G  S VAR  +     +  IQ+ KPYAE WMGTH S PS  V  
Sbjct  5    LIRLQCGANSYEWGKKGNSSAVARFAAATPSADFSIQDDKPYAELWMGTHPSNPSKDVTT  64

Query  536  G  538
            G
Sbjct  65   G  65



>ref|XP_011064085.1| PREDICTED: mannose-6-phosphate isomerase isoform X2 [Acromyrmex 
echinatior]
 ref|XP_011064086.1| PREDICTED: mannose-6-phosphate isomerase isoform X2 [Acromyrmex 
echinatior]
 ref|XP_011064087.1| PREDICTED: mannose-6-phosphate isomerase isoform X2 [Acromyrmex 
echinatior]
Length=400

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +2

Query  365  LRLRCAVKNYDWGRIGRESGVARLYSRNTGD-EIQEGKPYAEFWMGTHESGPSYVVVGGA  541
            + L+CAV+ Y WG++G  S VA L      D  + E K YAE WMGTHE+GPSY+     
Sbjct  1    MELKCAVQTYAWGKLGMNSIVASLIKSANADFVVDEQKTYAELWMGTHENGPSYLKDTDI  60

Query  542  PPPGRIAGN  568
            P    I  N
Sbjct  61   PLQKYIQEN  69



>gb|ENH82186.1| mannose-6-phosphate isomerase [Colletotrichum orbiculare MAFF 
240422]
Length=454

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +2

Query  362  LLRLRCAVKNYDWGRIGRESGVARLYSRNTGD--EIQEGKPYAEFWMGTHESGPSYVVVG  535
            L +L+C V +Y+WG+ G +S  AR  +    +   IQ  KPYAE WMGTH S PS  V  
Sbjct  7    LFKLQCGVNSYEWGKTGEDSAAARFAATTPAEGFNIQSDKPYAELWMGTHPSNPSKDVQS  66

Query  536  G  538
            G
Sbjct  67   G  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380